# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 20.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 259 330 11.4443 14.3054 21.4581 82.7317 Constraint 210 330 10.9683 13.7104 20.5655 82.7317 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 176 330 12.3757 15.4696 23.2044 82.7317 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 429 12.8937 16.1171 24.1756 82.3719 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 285 429 12.1123 15.1404 22.7106 82.0719 Constraint 210 429 9.4285 11.7856 17.6784 82.0719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 242 330 12.8767 16.0959 24.1438 81.7861 Constraint 182 429 12.6807 15.8509 23.7763 81.3738 Constraint 259 341 11.1402 13.9253 20.8879 81.3023 Constraint 210 341 12.4189 15.5236 23.2854 81.3023 Constraint 182 341 10.9744 13.7180 20.5770 81.3023 Constraint 303 404 13.0759 16.3449 24.5173 81.2632 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 404 10.3703 12.9628 19.4442 81.2632 Constraint 210 404 11.2483 14.0603 21.0905 81.2632 Constraint 285 355 9.7587 12.1983 18.2975 80.7947 Constraint 242 341 12.8247 16.0308 24.0462 80.3567 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 292 412 8.9687 11.2109 16.8164 80.2786 Constraint 285 412 9.2274 11.5342 17.3014 80.2786 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 259 429 10.8417 13.5521 20.3282 80.0717 Constraint 285 350 7.4395 9.2994 13.9491 80.0270 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 259 399 9.5368 11.9210 17.8816 79.8809 Constraint 210 399 10.4189 13.0236 19.5354 79.8809 Constraint 182 399 12.8371 16.0464 24.0696 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 169 330 13.0762 16.3452 24.5178 79.7779 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 259 421 7.0821 8.8527 13.2790 79.3366 Constraint 292 435 11.4233 14.2791 21.4187 79.0892 Constraint 285 435 12.8430 16.0537 24.0805 79.0892 Constraint 182 435 13.4735 16.8419 25.2628 79.0892 Constraint 242 399 8.5018 10.6273 15.9409 78.9353 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 210 421 5.9785 7.4732 11.2097 78.6385 Constraint 182 421 9.1384 11.4230 17.1344 78.6385 Constraint 176 421 11.2273 14.0341 21.0511 78.6385 Constraint 279 421 11.7373 14.6716 22.0074 78.5809 Constraint 279 341 8.7088 10.8860 16.3290 78.5094 Constraint 272 341 11.2548 14.0685 21.1027 78.5094 Constraint 267 341 11.0384 13.7980 20.6970 78.5094 Constraint 242 429 8.3095 10.3869 15.5804 78.3910 Constraint 242 421 5.1199 6.3998 9.5997 78.3910 Constraint 303 442 12.9800 16.2250 24.3375 78.3870 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 259 350 10.0788 12.5985 18.8978 78.3081 Constraint 210 350 12.1770 15.2213 22.8319 78.3081 Constraint 182 350 11.6789 14.5987 21.8980 78.3081 Constraint 221 341 12.0222 15.0278 22.5416 78.3023 Constraint 242 404 8.2394 10.2992 15.4488 78.2988 Constraint 292 355 11.0112 13.7640 20.6459 78.0595 Constraint 221 404 12.4000 15.5000 23.2500 77.9632 Constraint 161 242 13.1421 16.4276 24.6413 77.9592 Constraint 297 442 12.1653 15.2067 22.8100 77.7557 Constraint 259 412 6.8686 8.5857 12.8786 77.5617 Constraint 182 412 11.7161 14.6451 21.9676 77.5617 Constraint 201 330 14.0070 17.5087 26.2631 77.5025 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 242 350 11.6312 14.5390 21.8085 77.3625 Constraint 279 399 13.4741 16.8426 25.2639 77.0880 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 221 399 11.5527 14.4409 21.6613 76.8809 Constraint 182 355 14.1702 17.7128 26.5692 76.8450 Constraint 272 399 13.7079 17.1348 25.7022 76.6832 Constraint 237 429 9.8523 12.3154 18.4731 76.6784 Constraint 210 412 8.0753 10.0941 15.1412 76.5453 Constraint 128 303 11.5995 14.4993 21.7490 76.5309 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 285 11.3731 14.2164 21.3246 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 267 13.8683 17.3354 26.0031 76.5309 Constraint 104 259 12.2704 15.3380 23.0069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 279 412 12.8178 16.0223 24.0334 76.4877 Constraint 221 429 11.7473 14.6841 22.0261 76.3549 Constraint 210 435 9.2240 11.5300 17.2949 76.3539 Constraint 176 429 14.0885 17.6107 26.4160 76.3384 Constraint 161 237 10.7659 13.4574 20.1860 76.2466 Constraint 314 442 9.9883 12.4854 18.7281 76.1419 Constraint 190 341 14.3884 17.9855 26.9783 76.0731 Constraint 128 279 12.5636 15.7045 23.5567 75.9352 Constraint 104 279 12.7940 15.9926 23.9888 75.9352 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 176 341 14.8620 18.5775 27.8663 75.7314 Constraint 169 421 8.9878 11.2348 16.8522 75.7127 Constraint 237 421 7.4477 9.3096 13.9644 75.6803 Constraint 201 429 12.4930 15.6162 23.4244 75.6803 Constraint 201 421 9.7702 12.2128 18.3192 75.6803 Constraint 190 421 11.1614 13.9518 20.9276 75.6803 Constraint 128 267 12.6240 15.7801 23.6701 75.6352 Constraint 242 412 4.3877 5.4846 8.2268 75.5997 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 330 412 14.3025 17.8781 26.8172 75.5796 Constraint 237 404 10.6022 13.2527 19.8791 75.5698 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 272 13.0259 16.2824 24.4236 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 272 421 10.4808 13.1010 19.6515 75.5457 Constraint 267 421 10.5227 13.1533 19.7300 75.5457 Constraint 279 350 9.1911 11.4889 17.2334 75.5152 Constraint 272 350 11.5500 14.4375 21.6562 75.5152 Constraint 250 421 8.7290 10.9113 16.3670 75.5018 Constraint 169 429 10.9802 13.7253 20.5879 75.4127 Constraint 242 435 7.3211 9.1514 13.7270 75.4083 Constraint 322 435 13.1473 16.4341 24.6512 75.3822 Constraint 221 421 7.8416 9.8020 14.7031 75.3386 Constraint 221 350 11.7683 14.7104 22.0656 75.3081 Constraint 279 355 11.9254 14.9067 22.3601 75.0685 Constraint 292 442 8.3884 10.4854 15.7282 75.0205 Constraint 285 442 10.7034 13.3792 20.0688 75.0205 Constraint 259 442 8.2727 10.3409 15.5113 75.0205 Constraint 210 442 5.4866 6.8583 10.2874 75.0205 Constraint 182 442 9.7964 12.2455 18.3682 75.0205 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 350 412 11.9101 14.8876 22.3314 74.8711 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 237 399 11.3527 14.1909 21.2863 74.4874 Constraint 267 404 13.8086 17.2607 25.8911 74.4830 Constraint 272 412 11.8147 14.7683 22.1525 74.4688 Constraint 267 412 10.6206 13.2758 19.9137 74.4688 Constraint 297 429 12.9984 16.2480 24.3720 74.4680 Constraint 250 404 10.0159 12.5199 18.7798 74.3932 Constraint 221 435 11.4092 14.2615 21.3923 74.3703 Constraint 259 435 10.3546 12.9432 19.4148 74.3537 Constraint 161 322 12.4471 15.5588 23.3382 74.2406 Constraint 242 355 12.7917 15.9896 23.9843 74.1253 Constraint 242 442 5.0966 6.3707 9.5561 74.0749 Constraint 272 355 14.1765 17.7206 26.5809 74.0522 Constraint 322 442 10.8722 13.5903 20.3854 74.0487 Constraint 250 399 10.9015 13.6269 20.4403 74.0089 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 272 13.1702 16.4628 24.6942 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 272 14.7221 18.4027 27.6040 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 190 14.0933 17.6166 26.4250 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 237 12.3132 15.3916 23.0873 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 341 412 13.7376 17.1720 25.7580 73.8689 Constraint 210 355 14.0029 17.5037 26.2555 73.8451 Constraint 250 429 11.3973 14.2466 21.3700 73.7146 Constraint 169 412 11.3895 14.2368 21.3552 73.6195 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 237 412 6.9422 8.6777 13.0166 73.5871 Constraint 201 412 11.0577 13.8221 20.7332 73.5871 Constraint 190 412 12.4721 15.5901 23.3852 73.5871 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 250 412 6.2222 7.7777 11.6665 73.4086 Constraint 169 404 13.9261 17.4076 26.1114 73.3470 Constraint 176 412 13.3127 16.6409 24.9613 73.2454 Constraint 221 412 8.6476 10.8094 16.2142 73.2453 Constraint 201 399 14.1680 17.7099 26.5649 73.0845 Constraint 259 355 11.5361 14.4201 21.6302 73.0707 Constraint 169 399 13.3362 16.6702 25.0053 72.8304 Constraint 226 421 9.8794 12.3493 18.5239 72.6803 Constraint 237 330 15.1291 18.9114 28.3671 72.6656 Constraint 267 350 10.3356 12.9194 19.3792 72.6034 Constraint 279 442 13.5406 16.9257 25.3886 72.5772 Constraint 267 435 14.2938 17.8672 26.8008 72.5772 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 226 330 15.1305 18.9131 28.3696 72.5023 Constraint 169 442 7.3068 9.1335 13.7002 72.0946 Constraint 221 442 8.0438 10.0548 15.0822 72.0205 Constraint 237 435 7.5949 9.4936 14.2404 71.9085 Constraint 250 435 9.4344 11.7930 17.6895 71.7300 Constraint 201 404 14.3280 17.9100 26.8651 71.5717 Constraint 226 404 13.5112 16.8890 25.3335 71.5717 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 279 11.9043 14.8803 22.3205 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 267 12.2068 15.2585 22.8877 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 88 176 13.2501 16.5626 24.8439 71.4377 Constraint 169 435 10.8425 13.5531 20.3296 71.3349 Constraint 122 259 12.1650 15.2062 22.8094 71.3017 Constraint 161 314 14.8803 18.6004 27.9006 71.2385 Constraint 176 442 9.9076 12.3845 18.5768 71.1401 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 259 382 9.4031 11.7538 17.6308 71.1209 Constraint 267 355 12.6314 15.7892 23.6838 71.0636 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 226 429 12.9025 16.1281 24.1921 70.8931 Constraint 341 429 14.1086 17.6357 26.4536 70.8771 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 113 221 13.4325 16.7907 25.1860 70.8727 Constraint 104 226 13.5350 16.9187 25.3781 70.8727 Constraint 221 355 13.7917 17.2397 25.8595 70.8564 Constraint 190 429 14.5235 18.1544 27.2315 70.6883 Constraint 330 429 13.7306 17.1633 25.7449 70.5876 Constraint 226 412 9.5531 11.9414 17.9120 70.5871 Constraint 237 442 4.4317 5.5396 8.3094 70.5751 Constraint 201 442 7.5016 9.3770 14.0654 70.5751 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 161 259 14.7212 18.4015 27.6023 70.4950 Constraint 272 442 11.1233 13.9042 20.8562 70.4404 Constraint 267 442 11.7218 14.6523 21.9784 70.4404 Constraint 250 442 8.0056 10.0069 15.0104 70.3965 Constraint 272 429 14.1986 17.7483 26.6224 70.3771 Constraint 144 292 12.8734 16.0918 24.1377 70.3651 Constraint 122 242 9.8082 12.2603 18.3904 70.3561 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 104 435 13.8044 17.2555 25.8833 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 226 399 13.7389 17.1737 25.7605 70.1893 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 201 435 11.3410 14.1763 21.2644 69.8153 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 272 435 14.4077 18.0096 27.0144 69.5772 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 259 391 6.3854 7.9818 11.9727 69.4020 Constraint 210 382 12.5022 15.6278 23.4417 69.4020 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 104 421 9.3511 11.6889 17.5334 69.3154 Constraint 182 404 14.1845 17.7306 26.5960 69.2824 Constraint 176 435 13.9340 17.4175 26.1263 69.2606 Constraint 303 449 12.9984 16.2479 24.3719 69.0771 Constraint 136 242 12.6935 15.8668 23.8002 69.0417 Constraint 161 421 12.8166 16.0208 24.0311 68.9723 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 88 201 13.3038 16.6297 24.9446 68.7794 Constraint 104 341 10.4366 13.0457 19.5686 68.7632 Constraint 128 330 10.5075 13.1344 19.7016 68.7223 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 88 161 13.1158 16.3948 24.5921 68.5258 Constraint 190 442 10.0612 12.5765 18.8647 68.4818 Constraint 242 382 8.5418 10.6772 16.0158 68.4564 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 221 12.9491 16.1863 24.2795 68.4377 Constraint 210 391 9.3049 11.6311 17.4467 68.3856 Constraint 182 391 11.5390 14.4238 21.6357 68.3856 Constraint 136 429 13.0116 16.2645 24.3967 68.3448 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 122 285 13.0894 16.3617 24.5425 68.3017 Constraint 122 226 12.0924 15.1155 22.6733 68.3017 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 128 404 13.0213 16.2766 24.4149 68.2385 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 297 449 11.9999 14.9999 22.4999 68.0790 Constraint 292 449 9.0784 11.3480 17.0220 68.0790 Constraint 285 449 12.0285 15.0356 22.5535 68.0607 Constraint 250 341 14.9969 18.7461 28.1192 67.9985 Constraint 88 242 11.2326 14.0407 21.0611 67.9211 Constraint 122 303 13.3939 16.7423 25.1135 67.8823 Constraint 113 303 13.8441 17.3052 25.9578 67.8823 Constraint 259 375 11.5306 14.4133 21.6199 67.8226 Constraint 128 250 12.7422 15.9277 23.8916 67.8211 Constraint 136 314 11.5861 14.4826 21.7239 67.6287 Constraint 128 435 11.1307 13.9134 20.8701 67.5965 Constraint 128 421 7.6399 9.5499 14.3248 67.5965 Constraint 144 237 11.9154 14.8942 22.3413 67.5284 Constraint 136 303 14.0321 17.5402 26.3103 67.4767 Constraint 242 391 6.0876 7.6095 11.4143 67.4400 Constraint 237 382 11.6357 14.5447 21.8170 67.3876 Constraint 267 429 14.2575 17.8219 26.7329 67.3867 Constraint 267 382 12.3762 15.4702 23.2054 67.3299 Constraint 297 404 14.0705 17.5882 26.3823 67.2741 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 292 360 8.1736 10.2170 15.3256 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 96 435 10.6424 13.3030 19.9544 67.2404 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 242 449 7.9537 9.9421 14.9132 67.1152 Constraint 259 449 10.4158 13.0198 19.5297 67.0627 Constraint 210 449 6.3314 7.9142 11.8713 67.0627 Constraint 182 449 9.9070 12.3837 18.5756 67.0627 Constraint 176 449 10.5625 13.2031 19.8046 67.0627 Constraint 128 341 12.7068 15.8835 23.8253 67.0443 Constraint 250 375 12.5102 15.6378 23.4567 66.9860 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 190 435 13.9877 17.4846 26.2270 66.9084 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 226 435 10.9845 13.7306 20.5959 66.8153 Constraint 88 341 12.1322 15.1653 22.7479 66.7795 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 122 429 8.2149 10.2687 15.4030 66.6571 Constraint 113 429 11.2160 14.0200 21.0300 66.6571 Constraint 136 421 11.4126 14.2658 21.3987 66.6259 Constraint 104 350 11.3125 14.1407 21.2110 66.6210 Constraint 267 391 9.4718 11.8398 17.7597 66.6091 Constraint 128 399 11.4168 14.2710 21.4065 66.4513 Constraint 136 237 11.7388 14.6735 22.0102 66.3834 Constraint 161 429 13.9934 17.4917 26.2376 66.3500 Constraint 104 442 11.0401 13.8001 20.7002 66.2630 Constraint 237 391 9.6347 12.0434 18.0651 66.1731 Constraint 201 391 12.8242 16.0302 24.0454 66.1731 Constraint 190 391 13.0696 16.3370 24.5055 66.1731 Constraint 314 449 9.3186 11.6482 17.4724 66.1652 Constraint 153 297 13.4446 16.8058 25.2087 66.1384 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 272 13.1853 16.4816 24.7224 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 122 330 12.6316 15.7895 23.6842 66.0641 Constraint 113 330 11.8512 14.8139 22.2209 66.0641 Constraint 297 368 12.8207 16.0259 24.0388 66.0374 Constraint 96 250 12.5397 15.6746 23.5118 66.0357 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 272 391 11.1920 13.9900 20.9850 65.6110 Constraint 210 375 13.8805 17.3507 26.0260 65.6084 Constraint 330 442 14.2139 17.7674 26.6511 65.6030 Constraint 250 382 8.9880 11.2350 16.8524 65.5671 Constraint 259 360 8.3283 10.4104 15.6156 65.5329 Constraint 96 412 9.6791 12.0989 18.1483 65.5215 Constraint 128 412 11.0519 13.8149 20.7224 65.5032 Constraint 104 412 13.2236 16.5294 24.7942 65.5032 Constraint 226 442 7.4966 9.3707 14.0561 65.4818 Constraint 113 237 12.5383 15.6729 23.5093 65.4629 Constraint 221 382 12.2254 15.2818 22.9227 65.4039 Constraint 221 391 9.0121 11.2651 16.8977 65.3856 Constraint 88 350 11.7848 14.7309 22.0964 65.3399 Constraint 144 221 13.6465 17.0581 25.5871 65.2719 Constraint 128 442 7.7734 9.7168 14.5752 65.2649 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 88 404 11.9222 14.9028 22.3542 65.2385 Constraint 297 382 14.1301 17.6626 26.4938 65.1318 Constraint 169 449 6.9142 8.6427 12.9641 65.1215 Constraint 96 355 10.5335 13.1669 19.7503 65.0664 Constraint 122 435 10.1550 12.6937 19.0405 64.9382 Constraint 122 421 7.5370 9.4212 14.1319 64.9382 Constraint 113 421 10.3493 12.9367 19.4050 64.9382 Constraint 113 242 12.4824 15.6029 23.4044 64.7831 Constraint 113 435 13.6856 17.1070 25.6604 64.6382 Constraint 250 391 7.7323 9.6654 14.4981 64.5508 Constraint 210 360 10.2468 12.8085 19.2127 64.5166 Constraint 182 360 11.5636 14.4545 21.6818 64.5166 Constraint 279 360 10.8108 13.5135 20.2702 64.4590 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 226 391 11.3531 14.1913 21.2870 64.3876 Constraint 341 449 14.5025 18.1281 27.1921 64.3446 Constraint 350 449 13.2753 16.5941 24.8911 64.1986 Constraint 96 442 8.4835 10.6044 15.9066 64.1880 Constraint 190 399 15.0102 18.7627 28.1441 64.0955 Constraint 322 449 9.3455 11.6819 17.5228 64.0720 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 153 314 12.8736 16.0920 24.1380 64.0452 Constraint 330 449 13.2472 16.5590 24.8385 64.0038 Constraint 122 404 11.8049 14.7561 22.1342 63.8613 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 136 442 11.2976 14.1220 21.1830 63.6986 Constraint 303 435 14.2857 17.8571 26.7856 63.6495 Constraint 136 435 14.3455 17.9319 26.8979 63.6369 Constraint 113 442 11.6826 14.6032 21.9049 63.6048 Constraint 242 368 9.4875 11.8593 17.7890 63.5710 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 88 435 12.0776 15.0970 22.6456 63.5196 Constraint 88 421 8.4637 10.5796 15.8694 63.5196 Constraint 88 412 12.2405 15.3007 22.9510 63.5196 Constraint 161 442 10.4831 13.1039 19.6558 63.4584 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 237 368 13.2565 16.5706 24.8560 63.3022 Constraint 237 360 12.1154 15.1442 22.7164 63.3022 Constraint 210 368 12.7740 15.9675 23.9512 63.3022 Constraint 201 360 14.2386 17.7982 26.6973 63.3022 Constraint 190 360 14.1626 17.7033 26.5550 63.3022 Constraint 88 285 12.6449 15.8061 23.7092 63.2937 Constraint 350 442 13.6510 17.0637 25.5955 63.2556 Constraint 279 368 12.5851 15.7313 23.5970 63.2445 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 153 242 10.7659 13.4574 20.1861 63.0996 Constraint 128 461 8.9577 11.1971 16.7956 63.0253 Constraint 104 461 10.6271 13.2839 19.9259 63.0253 Constraint 237 375 14.1486 17.6857 26.5285 62.8732 Constraint 88 272 14.3213 17.9016 26.8524 62.8647 Constraint 122 412 11.0817 13.8522 20.7783 62.8450 Constraint 113 412 14.2790 17.8488 26.7732 62.8450 Constraint 113 399 12.5040 15.6299 23.4449 62.7767 Constraint 136 330 11.9293 14.9116 22.3674 62.7320 Constraint 144 226 14.1016 17.6270 26.4405 62.7009 Constraint 237 449 7.6898 9.6122 14.4183 62.6173 Constraint 201 449 8.9463 11.1829 16.7744 62.6173 Constraint 190 449 11.7207 14.6509 21.9764 62.6173 Constraint 122 442 8.1662 10.2078 15.3117 62.6067 Constraint 272 449 12.4876 15.6095 23.4142 62.4826 Constraint 161 435 13.8017 17.2522 25.8783 62.4696 Constraint 279 382 13.8810 17.3512 26.0268 62.3390 Constraint 355 442 14.6962 18.3702 27.5553 62.3152 Constraint 104 449 8.7198 10.8998 16.3496 62.3045 Constraint 144 314 13.3736 16.7170 25.0755 62.2815 Constraint 144 297 14.3355 17.9194 26.8791 62.2815 Constraint 221 449 9.7716 12.2145 18.3217 62.2755 Constraint 104 404 14.2310 17.7887 26.6830 62.2481 Constraint 322 382 13.4208 16.7760 25.1640 62.2200 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 136 461 11.2644 14.0806 21.1208 62.0547 Constraint 136 259 13.8023 17.2528 25.8792 61.9967 Constraint 136 285 14.3248 17.9060 26.8589 61.9037 Constraint 272 360 11.7253 14.6566 21.9849 61.7237 Constraint 267 360 10.4452 13.0565 19.5848 61.7237 Constraint 250 368 10.4329 13.0411 19.5617 61.6799 Constraint 250 360 10.9151 13.6439 20.4658 61.6799 Constraint 221 368 12.2616 15.3271 22.9906 61.5166 Constraint 221 360 10.3388 12.9235 19.3853 61.5166 Constraint 153 330 14.9738 18.7172 28.0758 61.4742 Constraint 153 322 10.9338 13.6673 20.5009 61.4742 Constraint 153 259 13.1424 16.4280 24.6420 61.4742 Constraint 122 399 10.1986 12.7482 19.1224 61.4626 Constraint 161 449 9.9768 12.4710 18.7065 61.3580 Constraint 210 467 13.2030 16.5038 24.7556 61.3064 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 128 467 12.1673 15.2091 22.8136 61.3064 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 88 259 12.3856 15.4820 23.2229 61.2935 Constraint 169 391 13.1059 16.3823 24.5735 61.2781 Constraint 88 442 10.9689 13.7112 20.5667 61.1698 Constraint 226 382 13.6085 17.0106 25.5159 61.0876 Constraint 176 399 15.2128 19.0160 28.5240 60.7538 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 104 467 13.4420 16.8024 25.2037 60.7107 Constraint 128 350 12.5217 15.6521 23.4781 60.6307 Constraint 144 421 11.3932 14.2415 21.3622 60.4326 Constraint 136 449 9.2408 11.5510 17.3265 60.3358 Constraint 176 360 14.8042 18.5053 27.7579 60.3022 Constraint 226 360 13.5174 16.8967 25.3451 60.3022 Constraint 404 467 8.3910 10.4888 15.7332 60.2295 Constraint 96 449 6.1214 7.6518 11.4777 60.2295 Constraint 176 391 14.1064 17.6330 26.4496 60.1734 Constraint 399 467 8.9970 11.2463 16.8694 60.1612 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 250 355 14.3999 17.9998 26.9998 60.1239 Constraint 113 341 13.6057 17.0072 25.5107 60.1146 Constraint 267 449 13.5723 16.9653 25.4480 59.9117 Constraint 250 449 11.1781 13.9726 20.9589 59.8678 Constraint 122 449 5.1170 6.3962 9.5943 59.6462 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 226 449 10.6783 13.3479 20.0218 59.6173 Constraint 259 461 13.5576 16.9471 25.4206 59.5192 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 169 461 10.1111 12.6389 18.9584 59.3652 Constraint 350 435 14.6081 18.2602 27.3903 59.2633 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 144 242 12.8391 16.0489 24.0733 59.1823 Constraint 88 355 11.5970 14.4962 21.7444 59.0778 Constraint 144 429 11.4419 14.3024 21.4536 59.0374 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 153 421 9.4927 11.8659 17.7988 58.9412 Constraint 122 467 9.1790 11.4738 17.2107 58.6481 Constraint 122 461 6.0480 7.5600 11.3400 58.6481 Constraint 113 461 9.2294 11.5368 17.3052 58.6481 Constraint 355 449 13.8923 17.3654 26.0480 58.6277 Constraint 242 467 13.0293 16.2866 24.4299 58.5736 Constraint 242 461 10.8906 13.6133 20.4199 58.5736 Constraint 136 412 14.7189 18.3987 27.5980 58.5423 Constraint 113 285 14.2784 17.8480 26.7720 58.5239 Constraint 80 161 14.2111 17.7638 26.6457 58.4409 Constraint 122 341 13.9926 17.4908 26.2362 58.3957 Constraint 314 467 13.6347 17.0434 25.5651 58.3946 Constraint 314 461 11.5149 14.3937 21.5905 58.3946 Constraint 292 461 12.1906 15.2383 22.8574 58.3946 Constraint 182 461 13.2849 16.6061 24.9091 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 272 382 14.3257 17.9072 26.8608 58.3409 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 182 382 14.8905 18.6132 27.9198 58.1246 Constraint 104 355 12.5954 15.7442 23.6163 58.0597 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 153 399 13.3173 16.6466 24.9699 57.8460 Constraint 144 435 12.7895 15.9868 23.9803 57.8460 Constraint 221 375 14.1523 17.6903 26.5355 57.8338 Constraint 250 350 12.8353 16.0441 24.0662 57.8012 Constraint 88 237 12.1227 15.1534 22.7301 57.7987 Constraint 355 435 15.0281 18.7852 28.1778 57.7604 Constraint 113 259 13.8884 17.3605 26.0408 57.7381 Constraint 104 250 14.7001 18.3751 27.5627 57.6618 Constraint 113 467 11.8134 14.7668 22.1501 57.4567 Constraint 88 190 14.5249 18.1562 27.2342 57.2146 Constraint 88 449 7.6931 9.6164 14.4245 57.2112 Constraint 80 350 11.3656 14.2070 21.3105 57.1495 Constraint 122 250 13.0375 16.2969 24.4453 56.9016 Constraint 201 461 12.8122 16.0152 24.0228 56.8610 Constraint 153 435 10.0615 12.5769 18.8654 56.8479 Constraint 153 429 9.8914 12.3643 18.5464 56.8479 Constraint 153 412 11.8498 14.8122 22.2183 56.8479 Constraint 128 355 14.2839 17.8549 26.7824 56.8453 Constraint 190 350 14.0616 17.5770 26.3654 56.7905 Constraint 221 461 13.5748 16.9685 25.4528 56.5192 Constraint 341 442 14.8901 18.6127 27.9190 56.4781 Constraint 80 285 13.6236 17.0295 25.5443 56.4575 Constraint 80 272 15.0106 18.7632 28.1448 56.4573 Constraint 80 221 14.3677 17.9597 26.9395 56.4573 Constraint 169 467 13.5867 16.9833 25.4750 56.3652 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 144 412 14.5106 18.1382 27.2073 56.3375 Constraint 88 461 7.4148 9.2686 13.9028 56.2132 Constraint 136 341 14.3534 17.9417 26.9126 56.1851 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 104 391 12.6060 15.7575 23.6362 56.0952 Constraint 80 429 12.0844 15.1055 22.6582 56.0639 Constraint 96 375 11.9794 14.9742 22.4613 55.8134 Constraint 122 279 14.8960 18.6200 27.9301 55.6871 Constraint 122 267 14.4243 18.0304 27.0456 55.6871 Constraint 169 341 14.9253 18.6566 27.9850 55.6522 Constraint 272 368 13.6973 17.1216 25.6824 55.5366 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 144 442 10.4807 13.1009 19.6514 55.5145 Constraint 292 467 14.6928 18.3660 27.5490 55.4697 Constraint 80 176 13.8056 17.2569 25.8854 55.4410 Constraint 176 461 13.8545 17.3182 25.9773 55.3946 Constraint 375 449 12.4316 15.5394 23.3092 55.3633 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 297 461 14.6788 18.3485 27.5227 55.2931 Constraint 279 449 14.3392 17.9240 26.8859 55.1794 Constraint 80 355 12.0573 15.0716 22.6074 55.1772 Constraint 144 461 8.9194 11.1493 16.7239 55.1406 Constraint 144 449 8.2009 10.2511 15.3766 55.1406 Constraint 80 421 11.0253 13.7817 20.6725 55.0475 Constraint 88 467 9.1462 11.4328 17.1492 55.0217 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 250 330 15.4766 19.3458 29.0187 54.8057 Constraint 237 461 11.0028 13.7535 20.6302 54.7678 Constraint 113 404 14.5822 18.2278 27.3417 54.7010 Constraint 272 404 14.5403 18.1754 27.2631 54.6642 Constraint 144 330 14.7654 18.4567 27.6851 54.5142 Constraint 176 350 14.7605 18.4507 27.6760 54.4066 Constraint 182 368 14.3686 17.9607 26.9411 54.3132 Constraint 314 473 11.1432 13.9290 20.8935 54.2042 Constraint 292 473 13.0042 16.2552 24.3829 54.2042 Constraint 210 473 12.2964 15.3705 23.0558 54.2042 Constraint 104 473 13.2630 16.5787 24.8681 54.2042 Constraint 122 350 13.3443 16.6804 25.0205 54.1871 Constraint 297 435 14.0241 17.5302 26.2953 54.0013 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 153 461 8.1479 10.1849 15.2774 53.9491 Constraint 153 449 6.0885 7.6106 11.4158 53.9491 Constraint 144 467 12.3119 15.3899 23.0848 53.9491 Constraint 144 272 15.0527 18.8159 28.2238 53.8717 Constraint 267 375 14.1223 17.6529 26.4793 53.8361 Constraint 314 480 13.2582 16.5727 24.8591 53.8200 Constraint 210 480 14.9194 18.6493 27.9739 53.8200 Constraint 104 480 14.1122 17.6403 26.4604 53.8200 Constraint 80 201 14.9461 18.6827 28.0240 53.7991 Constraint 136 467 14.3779 17.9724 26.9585 53.7497 Constraint 161 412 14.8771 18.5963 27.8945 53.5062 Constraint 128 473 12.2382 15.2977 22.9466 53.3946 Constraint 412 473 8.6705 10.8381 16.2571 53.3158 Constraint 322 467 14.3623 17.9528 26.9292 53.3014 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 128 391 11.6498 14.5622 21.8433 53.1618 Constraint 122 391 11.9677 14.9596 22.4394 53.1618 Constraint 322 473 12.8737 16.0921 24.1382 53.1273 Constraint 285 461 14.7387 18.4234 27.6351 52.9869 Constraint 80 242 13.5356 16.9195 25.3793 52.9386 Constraint 136 399 14.2518 17.8147 26.7220 52.9010 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 169 350 14.3553 17.9442 26.9163 52.4653 Constraint 88 391 11.6642 14.5802 21.8704 52.3926 Constraint 404 473 5.4961 6.8701 10.3051 52.3177 Constraint 399 473 5.4092 6.7614 10.1422 52.2495 Constraint 104 360 11.0353 13.7941 20.6912 52.2261 Constraint 96 473 9.7923 12.2404 18.3606 52.1110 Constraint 136 279 14.9241 18.6552 27.9828 52.0925 Constraint 96 368 11.5086 14.3857 21.5786 52.0280 Constraint 80 442 13.6411 17.0514 25.5771 51.9952 Constraint 399 480 8.5086 10.6358 15.9537 51.9334 Constraint 153 285 14.4682 18.0852 27.1279 51.8500 Constraint 237 350 14.1473 17.6841 26.5261 51.7483 Constraint 201 350 15.0333 18.7917 28.1875 51.7483 Constraint 88 375 12.8268 16.0335 24.0502 51.5990 Constraint 122 473 10.2048 12.7560 19.1341 51.5460 Constraint 412 480 12.2954 15.3692 23.0538 51.5286 Constraint 404 480 9.4119 11.7649 17.6474 51.5286 Constraint 242 473 11.2675 14.0844 21.1266 51.4715 Constraint 350 473 12.8801 16.1002 24.1503 51.3402 Constraint 88 279 14.9439 18.6799 28.0198 51.2424 Constraint 122 480 11.0746 13.8433 20.7649 51.1617 Constraint 368 449 12.8053 16.0066 24.0099 51.0734 Constraint 341 404 13.6568 17.0711 25.6066 51.0348 Constraint 113 473 12.7108 15.8885 23.8328 50.7364 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 169 360 13.4778 16.8473 25.2709 50.3150 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 144 473 13.7831 17.2289 25.8433 50.1407 Constraint 80 461 11.0165 13.7706 20.6560 49.9555 Constraint 113 350 13.4945 16.8681 25.3022 49.8285 Constraint 237 473 13.1816 16.4771 24.7156 49.7588 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 382 461 12.8336 16.0420 24.0629 49.6070 Constraint 128 360 11.3729 14.2162 21.3243 49.2928 Constraint 122 360 11.2695 14.0869 21.1303 49.2928 Constraint 113 360 12.7345 15.9181 23.8772 49.2928 Constraint 80 279 15.1450 18.9313 28.3969 49.2755 Constraint 226 461 14.1661 17.7077 26.5615 49.1968 Constraint 144 399 14.0635 17.5794 26.3691 49.1558 Constraint 88 473 9.5432 11.9290 17.8935 49.1110 Constraint 250 461 13.8651 17.3314 25.9971 49.0280 Constraint 113 226 14.6237 18.2796 27.4194 49.0035 Constraint 153 473 13.0481 16.3101 24.4651 48.9492 Constraint 153 267 15.2047 19.0059 28.5089 48.8558 Constraint 153 250 13.5443 16.9303 25.3955 48.8558 Constraint 355 473 11.8557 14.8197 22.2295 48.7692 Constraint 322 480 14.3373 17.9217 26.8825 48.7267 Constraint 88 480 9.3489 11.6861 17.5292 48.7267 Constraint 122 375 14.2370 17.7963 26.6945 48.6086 Constraint 375 461 12.3027 15.3783 23.0675 48.5907 Constraint 237 467 13.3071 16.6339 24.9509 48.4512 Constraint 226 368 14.3980 17.9975 26.9963 48.3025 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 144 259 14.6803 18.3503 27.5255 48.0862 Constraint 391 467 12.3405 15.4256 23.1383 47.8881 Constraint 382 467 12.6484 15.8105 23.7158 47.8881 Constraint 128 480 13.6461 17.0576 25.5864 47.8296 Constraint 169 473 13.4306 16.7882 25.1823 47.8216 Constraint 80 412 14.7799 18.4748 27.7122 47.7556 Constraint 113 391 14.0611 17.5764 26.3646 47.5888 Constraint 80 404 14.7692 18.4615 27.6923 47.4909 Constraint 153 480 14.2032 17.7540 26.6310 47.3763 Constraint 113 480 12.5342 15.6677 23.5016 47.3763 Constraint 128 382 14.6538 18.3172 27.4758 47.1715 Constraint 80 467 13.1770 16.4712 24.7068 47.0452 Constraint 375 467 11.3363 14.1703 21.2555 46.8718 Constraint 259 473 12.8836 16.1045 24.1568 46.8440 Constraint 279 429 14.4571 18.0713 27.1070 46.5611 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 153 391 13.9830 17.4787 26.2181 46.3810 Constraint 153 360 14.5047 18.1309 27.1964 46.3810 Constraint 355 480 13.2472 16.5590 24.8385 46.1740 Constraint 360 461 11.5224 14.4031 21.6046 46.0197 Constraint 80 259 13.9606 17.4508 26.1762 45.8937 Constraint 285 473 13.8773 17.3467 26.0200 45.7945 Constraint 350 461 14.3290 17.9112 26.8668 45.6775 Constraint 221 473 14.3242 17.9052 26.8578 45.6312 Constraint 201 382 15.1353 18.9192 28.3787 45.4605 Constraint 368 467 14.0122 17.5152 26.2728 45.3171 Constraint 122 355 13.9540 17.4424 26.1637 45.1985 Constraint 303 473 14.4832 18.1040 27.1560 44.7945 Constraint 242 480 14.3512 17.9390 26.9085 44.7304 Constraint 122 382 14.3252 17.9065 26.8598 44.6005 Constraint 80 435 15.2253 19.0317 28.5475 44.3287 Constraint 368 461 13.8137 17.2671 25.9007 44.3008 Constraint 360 467 12.3427 15.4283 23.1425 44.3008 Constraint 80 473 13.0706 16.3382 24.5073 43.6415 Constraint 128 375 15.0304 18.7880 28.1820 43.0356 Constraint 88 382 13.7361 17.1701 25.7551 43.0342 Constraint 153 303 15.4009 19.2512 28.8767 42.8598 Constraint 226 350 14.3974 17.9968 26.9952 42.8479 Constraint 113 355 14.2055 17.7568 26.6353 42.6254 Constraint 80 480 12.7434 15.9293 23.8939 42.4500 Constraint 136 350 14.5519 18.1899 27.2848 42.3016 Constraint 391 480 12.5036 15.6295 23.4443 42.1888 Constraint 297 375 14.0487 17.5609 26.3414 41.7923 Constraint 88 368 12.8273 16.0342 24.0512 41.7361 Constraint 144 404 15.1440 18.9300 28.3949 41.4741 Constraint 250 473 13.4731 16.8414 25.2620 41.4363 Constraint 144 480 13.6246 17.0308 25.5462 41.3860 Constraint 382 480 12.6900 15.8625 23.7938 41.1725 Constraint 80 391 13.3366 16.6708 25.0062 41.0480 Constraint 355 467 14.4865 18.1081 27.1621 41.0347 Constraint 391 473 9.0502 11.3127 16.9690 40.7859 Constraint 382 473 9.2058 11.5072 17.2608 40.7859 Constraint 136 267 15.3171 19.1464 28.7196 40.7472 Constraint 190 461 15.2852 19.1065 28.6598 40.2947 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 279 404 14.2746 17.8433 26.7649 40.0912 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 136 473 14.4786 18.0982 27.1473 39.1730 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 355 461 13.9991 17.4989 26.2484 38.0456 Constraint 128 368 14.3558 17.9448 26.9172 37.7294 Constraint 122 368 14.1135 17.6419 26.4628 37.7294 Constraint 368 480 13.0563 16.3204 24.4805 37.6035 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 80 368 14.5775 18.2219 27.3328 37.5539 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 169 382 15.2794 19.0992 28.6488 37.2630 Constraint 368 473 9.9385 12.4231 18.6347 37.1987 Constraint 360 473 8.8089 11.0112 16.5167 37.1987 Constraint 161 250 15.4285 19.2856 28.9284 36.9167 Constraint 136 360 14.0527 17.5659 26.3489 36.7588 Constraint 259 467 14.8377 18.5471 27.8206 36.5482 Constraint 279 375 14.4696 18.0870 27.1306 36.4264 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 421 497 6.5914 8.2393 12.3589 36.0872 Constraint 303 461 14.7108 18.3885 27.5827 36.0143 Constraint 314 489 11.7738 14.7172 22.0758 35.8393 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 169 489 12.7824 15.9780 23.9670 35.8393 Constraint 136 489 12.8929 16.1161 24.1742 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 104 489 11.2055 14.0069 21.0104 35.8393 Constraint 399 489 8.8894 11.1118 16.6677 35.6717 Constraint 182 473 14.4852 18.1065 27.1598 35.6423 Constraint 404 489 10.1074 12.6342 18.9513 35.2669 Constraint 435 497 8.8198 11.0247 16.5371 35.0892 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 190 404 15.1887 18.9859 28.4788 34.7051 Constraint 88 250 13.2462 16.5577 24.8366 34.3669 Constraint 303 497 12.8278 16.0347 24.0521 34.2847 Constraint 297 497 13.2006 16.5008 24.7512 34.2847 Constraint 330 497 12.7120 15.8899 23.8349 34.2104 Constraint 330 404 13.6502 17.0628 25.5941 34.1924 Constraint 237 341 14.8935 18.6168 27.9253 34.0301 Constraint 80 237 14.4695 18.0869 27.1304 33.9972 Constraint 341 497 13.0055 16.2568 24.3853 33.9104 Constraint 322 489 12.0090 15.0112 22.5168 33.7461 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 161 489 14.8673 18.5841 27.8762 33.6249 Constraint 201 341 15.1995 18.9993 28.4990 33.6032 Constraint 314 497 8.8201 11.0251 16.5377 33.5683 Constraint 136 497 12.2765 15.3457 23.0185 33.5683 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 104 497 9.6958 12.1198 18.1796 33.5683 Constraint 88 267 14.2633 17.8291 26.7436 33.4534 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 292 497 10.7892 13.4866 20.2298 33.2683 Constraint 285 497 12.8699 16.0874 24.1311 33.2683 Constraint 259 497 12.1749 15.2186 22.8279 33.2683 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 182 497 12.8840 16.1050 24.1574 33.2683 Constraint 169 497 11.7828 14.7286 22.0928 33.2683 Constraint 153 489 11.4660 14.3325 21.4987 33.1810 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 113 489 9.9260 12.4075 18.6113 33.1810 Constraint 292 489 13.2728 16.5910 24.8865 33.0025 Constraint 412 497 9.1618 11.4522 17.1783 32.9959 Constraint 404 497 7.8585 9.8232 14.7347 32.9959 Constraint 350 480 13.8463 17.3078 25.9618 32.9179 Constraint 322 497 9.7036 12.1295 18.1942 32.4914 Constraint 242 497 10.4719 13.0898 19.6348 32.3228 Constraint 221 497 12.8175 16.0219 24.0328 32.2683 Constraint 355 497 10.0466 12.5583 18.8374 32.1914 Constraint 350 497 11.1960 13.9950 20.9925 32.1914 Constraint 80 190 15.3587 19.1983 28.7975 32.0373 Constraint 144 489 10.7861 13.4827 20.2240 31.9666 Constraint 341 473 14.6613 18.3266 27.4899 31.9141 Constraint 144 360 14.9031 18.6289 27.9433 31.8176 Constraint 104 368 14.0424 17.5530 26.3294 31.7404 Constraint 136 391 14.4435 18.0544 27.0816 31.6388 Constraint 237 355 15.2683 19.0854 28.6281 31.5895 Constraint 80 375 14.2452 17.8065 26.7097 31.5528 Constraint 96 497 6.2746 7.8432 11.7648 31.4751 Constraint 88 497 5.7830 7.2287 10.8431 31.4751 Constraint 250 467 14.7341 18.4176 27.6264 31.4659 Constraint 122 497 7.5491 9.4364 14.1546 30.9101 Constraint 237 497 12.6556 15.8195 23.7293 30.6101 Constraint 201 497 14.0095 17.5119 26.2679 30.6101 Constraint 153 497 11.1774 13.9718 20.9577 30.6101 Constraint 144 497 11.2893 14.1116 21.1675 30.6101 Constraint 113 497 9.4270 11.7838 17.6757 30.6101 Constraint 272 497 14.9666 18.7082 28.0623 30.4316 Constraint 242 489 12.5991 15.7489 23.6234 30.2295 Constraint 161 467 15.0748 18.8435 28.2653 29.6022 Constraint 350 489 13.8753 17.3441 26.0162 28.9256 Constraint 350 467 14.6589 18.3236 27.4854 28.6154 Constraint 80 497 9.3774 11.7218 17.5826 28.4674 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 169 480 15.1026 18.8783 28.3174 28.3880 Constraint 104 375 14.4925 18.1157 27.1735 28.0466 Constraint 226 341 15.3615 19.2019 28.8028 27.6996 Constraint 176 497 14.6177 18.2721 27.4082 27.6953 Constraint 272 375 15.2593 19.0742 28.6112 27.6853 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 341 511 13.9920 17.4901 26.2351 27.0175 Constraint 182 489 14.3317 17.9147 26.8720 27.0045 Constraint 391 489 12.2902 15.3627 23.0441 26.9251 Constraint 88 226 13.2746 16.5933 24.8899 26.9136 Constraint 330 461 14.2265 17.7832 26.6748 26.8364 Constraint 412 511 11.3448 14.1811 21.2716 26.7157 Constraint 355 511 9.9140 12.3925 18.5888 26.6321 Constraint 226 497 14.7913 18.4892 27.7338 26.5201 Constraint 355 489 12.3598 15.4497 23.1746 26.3547 Constraint 259 489 14.3684 17.9605 26.9408 26.3416 Constraint 250 497 13.2671 16.5838 24.8757 26.3416 Constraint 399 511 6.6596 8.3245 12.4867 26.1224 Constraint 322 511 12.2991 15.3738 23.0608 25.9157 Constraint 128 511 13.3782 16.7228 25.0842 25.9157 Constraint 96 511 9.5650 11.9562 17.9343 25.9157 Constraint 404 511 8.9594 11.1993 16.7990 25.7176 Constraint 237 489 13.8484 17.3105 25.9658 25.6801 Constraint 314 511 10.7236 13.4045 20.1068 25.6157 Constraint 292 511 13.6966 17.1208 25.6812 25.6157 Constraint 259 511 14.4652 18.0815 27.1223 25.6157 Constraint 210 511 13.7717 17.2146 25.8218 25.6157 Constraint 104 511 12.9430 16.1788 24.2682 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 330 511 14.3502 17.9377 26.9066 25.5986 Constraint 350 511 11.9267 14.9084 22.3626 25.2986 Constraint 80 511 11.4172 14.2715 21.4073 24.8061 Constraint 242 511 12.7588 15.9485 23.9228 24.6701 Constraint 190 382 15.4233 19.2792 28.9187 24.5150 Constraint 161 497 13.9772 17.4715 26.2072 24.4841 Constraint 292 480 14.6075 18.2594 27.3891 24.3458 Constraint 303 511 14.5064 18.1330 27.1995 24.2823 Constraint 237 480 15.4169 19.2711 28.9066 24.1927 Constraint 391 497 9.1276 11.4095 17.1142 23.6561 Constraint 113 279 15.7230 19.6538 29.4806 23.5097 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 382 489 13.1178 16.3973 24.5960 23.1918 Constraint 375 489 11.4736 14.3421 21.5131 23.1918 Constraint 201 473 14.6122 18.2652 27.3978 23.1745 Constraint 122 511 10.6044 13.2554 19.8832 22.9575 Constraint 113 511 12.3843 15.4803 23.2205 22.9575 Constraint 279 435 14.1730 17.7162 26.5744 22.4472 Constraint 285 489 14.8336 18.5421 27.8131 22.4349 Constraint 391 511 10.6548 13.3185 19.9778 22.2720 Constraint 330 435 14.2677 17.8346 26.7519 22.2328 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 161 267 15.7014 19.6268 29.4401 22.0166 Constraint 382 497 10.4700 13.0875 19.6312 21.9372 Constraint 375 497 8.9030 11.1287 16.6931 21.6372 Constraint 368 497 10.3320 12.9150 19.3725 21.6372 Constraint 104 382 14.5469 18.1837 27.2755 21.6258 Constraint 272 461 14.9045 18.6307 27.9460 21.5623 Constraint 382 511 11.4146 14.2682 21.4023 21.2739 Constraint 375 511 8.7219 10.9024 16.3536 20.9739 Constraint 368 511 10.7660 13.4574 20.1862 20.9739 Constraint 360 511 9.1646 11.4557 17.1836 20.9739 Constraint 368 489 13.4290 16.7862 25.1793 20.6209 Constraint 360 489 10.7311 13.4139 20.1209 20.6209 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 303 599 13.0657 16.3321 24.4982 20.5191 Constraint 144 391 14.9605 18.7007 28.0510 20.1286 Constraint 161 330 15.1100 18.8875 28.3313 20.0725 Constraint 279 497 15.2415 19.0519 28.5778 19.8618 Constraint 285 511 14.4065 18.0082 27.0122 19.7790 Constraint 435 519 12.5598 15.6997 23.5496 19.7765 Constraint 429 519 9.6616 12.0770 18.1156 19.7765 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 412 519 13.3494 16.6868 25.0302 19.7765 Constraint 161 285 15.7090 19.6362 29.4543 19.6889 Constraint 221 511 15.1812 18.9765 28.4647 19.6157 Constraint 201 489 15.0154 18.7693 28.1539 19.6155 Constraint 590 657 11.6598 14.5748 21.8621 19.6092 Constraint 221 489 14.3964 17.9956 26.9933 19.4369 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 144 285 15.4174 19.2717 28.9076 19.2010 Constraint 297 473 13.8873 17.3591 26.0386 19.1637 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 341 599 13.6018 17.0022 25.5033 19.0683 Constraint 144 519 13.7391 17.1738 25.7607 18.9575 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 330 489 13.7131 17.1414 25.7120 18.9115 Constraint 113 250 13.6773 17.0966 25.6449 18.8902 Constraint 442 519 12.9829 16.2286 24.3429 18.4430 Constraint 330 473 14.7521 18.4401 27.6601 18.2743 Constraint 585 668 13.5009 16.8762 25.3143 18.2044 Constraint 449 519 10.5041 13.1301 19.6952 18.1430 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 404 519 11.6816 14.6020 21.9030 18.0576 Constraint 136 480 14.5382 18.1727 27.2591 17.9784 Constraint 153 279 15.3485 19.1856 28.7784 17.9696 Constraint 122 519 10.5240 13.1551 19.7326 17.9576 Constraint 113 519 11.6697 14.5871 21.8807 17.9576 Constraint 88 519 8.5041 10.6301 15.9452 17.9576 Constraint 314 622 12.7986 15.9982 23.9974 17.8945 Constraint 267 497 14.5668 18.2085 27.3127 17.7685 Constraint 303 604 12.6960 15.8700 23.8050 17.6961 Constraint 590 668 12.9979 16.2474 24.3711 17.6246 Constraint 604 676 11.5457 14.4321 21.6482 17.6035 Constraint 399 519 9.2768 11.5960 17.3940 17.4643 Constraint 136 250 15.1002 18.8752 28.3128 17.4300 Constraint 96 519 9.8146 12.2683 18.4025 17.2576 Constraint 237 511 14.8855 18.6069 27.9103 17.1208 Constraint 544 613 12.8781 16.0976 24.1465 17.1064 Constraint 314 613 12.4476 15.5596 23.3393 17.0849 Constraint 190 497 15.2619 19.0773 28.6160 17.0403 Constraint 599 676 12.4718 15.5898 23.3847 17.0305 Constraint 391 527 10.6418 13.3023 19.9534 16.9929 Constraint 429 629 10.5261 13.1576 19.7364 16.9828 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 322 519 12.3831 15.4789 23.2184 16.9576 Constraint 314 519 11.7766 14.7207 22.0810 16.9576 Constraint 128 519 13.1267 16.4084 24.6126 16.9576 Constraint 104 519 12.6142 15.7677 23.6516 16.9576 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 297 511 15.3716 19.2146 28.8218 16.7790 Constraint 435 527 10.8445 13.5556 20.3334 16.7766 Constraint 421 527 8.6354 10.7942 16.1914 16.7766 Constraint 412 527 11.1519 13.9399 20.9099 16.7766 Constraint 242 629 11.7352 14.6690 22.0036 16.7638 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 341 604 12.4046 15.5057 23.2586 16.6115 Constraint 322 604 9.9329 12.4161 18.6241 16.5734 Constraint 242 604 11.1631 13.9539 20.9308 16.5734 Constraint 210 604 10.0841 12.6051 18.9076 16.5734 Constraint 113 375 15.0853 18.8566 28.2849 16.5639 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 391 519 12.5247 15.6559 23.4839 16.2721 Constraint 144 250 14.6038 18.2547 27.3821 16.2012 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 153 511 13.6836 17.1044 25.6567 16.1700 Constraint 144 511 13.2801 16.6001 24.9002 16.1700 Constraint 182 375 14.4796 18.0995 27.1492 16.1586 Constraint 544 629 13.5073 16.8842 25.3263 16.1508 Constraint 80 519 10.9430 13.6788 20.5182 16.1480 Constraint 449 527 8.9058 11.1323 16.6984 16.1431 Constraint 429 604 8.2338 10.2923 15.4384 15.9828 Constraint 144 527 11.6628 14.5785 21.8678 15.9576 Constraint 136 511 14.7320 18.4150 27.6224 15.8283 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 404 527 10.4794 13.0993 19.6490 15.7785 Constraint 201 467 14.1326 17.6657 26.4986 15.7398 Constraint 391 604 11.4652 14.3315 21.4973 15.7157 Constraint 360 604 11.4758 14.3447 21.5171 15.7157 Constraint 322 629 12.2812 15.3515 23.0273 15.6922 Constraint 314 629 11.9118 14.8897 22.3346 15.6922 Constraint 190 368 15.0093 18.7617 28.1425 15.6441 Constraint 242 599 10.1332 12.6665 18.9998 15.5965 Constraint 399 604 9.8861 12.3577 18.5365 15.5851 Constraint 242 622 11.6118 14.5147 21.7721 15.5772 Constraint 429 535 9.8213 12.2766 18.4149 15.4620 Constraint 421 535 9.7453 12.1816 18.2724 15.4601 Constraint 442 527 10.3979 12.9974 19.4961 15.4431 Constraint 421 604 9.2705 11.5882 17.3822 15.4288 Constraint 404 604 9.6054 12.0068 18.0102 15.4067 Constraint 404 622 10.5186 13.1482 19.7223 15.3945 Constraint 404 613 10.4816 13.1020 19.6530 15.3945 Constraint 314 604 9.5524 11.9404 17.9107 15.0970 Constraint 571 636 12.3571 15.4464 23.1696 15.0630 Constraint 355 604 13.6949 17.1187 25.6780 15.0490 Constraint 429 622 10.0410 12.5513 18.8269 14.9829 Constraint 421 629 10.0693 12.5866 18.8799 14.9829 Constraint 421 622 10.6083 13.2604 19.8906 14.9829 Constraint 421 613 11.0038 13.7547 20.6321 14.9829 Constraint 412 622 11.2623 14.0778 21.1168 14.9829 Constraint 404 629 10.2833 12.8541 19.2812 14.9797 Constraint 375 527 11.1600 13.9499 20.9249 14.9740 Constraint 368 527 11.9411 14.9264 22.3896 14.9740 Constraint 355 519 10.9704 13.7130 20.5695 14.9739 Constraint 153 527 11.9263 14.9079 22.3619 14.9576 Constraint 136 527 12.7812 15.9765 23.9648 14.9576 Constraint 122 527 8.4902 10.6128 15.9192 14.9576 Constraint 113 527 9.8762 12.3452 18.5178 14.9576 Constraint 88 527 7.5752 9.4691 14.2036 14.9576 Constraint 322 599 10.3125 12.8906 19.3359 14.9297 Constraint 314 599 9.6142 12.0177 18.0266 14.9297 Constraint 314 590 11.5599 14.4499 21.6749 14.9297 Constraint 259 599 11.7348 14.6685 22.0027 14.9297 Constraint 449 535 10.9344 13.6680 20.5020 14.8266 Constraint 355 535 10.1675 12.7094 19.0641 14.7865 Constraint 210 629 10.3327 12.9159 19.3739 14.7676 Constraint 80 267 15.3164 19.1456 28.7183 14.6605 Constraint 391 613 12.6228 15.7785 23.6677 14.5920 Constraint 577 657 11.5537 14.4421 21.6631 14.5473 Constraint 391 629 12.0217 15.0272 22.5408 14.4982 Constraint 391 622 12.1195 15.1494 22.7240 14.4982 Constraint 314 552 13.9073 17.3841 26.0761 14.4768 Constraint 429 599 9.1262 11.4078 17.1117 14.4329 Constraint 429 613 9.0409 11.3012 16.9517 14.4099 Constraint 412 613 12.0352 15.0440 22.5660 14.4099 Constraint 169 511 14.7204 18.4005 27.6008 14.3845 Constraint 375 604 11.2866 14.1083 21.1624 14.3422 Constraint 480 599 10.1010 12.6262 18.9394 14.3104 Constraint 128 527 10.5538 13.1922 19.7883 14.2577 Constraint 104 527 10.5216 13.1520 19.7280 14.2577 Constraint 96 527 7.7305 9.6632 14.4947 14.2577 Constraint 341 489 13.9501 17.4376 26.1563 14.2564 Constraint 128 535 12.7217 15.9021 23.8532 14.2141 Constraint 122 535 11.6157 14.5196 21.7794 14.2141 Constraint 322 577 11.5281 14.4101 21.6151 14.1515 Constraint 314 577 11.5079 14.3848 21.5772 14.1515 Constraint 442 535 12.3818 15.4772 23.2158 14.1266 Constraint 104 552 12.5713 15.7142 23.5712 14.1093 Constraint 136 552 14.0038 17.5048 26.2572 14.1093 Constraint 128 552 13.6929 17.1161 25.6742 14.1093 Constraint 429 590 10.4169 13.0212 19.5318 14.0786 Constraint 590 676 13.9344 17.4180 26.1270 14.0613 Constraint 399 622 11.0110 13.7637 20.6456 14.0122 Constraint 399 613 10.5055 13.1318 19.6977 14.0122 Constraint 412 629 10.7439 13.4298 20.1447 13.9951 Constraint 375 519 11.3528 14.1910 21.2866 13.9577 Constraint 368 519 13.1582 16.4478 24.6717 13.9577 Constraint 360 519 10.5757 13.2196 19.8294 13.9577 Constraint 210 527 10.9866 13.7332 20.5999 13.9577 Constraint 210 519 13.5103 16.8879 25.3318 13.9577 Constraint 201 527 14.3869 17.9837 26.9755 13.9577 Constraint 169 527 12.3848 15.4810 23.2214 13.9577 Constraint 153 519 13.8314 17.2893 25.9339 13.9577 Constraint 136 519 14.8491 18.5614 27.8421 13.9577 Constraint 322 590 11.9415 14.9268 22.3902 13.9297 Constraint 297 599 12.4003 15.5003 23.2505 13.9297 Constraint 292 599 10.4744 13.0930 19.6396 13.9297 Constraint 285 599 12.1307 15.1633 22.7450 13.9297 Constraint 382 622 12.2179 15.2724 22.9086 13.9252 Constraint 382 613 12.8469 16.0586 24.0879 13.9252 Constraint 368 613 13.2888 16.6110 24.9166 13.9252 Constraint 176 404 14.7011 18.3764 27.5646 13.9109 Constraint 322 622 12.6110 15.7637 23.6456 13.9041 Constraint 461 535 9.7397 12.1747 18.2620 13.8285 Constraint 237 629 10.2392 12.7989 19.1984 13.7798 Constraint 259 629 12.9002 16.1253 24.1879 13.6961 Constraint 80 382 15.0819 18.8523 28.2785 13.6639 Constraint 350 527 11.2153 14.0191 21.0287 13.6405 Constraint 330 527 11.6381 14.5477 21.8215 13.6405 Constraint 226 473 14.9169 18.6462 27.9693 13.6357 Constraint 237 599 10.3269 12.9087 19.3630 13.6003 Constraint 210 599 9.4684 11.8355 17.7532 13.6003 Constraint 391 535 10.0147 12.5184 18.7776 13.5832 Constraint 577 668 14.0266 17.5333 26.2999 13.5474 Constraint 330 585 13.0003 16.2504 24.3755 13.5166 Constraint 399 629 10.6856 13.3570 20.0355 13.5136 Constraint 341 571 13.1781 16.4727 24.7090 13.5103 Constraint 279 604 13.4732 16.8415 25.2622 13.5079 Constraint 350 604 14.3368 17.9210 26.8816 13.4760 Constraint 467 604 9.3586 11.6982 17.5473 13.4599 Constraint 461 604 10.2357 12.7947 19.1920 13.4599 Constraint 303 489 13.3576 16.6969 25.0454 13.4370 Constraint 435 535 11.7051 14.6314 21.9470 13.3668 Constraint 412 535 11.3299 14.1624 21.2436 13.3668 Constraint 297 489 13.0709 16.3386 24.5079 13.3497 Constraint 176 489 15.3331 19.1664 28.7495 13.3497 Constraint 613 687 12.0902 15.1128 22.6692 13.3429 Constraint 571 644 14.0346 17.5432 26.3148 13.3312 Constraint 303 585 13.1634 16.4542 24.6813 13.3297 Constraint 297 585 13.7553 17.1941 25.7911 13.3297 Constraint 201 368 14.6227 18.2784 27.4176 13.3218 Constraint 360 613 12.4902 15.6128 23.4192 13.3137 Constraint 480 590 10.7533 13.4416 20.1624 13.3123 Constraint 585 676 15.0367 18.7959 28.1938 13.3076 Constraint 360 535 8.5833 10.7291 16.0937 13.2832 Constraint 210 535 12.6666 15.8332 23.7498 13.2141 Constraint 104 535 12.7669 15.9587 23.9380 13.2141 Constraint 259 480 14.6497 18.3122 27.4683 13.2017 Constraint 571 651 13.4723 16.8404 25.2606 13.1853 Constraint 360 599 9.8853 12.3566 18.5349 13.1658 Constraint 297 577 11.1433 13.9292 20.8938 13.1515 Constraint 80 527 10.0658 12.5822 18.8733 13.1481 Constraint 604 706 13.3902 16.7378 25.1067 13.1193 Constraint 279 599 13.2225 16.5281 24.7921 13.1115 Constraint 128 544 13.4276 16.7844 25.1767 13.1093 Constraint 104 544 12.8053 16.0066 24.0099 13.1093 Constraint 322 613 11.3170 14.1462 21.2193 13.0945 Constraint 368 604 12.2218 15.2773 22.9159 13.0834 Constraint 552 636 13.8233 17.2791 25.9186 13.0822 Constraint 429 585 10.7355 13.4193 20.1290 13.0818 Constraint 557 636 12.5667 15.7083 23.5625 13.0803 Constraint 480 604 8.3464 10.4330 15.6495 13.0738 Constraint 341 435 13.4242 16.7802 25.1703 13.0211 Constraint 435 604 10.5279 13.1599 19.7399 13.0104 Constraint 435 622 11.0190 13.7737 20.6606 12.9983 Constraint 442 629 10.7192 13.3991 20.0986 12.9964 Constraint 412 604 10.2213 12.7767 19.1650 12.9951 Constraint 297 604 11.3190 14.1488 21.2232 12.9326 Constraint 375 613 11.0879 13.8599 20.7898 12.9089 Constraint 360 622 12.4290 15.5362 23.3043 12.9089 Constraint 467 599 9.9686 12.4608 18.6912 12.8870 Constraint 467 590 11.2274 14.0342 21.0513 12.8870 Constraint 461 599 10.2161 12.7702 19.1553 12.8870 Constraint 461 590 11.8877 14.8596 22.2894 12.8870 Constraint 473 599 8.9924 11.2405 16.8608 12.8851 Constraint 473 590 10.4974 13.1218 19.6827 12.8851 Constraint 473 585 9.4620 11.8275 17.7413 12.8851 Constraint 449 585 12.7729 15.9661 23.9491 12.8748 Constraint 449 599 11.3182 14.1478 21.2217 12.7796 Constraint 399 535 7.5685 9.4606 14.1909 12.7736 Constraint 303 590 13.7559 17.1949 25.7924 12.7153 Constraint 303 622 15.2092 19.0114 28.5172 12.6897 Constraint 122 604 12.1232 15.1540 22.7310 12.6547 Constraint 122 599 12.6434 15.8043 23.7064 12.6547 Constraint 322 527 8.6280 10.7850 16.1775 12.6242 Constraint 314 527 8.5478 10.6848 16.0272 12.6242 Constraint 292 527 10.9137 13.6421 20.4632 12.6242 Constraint 182 527 12.9617 16.2021 24.3032 12.6242 Constraint 382 604 11.7211 14.6514 21.9772 12.6042 Constraint 122 585 13.0590 16.3237 24.4855 12.5834 Constraint 292 604 9.7234 12.1542 18.2314 12.5830 Constraint 237 604 10.4680 13.0851 19.6276 12.5830 Constraint 421 599 8.0975 10.1219 15.1828 12.5790 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 613 698 13.2624 16.5780 24.8671 12.5471 Constraint 604 698 11.6898 14.6123 21.9184 12.5394 Constraint 350 599 13.4405 16.8007 25.2010 12.4991 Constraint 461 613 12.4180 15.5226 23.2838 12.4600 Constraint 435 613 11.4336 14.2919 21.4379 12.4253 Constraint 314 585 11.5889 14.4862 21.7293 12.3974 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 473 613 9.9214 12.4018 18.6026 12.3648 Constraint 341 527 11.5615 14.4519 21.6778 12.3594 Constraint 449 604 11.6954 14.6193 21.9289 12.3545 Constraint 604 687 10.9956 13.7446 20.6168 12.3429 Constraint 303 577 10.1209 12.6511 18.9766 12.3419 Constraint 285 577 12.0921 15.1151 22.6727 12.3419 Constraint 279 577 11.5019 14.3773 21.5660 12.3419 Constraint 136 544 13.8819 17.3523 26.0285 12.2997 Constraint 382 527 11.7056 14.6320 21.9480 12.2740 Constraint 382 519 13.1531 16.4413 24.6620 12.2557 Constraint 341 480 13.6402 17.0502 25.5753 12.2545 Constraint 421 585 12.1338 15.1672 22.7508 12.2278 Constraint 144 303 15.8271 19.7839 29.6758 12.2045 Constraint 341 461 14.8759 18.5949 27.8923 12.1899 Constraint 391 599 9.0141 11.2677 16.9015 12.1780 Constraint 360 590 10.8139 13.5174 20.2761 12.1780 Constraint 330 599 12.7007 15.8759 23.8138 12.1426 Constraint 382 535 11.1169 13.8961 20.8441 12.1373 Constraint 375 535 8.9913 11.2392 16.8588 12.1373 Constraint 368 535 9.8266 12.2832 18.4248 12.1373 Constraint 292 577 11.8872 14.8590 22.2886 12.1352 Constraint 272 577 12.8029 16.0036 24.0054 12.1352 Constraint 182 577 11.8656 14.8320 22.2480 12.1352 Constraint 88 535 10.1420 12.6775 19.0163 12.1209 Constraint 355 599 11.7482 14.6852 22.0278 12.0943 Constraint 435 585 12.5941 15.7426 23.6140 12.0940 Constraint 96 552 13.2560 16.5700 24.8550 12.0161 Constraint 435 629 10.3485 12.9356 19.4034 12.0105 Constraint 442 622 10.7912 13.4890 20.2334 11.9983 Constraint 421 636 12.7747 15.9684 23.9526 11.9820 Constraint 480 622 10.5285 13.1606 19.7409 11.9805 Constraint 480 613 9.5177 11.8971 17.8456 11.9805 Constraint 153 350 14.4186 18.0232 27.0348 11.9776 Constraint 341 535 11.8770 14.8463 22.2694 11.9497 Constraint 259 604 11.5392 14.4239 21.6359 11.9163 Constraint 442 599 11.3104 14.1380 21.2070 11.8924 Constraint 467 585 9.3127 11.6409 17.4613 11.8870 Constraint 461 585 10.3285 12.9106 19.3659 11.8870 Constraint 314 535 9.8912 12.3640 18.5460 11.8807 Constraint 297 535 13.6361 17.0452 25.5678 11.8807 Constraint 292 535 11.8932 14.8665 22.2998 11.8807 Constraint 182 535 14.3072 17.8840 26.8260 11.8807 Constraint 88 629 12.9870 16.2337 24.3506 11.8451 Constraint 435 599 11.2222 14.0278 21.0417 11.7940 Constraint 250 489 14.5991 18.2489 27.3734 11.7706 Constraint 599 687 10.8009 13.5011 20.2516 11.7699 Constraint 590 687 13.7404 17.1755 25.7632 11.7699 Constraint 303 629 14.0263 17.5329 26.2994 11.7019 Constraint 285 629 13.5365 16.9206 25.3808 11.7019 Constraint 341 577 10.3349 12.9186 19.3779 11.7007 Constraint 429 577 11.8011 14.7514 22.1271 11.6741 Constraint 341 585 11.8110 14.7638 22.1457 11.6721 Constraint 322 552 13.0170 16.2713 24.4069 11.6673 Constraint 88 599 11.4019 14.2524 21.3785 11.6548 Constraint 88 604 11.3614 14.2017 21.3026 11.6548 Constraint 136 404 14.4130 18.0163 27.0244 11.6480 Constraint 221 599 11.0439 13.8049 20.7074 11.6003 Constraint 412 599 9.0098 11.2623 16.8934 11.5912 Constraint 480 629 8.9723 11.2154 16.8231 11.5757 Constraint 210 613 10.0986 12.6232 18.9348 11.5747 Constraint 330 571 13.0732 16.3414 24.5122 11.5547 Constraint 303 571 12.8709 16.0886 24.1329 11.5547 Constraint 341 557 13.2351 16.5439 24.8159 11.5276 Constraint 360 629 11.7569 14.6961 22.0442 11.4973 Constraint 341 590 13.5610 16.9513 25.4269 11.4911 Constraint 404 585 10.8767 13.5959 20.3938 11.4451 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 404 590 9.2115 11.5144 17.2717 11.4298 Constraint 429 636 11.4829 14.3537 21.5305 11.4212 Constraint 322 585 10.9783 13.7228 20.5842 11.3974 Constraint 467 629 9.5932 11.9915 17.9872 11.3667 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 467 613 10.3868 12.9835 19.4752 11.3667 Constraint 461 629 10.8956 13.6195 20.4292 11.3667 Constraint 461 622 12.4185 15.5232 23.2848 11.3667 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 272 473 14.4536 18.0670 27.1005 11.3474 Constraint 557 644 13.8247 17.2809 25.9214 11.3351 Constraint 267 577 13.4095 16.7618 25.1427 11.3256 Constraint 226 375 15.0471 18.8089 28.2134 11.3216 Constraint 80 552 12.3773 15.4717 23.2075 11.3113 Constraint 442 604 10.0658 12.5822 18.8734 11.2983 Constraint 182 467 13.0122 16.2653 24.3979 11.2612 Constraint 404 535 9.4640 11.8300 17.7449 11.2228 Constraint 250 511 14.9515 18.6893 28.0340 11.2060 Constraint 399 599 7.9926 9.9907 14.9861 11.1934 Constraint 557 651 14.3411 17.9264 26.8896 11.1872 Constraint 629 706 11.0510 13.8137 20.7206 11.1424 Constraint 622 706 12.9742 16.2177 24.3266 11.1424 Constraint 613 706 14.2652 17.8316 26.7473 11.1424 Constraint 535 613 12.4416 15.5520 23.3280 11.1285 Constraint 535 604 11.5048 14.3810 21.5714 11.1285 Constraint 242 535 11.4165 14.2707 21.4060 11.1209 Constraint 242 527 10.5146 13.1432 19.7148 11.1209 Constraint 237 527 12.8257 16.0321 24.0482 11.1209 Constraint 169 519 14.4482 18.0602 27.0903 11.1209 Constraint 96 535 9.9876 12.4845 18.7267 11.1209 Constraint 242 519 12.8170 16.0213 24.0319 11.1209 Constraint 285 604 11.7905 14.7382 22.1073 11.1067 Constraint 368 599 9.7359 12.1698 18.2548 11.1065 Constraint 330 519 12.9117 16.1397 24.2095 11.1037 Constraint 480 585 8.0519 10.0648 15.0973 11.0979 Constraint 449 577 12.0752 15.0939 22.6409 11.0406 Constraint 391 590 10.1335 12.6669 19.0003 11.0321 Constraint 382 599 9.8086 12.2608 18.3911 11.0321 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 375 599 9.1158 11.3948 17.0922 11.0321 Constraint 375 590 9.7444 12.1805 18.2708 11.0321 Constraint 368 590 10.7074 13.3842 20.0763 11.0321 Constraint 96 544 13.4018 16.7523 25.1284 11.0161 Constraint 535 622 12.2755 15.3444 23.0166 10.9826 Constraint 599 698 11.7775 14.7219 22.0828 10.9742 Constraint 136 355 15.9014 19.8767 29.8151 10.9298 Constraint 330 590 13.6890 17.1113 25.6669 10.9281 Constraint 250 629 12.8736 16.0919 24.1379 10.9211 Constraint 292 622 11.7373 14.6717 22.0075 10.9080 Constraint 292 613 11.9390 14.9238 22.3857 10.9080 Constraint 210 622 9.0351 11.2939 16.9408 10.9080 Constraint 201 622 9.8642 12.3302 18.4954 10.9080 Constraint 182 622 12.0167 15.0209 22.5314 10.9080 Constraint 182 613 12.4237 15.5297 23.2945 10.9080 Constraint 176 622 11.7230 14.6537 21.9806 10.9080 Constraint 442 585 13.6979 17.1224 25.6836 10.9065 Constraint 429 552 12.1581 15.1976 22.7965 10.8889 Constraint 421 552 12.3863 15.4828 23.2243 10.8870 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 442 12.0721 15.0901 22.6352 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 237 14.6819 18.3523 27.5285 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 169 13.2793 16.5991 24.8987 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 113 267 15.0725 18.8407 28.2610 10.8052 Constraint 350 535 9.9144 12.3929 18.5894 10.8038 Constraint 330 535 12.3228 15.4035 23.1053 10.8038 Constraint 303 535 12.9411 16.1764 24.2647 10.8038 Constraint 350 519 11.4708 14.3386 21.5078 10.8037 Constraint 267 473 14.7770 18.4713 27.7069 10.7988 Constraint 497 599 11.8179 14.7724 22.1586 10.7647 Constraint 421 590 9.8756 12.3445 18.5167 10.7452 Constraint 314 636 13.7305 17.1631 25.7446 10.7173 Constraint 322 544 14.2404 17.8005 26.7007 10.7161 Constraint 350 577 13.2797 16.5997 24.8995 10.7045 Constraint 421 577 11.6676 14.5845 21.8767 10.6742 Constraint 88 590 13.1054 16.3817 24.5726 10.6548 Constraint 113 604 12.0406 15.0508 22.5762 10.6548 Constraint 113 599 12.8421 16.0526 24.0789 10.6548 Constraint 355 527 9.1328 11.4160 17.1240 10.6405 Constraint 651 729 12.3755 15.4694 23.2041 10.6254 Constraint 644 729 13.4846 16.8558 25.2837 10.6254 Constraint 644 720 12.1090 15.1362 22.7044 10.6254 Constraint 226 604 11.9320 14.9150 22.3724 10.5869 Constraint 201 604 9.4531 11.8164 17.7246 10.5869 Constraint 182 604 9.3049 11.6312 17.4467 10.5869 Constraint 176 604 9.9726 12.4657 18.6986 10.5869 Constraint 330 577 10.8608 13.5760 20.3640 10.5547 Constraint 297 571 13.5751 16.9688 25.4532 10.5384 Constraint 297 622 14.0796 17.5995 26.3992 10.5032 Constraint 176 613 12.5095 15.6368 23.4552 10.5032 Constraint 421 651 13.6728 17.0910 25.6364 10.4811 Constraint 297 552 12.1297 15.1621 22.7431 10.4768 Constraint 412 590 10.6901 13.3626 20.0439 10.4452 Constraint 144 577 11.4683 14.3354 21.5031 10.4238 Constraint 421 644 14.5336 18.1670 27.2505 10.4212 Constraint 303 557 14.2620 17.8275 26.7413 10.3817 Constraint 473 622 9.0539 11.3174 16.9761 10.3649 Constraint 330 480 13.7139 17.1424 25.7135 10.3565 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 467 636 11.0078 13.7597 20.6396 10.3504 Constraint 182 571 14.8025 18.5031 27.7546 10.3480 Constraint 449 613 12.2942 15.3677 23.0516 10.3424 Constraint 80 544 13.1099 16.3874 24.5811 10.3113 Constraint 461 552 11.0427 13.8034 20.7051 10.2554 Constraint 449 552 12.0051 15.0064 22.5096 10.2535 Constraint 88 585 11.5241 14.4051 21.6076 10.2500 Constraint 604 713 13.9736 17.4670 26.2005 10.2206 Constraint 221 535 13.7853 17.2316 25.8474 10.2142 Constraint 250 599 11.4581 14.3226 21.4840 10.1586 Constraint 557 657 13.3991 16.7488 25.1233 10.1267 Constraint 480 571 11.2686 14.0857 21.1286 10.0612 Constraint 399 590 8.6471 10.8089 16.2133 10.0475 Constraint 88 552 11.2892 14.1115 21.1672 9.9798 Constraint 382 629 10.7412 13.4265 20.1398 9.9605 Constraint 399 585 10.2084 12.7605 19.1408 9.9579 Constraint 169 355 14.8092 18.5115 27.7672 9.9510 Constraint 399 636 12.0949 15.1186 22.6779 9.9474 Constraint 292 590 12.2011 15.2514 22.8771 9.9394 Constraint 375 622 9.2454 11.5567 17.3351 9.9320 Constraint 122 577 11.1647 13.9559 20.9338 9.9263 Constraint 272 604 11.5970 14.4963 21.7444 9.9202 Constraint 221 604 10.2058 12.7573 19.1359 9.9202 Constraint 201 613 11.0938 13.8673 20.8009 9.9202 Constraint 190 604 11.2476 14.0595 21.0893 9.9202 Constraint 330 629 13.6364 17.0454 25.5682 9.9147 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 577 687 13.5852 16.9814 25.4722 9.9026 Constraint 330 613 13.4424 16.8030 25.2045 9.9025 Constraint 303 613 14.0095 17.5119 26.2678 9.9025 Constraint 577 676 15.2551 19.0689 28.6033 9.8892 Constraint 421 544 12.1256 15.1570 22.7355 9.8870 Constraint 88 622 14.0345 17.5431 26.3147 9.8452 Constraint 88 613 13.3906 16.7382 25.1073 9.8452 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 201 15.1424 18.9280 28.3920 9.8353 Constraint 69 176 15.3196 19.1495 28.7243 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 69 144 12.3422 15.4278 23.1417 9.8353 Constraint 292 544 15.3900 19.2375 28.8563 9.8093 Constraint 182 544 12.8434 16.0542 24.0813 9.8093 Constraint 169 544 14.1825 17.7281 26.5922 9.8093 Constraint 657 735 11.3058 14.1323 21.1985 9.7954 Constraint 651 735 12.7198 15.8997 23.8496 9.7954 Constraint 435 590 12.4522 15.5652 23.3478 9.7940 Constraint 391 585 11.4563 14.3204 21.4807 9.7886 Constraint 360 585 10.5687 13.2108 19.8163 9.7886 Constraint 355 585 12.5478 15.6847 23.5271 9.7886 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 297 527 11.7284 14.6605 21.9908 9.7875 Constraint 285 535 12.8552 16.0691 24.1036 9.7875 Constraint 259 535 12.3103 15.3879 23.0819 9.7875 Constraint 176 527 14.6350 18.2938 27.4407 9.7875 Constraint 341 519 12.1309 15.1636 22.7454 9.7874 Constraint 201 629 8.0953 10.1191 15.1787 9.7773 Constraint 297 629 12.2351 15.2938 22.9407 9.7057 Constraint 292 629 10.1011 12.6264 18.9396 9.7057 Constraint 297 613 13.4515 16.8144 25.2216 9.6935 Constraint 144 535 10.5031 13.1289 19.6934 9.6410 Constraint 511 585 14.0847 17.6059 26.4088 9.6305 Constraint 303 527 11.3849 14.2312 21.3468 9.6242 Constraint 221 527 11.6757 14.5946 21.8919 9.6242 Constraint 480 636 9.0982 11.3728 17.0592 9.5613 Constraint 279 585 14.4337 18.0422 27.0632 9.5464 Constraint 279 571 13.5219 16.9023 25.3535 9.5384 Constraint 122 552 11.6557 14.5697 21.8545 9.5363 Constraint 497 604 10.8918 13.6147 20.4221 9.5281 Constraint 355 590 11.7045 14.6306 21.9459 9.5266 Constraint 144 599 12.5529 15.6911 23.5367 9.4992 Constraint 144 590 13.4786 16.8483 25.2724 9.4954 Constraint 292 552 14.1675 17.7094 26.5641 9.4605 Constraint 182 552 13.1051 16.3814 24.5720 9.4605 Constraint 429 644 13.4868 16.8585 25.2877 9.4289 Constraint 571 657 12.4964 15.6205 23.4308 9.4268 Constraint 161 527 14.3385 17.9231 26.8847 9.3846 Constraint 350 552 13.5152 16.8940 25.3410 9.3836 Constraint 330 557 13.2309 16.5387 24.8080 9.3653 Constraint 449 629 10.8969 13.6211 20.4317 9.3546 Constraint 449 622 11.3068 14.1335 21.2003 9.3546 Constraint 461 636 12.6923 15.8654 23.7981 9.3504 Constraint 136 577 12.0002 15.0003 22.5004 9.3196 Constraint 128 577 11.4988 14.3734 21.5602 9.3196 Constraint 330 604 10.2537 12.8172 19.2257 9.3195 Constraint 489 599 10.5323 13.1653 19.7480 9.3187 Constraint 590 698 14.6567 18.3209 27.4813 9.3075 Constraint 467 552 11.0322 13.7902 20.6853 9.2555 Constraint 467 544 11.1910 13.9888 20.9832 9.2554 Constraint 461 544 11.7190 14.6487 21.9730 9.2554 Constraint 449 544 12.2367 15.2959 22.9438 9.2535 Constraint 480 577 10.2884 12.8605 19.2907 9.2516 Constraint 113 585 12.0859 15.1073 22.6610 9.2500 Constraint 113 552 11.5500 14.4375 21.6562 9.2363 Constraint 144 552 11.1300 13.9125 20.8687 9.2362 Constraint 144 544 11.7394 14.6743 22.0114 9.2362 Constraint 153 577 13.2596 16.5745 24.8617 9.2323 Constraint 285 480 14.3880 17.9850 26.9775 9.2018 Constraint 210 636 11.0018 13.7522 20.6283 9.1259 Constraint 221 622 10.9782 13.7228 20.5841 9.1208 Constraint 190 622 11.7804 14.7255 22.0883 9.1208 Constraint 350 585 14.7410 18.4262 27.6393 9.1096 Constraint 144 585 11.7786 14.7233 22.0849 9.0906 Constraint 489 613 11.8589 14.8237 22.2355 9.0821 Constraint 489 604 10.3677 12.9596 19.4394 9.0821 Constraint 489 577 10.8886 13.6108 20.4161 9.0631 Constraint 489 571 11.7170 14.6463 21.9694 9.0631 Constraint 473 552 10.5132 13.1415 19.7123 9.0469 Constraint 473 577 9.9287 12.4109 18.6163 9.0407 Constraint 176 544 14.2291 17.7863 26.6795 8.9997 Constraint 480 651 12.5744 15.7180 23.5770 8.9864 Constraint 153 341 13.5491 16.9364 25.4046 8.9828 Constraint 80 535 11.9608 14.9509 22.4264 8.9778 Constraint 144 350 14.3810 17.9763 26.9644 8.9776 Constraint 480 657 11.0162 13.7703 20.6554 8.9661 Constraint 404 636 10.9809 13.7261 20.5892 8.9596 Constraint 113 577 11.7417 14.6771 22.0156 8.9263 Constraint 88 577 11.5394 14.4243 21.6364 8.9263 Constraint 421 657 13.4203 16.7754 25.1631 8.9158 Constraint 629 720 11.7344 14.6680 22.0020 8.9027 Constraint 629 713 10.9956 13.7445 20.6167 8.9027 Constraint 622 720 14.3975 17.9969 26.9954 8.9027 Constraint 622 713 13.0104 16.2631 24.3946 8.9027 Constraint 585 687 14.4727 18.0909 27.1363 8.9027 Constraint 577 698 13.4519 16.8148 25.2222 8.9027 Constraint 467 577 9.7133 12.1416 18.2125 8.8966 Constraint 461 577 9.6313 12.0391 18.0587 8.8966 Constraint 535 629 12.8773 16.0967 24.1450 8.8893 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 242 613 9.5926 11.9908 17.9862 8.7997 Constraint 237 622 6.2981 7.8726 11.8089 8.7997 Constraint 237 613 8.8299 11.0374 16.5561 8.7997 Constraint 169 368 15.0692 18.8365 28.2548 8.7994 Constraint 449 590 12.4550 15.5688 23.3531 8.7817 Constraint 467 651 13.6235 17.0294 25.5441 8.7775 Constraint 467 644 13.2790 16.5988 24.8982 8.7775 Constraint 429 544 11.7930 14.7412 22.1118 8.7411 Constraint 314 651 14.0041 17.5052 26.2578 8.7404 Constraint 297 590 13.2844 16.6055 24.9082 8.7250 Constraint 322 636 11.3267 14.1583 21.2375 8.7211 Constraint 285 622 13.6428 17.0534 25.5802 8.7160 Constraint 272 622 13.1157 16.3946 24.5919 8.7160 Constraint 272 613 14.0478 17.5597 26.3396 8.7160 Constraint 267 622 14.5125 18.1406 27.2110 8.7160 Constraint 190 613 13.3991 16.7488 25.1233 8.7160 Constraint 226 629 10.0540 12.5675 18.8512 8.7057 Constraint 221 629 10.0603 12.5754 18.8631 8.7057 Constraint 190 629 10.1938 12.7422 19.1134 8.7057 Constraint 182 629 9.3341 11.6676 17.5015 8.7057 Constraint 176 629 8.6640 10.8300 16.2450 8.7057 Constraint 330 552 10.9386 13.6732 20.5099 8.6836 Constraint 96 599 11.2776 14.0970 21.1455 8.6587 Constraint 382 585 11.7329 14.6662 21.9993 8.6426 Constraint 375 585 10.0254 12.5317 18.7976 8.6426 Constraint 368 585 11.3496 14.1870 21.2805 8.6426 Constraint 153 535 11.1620 13.9524 20.9287 8.6411 Constraint 136 535 12.3045 15.3807 23.0710 8.6411 Constraint 113 535 10.7988 13.4985 20.2477 8.6411 Constraint 169 622 10.4486 13.0608 19.5912 8.6209 Constraint 169 613 11.0064 13.7580 20.6370 8.6209 Constraint 226 599 10.2322 12.7902 19.1854 8.6100 Constraint 210 590 10.3679 12.9599 19.4398 8.6100 Constraint 201 599 8.8273 11.0341 16.5512 8.6100 Constraint 201 590 12.4086 15.5108 23.2661 8.6100 Constraint 176 599 9.9135 12.3918 18.5877 8.6100 Constraint 527 604 11.6895 14.6118 21.9177 8.5811 Constraint 435 577 11.3918 14.2398 21.3596 8.5809 Constraint 412 577 12.1085 15.1356 22.7034 8.5809 Constraint 480 644 11.6986 14.6233 21.9350 8.5613 Constraint 552 657 13.9028 17.3785 26.0678 8.5557 Constraint 497 585 11.2464 14.0580 21.0870 8.5503 Constraint 412 585 12.6860 15.8575 23.7863 8.4606 Constraint 341 552 10.8863 13.6079 20.4118 8.3836 Constraint 303 552 10.7801 13.4751 20.2126 8.3836 Constraint 285 552 13.6703 17.0879 25.6318 8.3836 Constraint 350 590 13.8700 17.3375 26.0063 8.3807 Constraint 297 557 14.6661 18.3326 27.4990 8.3653 Constraint 104 585 11.5185 14.3981 21.5971 8.3529 Constraint 473 657 10.5072 13.1340 19.7010 8.3486 Constraint 449 636 13.5106 16.8883 25.3325 8.3383 Constraint 489 590 12.0122 15.0152 22.5228 8.3207 Constraint 190 355 15.5021 19.3776 29.0664 8.2627 Constraint 461 571 12.9598 16.1998 24.2997 8.2554 Constraint 449 557 13.5343 16.9179 25.3768 8.2535 Constraint 153 552 12.6634 15.8292 23.7439 8.2363 Constraint 153 544 12.6871 15.8588 23.7883 8.2363 Constraint 122 544 11.9654 14.9567 22.4350 8.2363 Constraint 113 544 12.7014 15.8767 23.8151 8.2363 Constraint 604 720 14.1296 17.6620 26.4930 8.2359 Constraint 599 713 13.3448 16.6810 25.0214 8.2359 Constraint 292 585 12.0953 15.1192 22.6788 8.2167 Constraint 221 585 14.0675 17.5844 26.3766 8.2167 Constraint 210 585 11.4220 14.2775 21.4162 8.2167 Constraint 182 585 12.6352 15.7941 23.6911 8.2167 Constraint 412 636 13.4466 16.8083 25.2124 8.2147 Constraint 544 636 15.1544 18.9429 28.4144 8.2065 Constraint 242 651 15.2476 19.0595 28.5892 8.1669 Constraint 355 613 13.3189 16.6486 24.9729 8.1526 Constraint 330 467 14.9900 18.7375 28.1062 8.1440 Constraint 259 622 11.1842 13.9803 20.9704 8.1330 Constraint 259 613 12.0423 15.0529 22.5794 8.1330 Constraint 250 622 10.5164 13.1454 19.7182 8.1330 Constraint 250 613 12.3852 15.4815 23.2223 8.1330 Constraint 226 622 9.3212 11.6516 17.4773 8.1330 Constraint 221 613 11.7762 14.7202 22.0803 8.1330 Constraint 182 636 11.6570 14.5713 21.8569 8.1259 Constraint 176 636 10.9667 13.7084 20.5625 8.1259 Constraint 292 519 11.9132 14.8915 22.3372 8.1209 Constraint 237 535 13.0638 16.3297 24.4946 8.1209 Constraint 226 535 15.2423 19.0529 28.5793 8.1209 Constraint 221 519 13.7402 17.1753 25.7630 8.1209 Constraint 182 519 14.3932 17.9915 26.9873 8.1209 Constraint 69 250 14.5595 18.1993 27.2990 8.0149 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 519 599 11.5826 14.4783 21.7174 8.0082 Constraint 519 590 12.9956 16.2445 24.3667 8.0082 Constraint 511 599 12.9228 16.1536 24.2303 8.0082 Constraint 442 613 9.4835 11.8544 17.7816 8.0079 Constraint 272 599 10.6818 13.3523 20.0284 7.9432 Constraint 190 599 10.1463 12.6829 19.0243 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 182 590 12.2717 15.3396 23.0094 7.9432 Constraint 279 613 15.6517 19.5646 29.3469 7.9064 Constraint 599 706 12.5498 15.6872 23.5309 7.9046 Constraint 585 698 14.6845 18.3556 27.5334 7.9046 Constraint 113 368 14.1058 17.6322 26.4483 7.9038 Constraint 226 355 15.3389 19.1737 28.7605 7.8954 Constraint 429 557 13.4221 16.7776 25.1664 7.8889 Constraint 435 552 12.6478 15.8098 23.7146 7.8870 Constraint 161 391 15.1595 18.9494 28.4241 7.8629 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 69 190 15.6292 19.5365 29.3048 7.8354 Constraint 644 735 12.7380 15.9225 23.8838 7.8108 Constraint 489 622 11.3558 14.1947 21.2921 7.7985 Constraint 473 651 10.5814 13.2268 19.8402 7.7756 Constraint 473 644 10.3382 12.9228 19.3842 7.7756 Constraint 497 590 11.5960 14.4950 21.7425 7.7648 Constraint 136 590 13.3095 16.6369 24.9553 7.7577 Constraint 226 613 11.8197 14.7747 22.1620 7.7282 Constraint 292 636 12.4320 15.5400 23.3100 7.7211 Constraint 360 651 12.0586 15.0732 22.6098 7.6971 Constraint 355 651 12.2728 15.3410 23.0115 7.6971 Constraint 297 544 11.9613 14.9516 22.4274 7.6663 Constraint 272 544 14.1459 17.6824 26.5235 7.6663 Constraint 272 535 15.0698 18.8372 28.2558 7.6663 Constraint 96 604 11.7655 14.7068 22.0603 7.6587 Constraint 96 590 13.2793 16.5992 24.8987 7.6587 Constraint 128 585 11.1570 13.9463 20.9194 7.6529 Constraint 636 720 12.9221 16.1526 24.2290 7.6427 Constraint 169 535 12.2047 15.2558 22.8837 7.6411 Constraint 169 604 8.1601 10.2001 15.3001 7.6331 Constraint 368 629 10.0157 12.5196 18.7794 7.5796 Constraint 279 552 11.9216 14.9020 22.3530 7.5740 Constraint 629 729 12.8289 16.0361 24.0541 7.5692 Constraint 604 729 14.5382 18.1727 27.2591 7.5692 Constraint 355 629 12.0916 15.1145 22.6717 7.5675 Constraint 242 577 10.2381 12.7976 19.1965 7.5622 Constraint 210 577 9.6193 12.0242 18.0363 7.5622 Constraint 279 557 15.4207 19.2758 28.9138 7.5557 Constraint 176 590 12.8367 16.0459 24.0689 7.5384 Constraint 391 544 14.5069 18.1336 27.2004 7.4575 Constraint 435 651 13.5753 16.9691 25.4536 7.4443 Constraint 435 644 15.1593 18.9492 28.4237 7.4443 Constraint 429 651 12.1863 15.2329 22.8494 7.4443 Constraint 527 622 10.9543 13.6929 20.5394 7.4352 Constraint 144 604 10.9273 13.6591 20.4886 7.4022 Constraint 341 544 13.1870 16.4838 24.7257 7.3990 Constraint 480 668 12.3536 15.4420 23.1630 7.3932 Constraint 497 622 11.3764 14.2205 21.3308 7.3822 Constraint 497 613 10.7565 13.4456 20.1683 7.3822 Constraint 272 552 13.8971 17.3713 26.0570 7.3673 Constraint 176 552 15.4030 19.2537 28.8806 7.3673 Constraint 497 577 10.2242 12.7803 19.1704 7.3631 Constraint 341 613 13.5183 16.8978 25.3467 7.3535 Constraint 136 585 11.0419 13.8023 20.7035 7.3529 Constraint 429 657 12.1368 15.1710 22.7565 7.3505 Constraint 412 651 13.0125 16.2656 24.3984 7.3505 Constraint 279 473 14.5981 18.2477 27.3715 7.2610 Constraint 467 571 12.4577 15.5721 23.3581 7.2554 Constraint 467 557 12.8085 16.0106 24.0159 7.2554 Constraint 461 557 12.5643 15.7054 23.5581 7.2554 Constraint 96 585 12.8507 16.0634 24.0951 7.2539 Constraint 449 571 13.0527 16.3159 24.4739 7.2535 Constraint 442 577 10.9793 13.7241 20.5862 7.2475 Constraint 636 729 13.5816 16.9770 25.4655 7.2378 Constraint 636 713 11.9933 14.9916 22.4875 7.2378 Constraint 599 720 13.5434 16.9293 25.3939 7.2378 Constraint 144 571 11.6202 14.5252 21.7878 7.2362 Constraint 210 544 14.3765 17.9706 26.9560 7.2361 Constraint 153 557 12.7454 15.9317 23.8976 7.2343 Constraint 144 557 11.1781 13.9727 20.9590 7.2343 Constraint 122 557 13.2321 16.5401 24.8101 7.2343 Constraint 136 571 13.9035 17.3794 26.0691 7.2324 Constraint 237 585 12.9075 16.1344 24.2016 7.2289 Constraint 144 341 13.4717 16.8396 25.2594 7.1973 Constraint 96 629 12.8077 16.0097 24.0145 7.1823 Constraint 144 613 13.7451 17.1814 25.7721 7.1620 Constraint 210 657 12.6519 15.8149 23.7224 7.1535 Constraint 322 657 11.9574 14.9467 22.4200 7.1516 Constraint 250 604 11.3847 14.2309 21.3464 7.1452 Constraint 629 735 14.2887 17.8609 26.7913 7.1441 Constraint 322 644 11.0473 13.8091 20.7137 7.1413 Constraint 292 651 13.7772 17.2215 25.8322 7.1413 Constraint 122 571 13.4522 16.8153 25.2229 7.1392 Constraint 113 571 13.9247 17.4059 26.1089 7.1392 Constraint 237 636 11.2651 14.0814 21.1221 7.1381 Constraint 201 636 10.1708 12.7135 19.0703 7.1381 Constraint 391 657 12.8339 16.0424 24.0636 7.1209 Constraint 391 644 13.5702 16.9628 25.4441 7.1209 Constraint 368 644 12.2930 15.3663 23.0494 7.1209 Constraint 360 657 12.6424 15.8030 23.7045 7.1209 Constraint 360 644 12.5741 15.7176 23.5764 7.1209 Constraint 242 571 11.0999 13.8749 20.8124 7.1084 Constraint 210 571 12.8411 16.0514 24.0771 7.1084 Constraint 473 571 11.3452 14.1814 21.2722 7.0632 Constraint 480 557 11.0056 13.7570 20.6355 7.0468 Constraint 161 577 11.6399 14.5499 21.8249 7.0234 Constraint 80 250 12.0620 15.0775 22.6162 7.0153 Constraint 80 226 14.2487 17.8109 26.7164 7.0153 Constraint 368 622 9.2162 11.5202 17.2803 7.0067 Constraint 355 622 11.1559 13.9448 20.9172 7.0067 Constraint 467 657 11.7063 14.6329 21.9494 6.9903 Constraint 161 599 11.7012 14.6265 21.9397 6.9896 Constraint 497 629 9.8933 12.3666 18.5498 6.9889 Constraint 330 622 14.5795 18.2243 27.3365 6.9609 Constraint 285 613 12.7572 15.9464 23.9197 6.9186 Constraint 279 629 13.5392 16.9240 25.3860 6.9186 Constraint 272 629 10.5541 13.1926 19.7889 6.9186 Constraint 267 629 12.8427 16.0534 24.0802 6.9186 Constraint 267 613 15.0001 18.7501 28.1252 6.9186 Constraint 267 604 12.0117 15.0146 22.5219 6.9186 Constraint 285 467 14.4006 18.0008 27.0011 6.9031 Constraint 221 467 13.4041 16.7551 25.1326 6.9031 Constraint 421 571 12.4144 15.5180 23.2770 6.8890 Constraint 421 557 12.1352 15.1690 22.7535 6.8890 Constraint 182 480 12.9003 16.1253 24.1880 6.8767 Constraint 88 636 13.6050 17.0063 25.5094 6.8549 Constraint 69 226 15.7196 19.6495 29.4743 6.8531 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 412 15.1547 18.9434 28.4151 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 221 15.0813 18.8516 28.2775 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 182 14.0495 17.5618 26.3427 6.8531 Constraint 58 136 12.4233 15.5292 23.2938 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 242 590 8.2842 10.3552 15.5329 6.8350 Constraint 169 636 9.9033 12.3791 18.5687 6.8235 Constraint 169 629 8.2924 10.3655 15.5483 6.8235 Constraint 636 735 14.6342 18.2928 27.4392 6.8127 Constraint 360 552 11.7491 14.6864 22.0296 6.8105 Constraint 314 544 14.9122 18.6403 27.9604 6.8094 Constraint 176 467 13.0655 16.3318 24.4978 6.7922 Constraint 303 519 11.9943 14.9929 22.4893 6.7875 Constraint 297 519 13.0113 16.2641 24.3961 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 285 519 13.1150 16.3937 24.5906 6.7875 Constraint 279 527 12.9570 16.1963 24.2944 6.7875 Constraint 272 527 12.5725 15.7157 23.5735 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 259 519 12.8745 16.0931 24.1396 6.7875 Constraint 250 535 12.6318 15.7897 23.6846 6.7875 Constraint 250 527 12.0037 15.0046 22.5069 6.7875 Constraint 226 527 12.7838 15.9797 23.9695 6.7875 Constraint 226 489 14.5636 18.2045 27.3067 6.7875 Constraint 190 527 13.9598 17.4498 26.1747 6.7875 Constraint 461 657 13.7564 17.1956 25.7933 6.7775 Constraint 461 651 13.9557 17.4447 26.1670 6.7775 Constraint 404 651 10.4614 13.0767 19.6151 6.7775 Constraint 322 651 11.1283 13.9103 20.8655 6.7365 Constraint 391 651 11.9107 14.8884 22.3325 6.7093 Constraint 104 577 10.1241 12.6551 18.9826 6.6862 Constraint 122 613 12.6362 15.7952 23.6928 6.6645 Constraint 104 599 10.3525 12.9406 19.4109 6.6645 Constraint 136 599 11.6718 14.5897 21.8846 6.6644 Constraint 128 599 10.5157 13.1446 19.7169 6.6644 Constraint 399 552 12.0783 15.0978 22.6468 6.6498 Constraint 375 552 12.0507 15.0634 22.5951 6.6473 Constraint 169 599 8.7472 10.9340 16.4010 6.6408 Constraint 169 590 11.9971 14.9964 22.4947 6.6408 Constraint 391 552 11.3168 14.1460 21.2190 6.5900 Constraint 330 544 11.3600 14.2000 21.3000 6.5894 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 259 577 10.1894 12.7368 19.1052 6.5622 Constraint 237 577 11.1710 13.9638 20.9456 6.5622 Constraint 221 577 10.5515 13.1893 19.7840 6.5622 Constraint 210 651 12.6651 15.8313 23.7470 6.5583 Constraint 442 557 13.2712 16.5890 24.8834 6.5536 Constraint 442 552 11.8127 14.7659 22.1489 6.5536 Constraint 360 636 12.3198 15.3998 23.0996 6.5511 Constraint 355 636 14.4219 18.0274 27.0411 6.5511 Constraint 190 473 13.7400 17.1750 25.7625 6.4513 Constraint 176 473 11.9324 14.9154 22.3732 6.4513 Constraint 161 473 11.6056 14.5070 21.7605 6.4513 Constraint 527 613 11.6589 14.5736 21.8605 6.4352 Constraint 285 544 15.7137 19.6422 29.4633 6.3827 Constraint 190 544 14.7696 18.4619 27.6929 6.3827 Constraint 285 590 12.2210 15.2762 22.9143 6.3548 Constraint 242 636 12.5169 15.6461 23.4692 6.3510 Constraint 161 590 13.1760 16.4700 24.7050 6.3445 Constraint 221 636 12.6381 15.7977 23.6965 6.3388 Constraint 511 604 11.4989 14.3736 21.5604 6.3256 Constraint 113 382 14.1975 17.7468 26.6202 6.2901 Constraint 169 585 12.3652 15.4565 23.1848 6.2475 Constraint 113 557 13.1335 16.4169 24.6254 6.2343 Constraint 128 571 13.4127 16.7659 25.1488 6.2325 Constraint 435 657 12.6534 15.8168 23.7252 6.2301 Constraint 201 585 12.5119 15.6398 23.4597 6.2205 Constraint 176 585 12.3706 15.4633 23.1949 6.2205 Constraint 303 480 12.8022 16.0027 24.0041 6.2038 Constraint 314 657 13.2314 16.5392 24.8088 6.1670 Constraint 242 657 13.8717 17.3396 26.0094 6.1670 Constraint 176 644 9.7664 12.2081 18.3121 6.1638 Constraint 360 544 13.7534 17.1918 25.7877 6.1594 Constraint 267 599 11.0915 13.8643 20.7965 6.1561 Constraint 221 590 11.1203 13.9004 20.8505 6.1561 Constraint 190 590 13.1070 16.3837 24.5756 6.1561 Constraint 201 657 12.7717 15.9647 23.9470 6.1535 Constraint 88 571 12.5780 15.7225 23.5838 6.1392 Constraint 412 657 12.6984 15.8730 23.8094 6.1363 Constraint 399 657 10.9192 13.6490 20.4735 6.1363 Constraint 399 651 10.6679 13.3349 20.0024 6.1363 Constraint 382 651 9.8333 12.2916 18.4375 6.1363 Constraint 375 651 7.4588 9.3235 13.9852 6.1363 Constraint 368 657 11.7713 14.7141 22.0712 6.1363 Constraint 368 651 9.5549 11.9436 17.9154 6.1363 Constraint 355 644 13.1411 16.4263 24.6395 6.1363 Constraint 519 613 13.0943 16.3679 24.5518 6.1352 Constraint 519 604 12.0702 15.0877 22.6316 6.1352 Constraint 489 585 9.9037 12.3796 18.5694 6.1063 Constraint 341 668 12.8924 16.1155 24.1732 6.1056 Constraint 473 557 10.7444 13.4305 20.1458 6.0469 Constraint 442 657 14.1449 17.6811 26.5216 6.0173 Constraint 511 590 12.9716 16.2145 24.3217 6.0082 Constraint 382 636 11.8288 14.7860 22.1790 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 368 636 12.1881 15.2351 22.8526 5.9904 Constraint 153 382 14.5798 18.2248 27.3371 5.9901 Constraint 161 341 14.7548 18.4435 27.6652 5.9828 Constraint 169 644 10.7507 13.4383 20.1575 5.9785 Constraint 350 629 13.9340 17.4175 26.1262 5.9782 Constraint 382 644 12.4081 15.5101 23.2651 5.9750 Constraint 375 644 9.2437 11.5546 17.3319 5.9750 Constraint 489 657 12.1785 15.2231 22.8347 5.9726 Constraint 360 571 10.3361 12.9201 19.3802 5.9411 Constraint 330 636 12.3381 15.4226 23.1339 5.9340 Constraint 297 636 12.1898 15.2372 22.8559 5.9340 Constraint 285 636 14.8650 18.5813 27.8719 5.9340 Constraint 272 636 13.0596 16.3245 24.4868 5.9340 Constraint 259 636 14.1904 17.7381 26.6071 5.9340 Constraint 190 636 11.8889 14.8611 22.2916 5.9340 Constraint 169 577 11.6915 14.6144 21.9216 5.9264 Constraint 104 571 12.7549 15.9436 23.9155 5.8990 Constraint 161 399 15.0051 18.7563 28.1345 5.8628 Constraint 122 629 12.0563 15.0703 22.6055 5.8549 Constraint 113 636 12.2704 15.3380 23.0069 5.8549 Constraint 113 629 11.4599 14.3249 21.4873 5.8549 Constraint 113 613 11.7958 14.7447 22.1171 5.8549 Constraint 104 613 11.7299 14.6624 21.9936 5.8549 Constraint 80 604 13.0379 16.2973 24.4460 5.8485 Constraint 80 590 13.8707 17.3383 26.0075 5.8485 Constraint 80 585 12.4363 15.5453 23.3180 5.8485 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 449 11.9904 14.9880 22.4819 5.8367 Constraint 58 442 14.8358 18.5447 27.8171 5.8367 Constraint 58 169 14.7118 18.3897 27.5845 5.8367 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 58 144 12.5389 15.6736 23.5104 5.8367 Constraint 237 590 7.5759 9.4699 14.2049 5.8350 Constraint 519 622 10.8433 13.5541 20.3312 5.8017 Constraint 435 557 12.7260 15.9075 23.8613 5.7938 Constraint 412 552 12.0799 15.0999 22.6499 5.7938 Constraint 404 577 8.4977 10.6221 15.9332 5.7881 Constraint 303 467 12.5439 15.6799 23.5199 5.7784 Constraint 322 571 10.8131 13.5164 20.2746 5.7750 Constraint 314 571 9.0778 11.3472 17.0208 5.7750 Constraint 292 571 11.4780 14.3475 21.5212 5.7750 Constraint 259 571 11.5009 14.3761 21.5642 5.7750 Constraint 442 590 11.5051 14.3813 21.5720 5.7702 Constraint 221 651 14.6200 18.2750 27.4126 5.7590 Constraint 190 651 13.2452 16.5565 24.8348 5.7590 Constraint 182 651 11.1059 13.8824 20.8235 5.7590 Constraint 176 651 11.0926 13.8658 20.7987 5.7590 Constraint 272 590 13.1627 16.4533 24.6800 5.7513 Constraint 341 651 14.1088 17.6360 26.4540 5.6759 Constraint 136 613 11.9623 14.9528 22.4293 5.6645 Constraint 136 604 9.1653 11.4567 17.1850 5.6645 Constraint 128 613 11.9172 14.8965 22.3447 5.6645 Constraint 128 604 8.7007 10.8759 16.3138 5.6645 Constraint 128 590 11.6310 14.5388 21.8082 5.6645 Constraint 122 590 12.0723 15.0903 22.6355 5.6645 Constraint 113 622 13.0022 16.2528 24.3792 5.6645 Constraint 113 590 12.5590 15.6987 23.5481 5.6645 Constraint 104 604 8.9112 11.1389 16.7084 5.6645 Constraint 104 590 11.3809 14.2261 21.3392 5.6645 Constraint 435 636 12.3627 15.4533 23.1800 5.6571 Constraint 161 604 9.9366 12.4208 18.6311 5.6561 Constraint 399 544 12.1619 15.2023 22.8035 5.6498 Constraint 435 571 12.4659 15.5823 23.3735 5.6478 Constraint 161 622 12.6896 15.8620 23.7931 5.6439 Constraint 404 544 13.8985 17.3731 26.0597 5.6315 Constraint 552 644 14.1880 17.7350 26.6025 5.6161 Constraint 80 599 12.3419 15.4274 23.1411 5.5866 Constraint 169 651 11.7107 14.6383 21.9575 5.5737 Constraint 303 544 12.4717 15.5897 23.3845 5.5730 Constraint 279 544 12.2520 15.3150 22.9725 5.5730 Constraint 279 535 14.9140 18.6425 27.9637 5.5730 Constraint 267 535 14.2425 17.8031 26.7047 5.5730 Constraint 489 651 13.7868 17.2335 25.8502 5.5678 Constraint 404 657 8.9901 11.2376 16.8564 5.5633 Constraint 391 636 13.0980 16.3725 24.5587 5.5633 Constraint 382 657 10.4582 13.0727 19.6091 5.5633 Constraint 375 657 8.1899 10.2374 15.3561 5.5633 Constraint 399 668 13.7084 17.1356 25.7033 5.5556 Constraint 190 585 13.9959 17.4949 26.2424 5.5538 Constraint 442 544 12.1765 15.2206 22.8309 5.5536 Constraint 182 511 14.7062 18.3827 27.5740 5.5478 Constraint 442 571 12.2457 15.3071 22.9607 5.4603 Constraint 399 577 9.8884 12.3606 18.5408 5.4468 Constraint 242 585 10.7567 13.4459 20.1689 5.4417 Constraint 267 552 14.5990 18.2487 27.3730 5.3838 Constraint 314 644 13.1499 16.4374 24.6560 5.3664 Constraint 314 668 13.0258 16.2823 24.4234 5.3644 Constraint 292 657 12.4216 15.5270 23.2905 5.3644 Constraint 285 668 14.2945 17.8681 26.8022 5.3644 Constraint 259 668 14.3279 17.9099 26.8649 5.3644 Constraint 242 668 14.4545 18.0682 27.1023 5.3644 Constraint 297 644 10.6676 13.3345 20.0017 5.3542 Constraint 292 644 11.6069 14.5086 21.7629 5.3542 Constraint 272 651 13.1903 16.4878 24.7318 5.3542 Constraint 272 644 12.1467 15.1833 22.7750 5.3542 Constraint 182 644 9.3390 11.6737 17.5105 5.3542 Constraint 226 636 12.3225 15.4032 23.1048 5.3510 Constraint 153 590 13.3991 16.7489 25.1233 5.3078 Constraint 391 557 10.5975 13.2469 19.8703 5.2565 Constraint 161 613 11.7941 14.7426 22.1139 5.2391 Constraint 161 557 13.7538 17.1922 25.7883 5.2363 Constraint 161 552 13.4628 16.8285 25.2428 5.2363 Constraint 153 571 11.6138 14.5172 21.7759 5.2363 Constraint 210 552 13.1293 16.4116 24.6174 5.2209 Constraint 104 629 10.1928 12.7409 19.1114 5.1881 Constraint 88 651 13.2778 16.5973 24.8959 5.1881 Constraint 88 644 14.2567 17.8209 26.7314 5.1881 Constraint 210 644 10.1670 12.7087 19.0631 5.1760 Constraint 201 644 10.0204 12.5255 18.7882 5.1760 Constraint 190 644 11.2075 14.0094 21.0141 5.1760 Constraint 169 668 11.6652 14.5815 21.8723 5.1689 Constraint 169 657 11.2965 14.1206 21.1809 5.1689 Constraint 237 657 13.6538 17.0673 25.6009 5.1689 Constraint 259 590 9.5860 11.9825 17.9738 5.1683 Constraint 250 590 9.0578 11.3222 16.9833 5.1683 Constraint 226 590 10.5378 13.1722 19.7583 5.1683 Constraint 88 544 8.8191 11.0239 16.5359 5.1431 Constraint 391 577 7.6385 9.5482 14.3222 5.1315 Constraint 391 571 8.0203 10.0253 15.0380 5.1315 Constraint 368 577 9.8527 12.3159 18.4739 5.1315 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 355 577 10.5520 13.1901 19.7851 5.1315 Constraint 355 571 11.3910 14.2387 21.3580 5.1315 Constraint 421 668 13.9012 17.3766 26.0648 5.1229 Constraint 237 571 11.2505 14.0631 21.0947 5.1123 Constraint 341 644 13.9623 17.4529 26.1793 5.1075 Constraint 668 742 9.3796 11.7244 17.5867 5.0954 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 651 742 13.2348 16.5435 24.8153 5.0954 Constraint 442 636 13.1286 16.4107 24.6161 5.0192 Constraint 226 467 13.7562 17.1953 25.7929 5.0051 Constraint 190 467 13.7204 17.1505 25.7257 5.0051 Constraint 104 622 10.9527 13.6909 20.5364 4.9977 Constraint 527 629 9.3628 11.7035 17.5553 4.9921 Constraint 519 629 10.8032 13.5040 20.2559 4.9921 Constraint 511 629 11.0937 13.8672 20.8007 4.9921 Constraint 161 360 15.8635 19.8294 29.7441 4.9920 Constraint 153 375 15.8076 19.7595 29.6392 4.9920 Constraint 153 368 15.1699 18.9623 28.4435 4.9920 Constraint 412 644 14.9201 18.6501 27.9752 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 399 644 10.8733 13.5916 20.3875 4.9904 Constraint 350 622 13.5836 16.9795 25.4692 4.9904 Constraint 473 668 10.5373 13.1716 19.7574 4.9884 Constraint 429 668 14.3714 17.9642 26.9463 4.9827 Constraint 489 636 11.4076 14.2595 21.3892 4.9745 Constraint 285 571 10.8206 13.5257 20.2886 4.9654 Constraint 330 657 10.7961 13.4952 20.2428 4.9596 Constraint 314 676 13.4401 16.8001 25.2001 4.9596 Constraint 360 557 10.8354 13.5443 20.3164 4.9565 Constraint 355 557 11.9757 14.9696 22.4544 4.9565 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 303 644 13.8535 17.3168 25.9753 4.9494 Constraint 297 651 10.9259 13.6574 20.4861 4.9494 Constraint 279 651 14.4113 18.0141 27.0211 4.9494 Constraint 279 644 13.7781 17.2227 25.8340 4.9494 Constraint 279 590 14.3372 17.9215 26.8823 4.9416 Constraint 176 368 15.2096 19.0120 28.5181 4.9120 Constraint 267 461 15.1514 18.9393 28.4089 4.8980 Constraint 96 577 11.6202 14.5252 21.7878 4.8967 Constraint 297 467 10.3673 12.9592 19.4388 4.8967 Constraint 368 544 15.2886 19.1107 28.6660 4.8259 Constraint 153 585 12.0631 15.0789 22.6183 4.8060 Constraint 412 571 12.1450 15.1812 22.7719 4.7957 Constraint 412 557 11.9867 14.9834 22.4751 4.7957 Constraint 404 557 13.1589 16.4487 24.6730 4.7957 Constraint 399 557 12.5868 15.7335 23.6002 4.7957 Constraint 375 571 9.5412 11.9265 17.8898 4.7952 Constraint 250 577 11.6349 14.5437 21.8155 4.7750 Constraint 221 571 12.5772 15.7215 23.5823 4.7750 Constraint 279 622 15.2191 19.0238 28.5357 4.7744 Constraint 429 676 14.9281 18.6602 27.9902 4.7718 Constraint 421 676 14.3843 17.9804 26.9706 4.7718 Constraint 201 651 12.0911 15.1139 22.6709 4.7712 Constraint 272 585 13.7903 17.2378 25.8567 4.7442 Constraint 96 613 12.4256 15.5320 23.2981 4.6683 Constraint 429 571 11.7846 14.7308 22.0962 4.6498 Constraint 201 535 13.8789 17.3486 26.0229 4.6411 Constraint 226 577 11.4860 14.3575 21.5363 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 190 577 10.8965 13.6206 20.4309 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 404 668 12.2559 15.3198 22.9797 4.5633 Constraint 382 668 13.1645 16.4556 24.6834 4.5633 Constraint 375 668 10.5819 13.2273 19.8410 4.5633 Constraint 368 668 13.4308 16.7885 25.1828 4.5633 Constraint 341 629 13.0854 16.3568 24.5352 4.5569 Constraint 341 636 14.0739 17.5924 26.3886 4.5492 Constraint 341 698 13.4198 16.7748 25.1622 4.5480 Constraint 341 687 13.9644 17.4555 26.1832 4.5480 Constraint 341 676 12.5875 15.7344 23.6016 4.5345 Constraint 161 571 12.3602 15.4502 23.1753 4.4267 Constraint 161 544 11.0392 13.7990 20.6986 4.4267 Constraint 161 535 10.4552 13.0690 19.6035 4.4267 Constraint 161 279 15.5728 19.4660 29.1989 4.4156 Constraint 322 698 12.9511 16.1889 24.2833 4.3798 Constraint 297 698 11.8512 14.8140 22.2210 4.3798 Constraint 292 698 13.2226 16.5283 24.7925 4.3798 Constraint 292 687 14.9226 18.6532 27.9799 4.3798 Constraint 279 698 13.4424 16.8030 25.2045 4.3798 Constraint 221 698 14.3185 17.8982 26.8473 4.3798 Constraint 210 698 14.3704 17.9631 26.9446 4.3798 Constraint 259 657 14.1304 17.6630 26.4945 4.3798 Constraint 330 668 9.1691 11.4614 17.1921 4.3664 Constraint 322 676 9.7726 12.2157 18.3236 4.3664 Constraint 322 668 9.1989 11.4986 17.2479 4.3664 Constraint 303 668 13.1281 16.4101 24.6151 4.3664 Constraint 297 676 9.9632 12.4540 18.6810 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 292 676 12.1649 15.2061 22.8091 4.3664 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 279 668 12.3396 15.4245 23.1367 4.3664 Constraint 272 676 12.5646 15.7057 23.5586 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 272 657 12.0233 15.0291 22.5437 4.3664 Constraint 267 668 14.0080 17.5100 26.2650 4.3664 Constraint 226 668 13.6343 17.0429 25.5644 4.3664 Constraint 221 668 11.6433 14.5541 21.8312 4.3664 Constraint 221 657 13.1227 16.4033 24.6050 4.3664 Constraint 221 644 11.9865 14.9831 22.4746 4.3664 Constraint 210 676 12.4326 15.5408 23.3111 4.3664 Constraint 210 668 10.2023 12.7528 19.1292 4.3664 Constraint 201 668 10.4398 13.0498 19.5746 4.3664 Constraint 190 676 12.7959 15.9949 23.9923 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 190 657 11.4202 14.2752 21.4128 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 657 9.1175 11.3968 17.0953 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 657 9.2254 11.5317 17.2976 4.3664 Constraint 250 636 14.5946 18.2432 27.3648 4.3587 Constraint 161 404 14.8242 18.5302 27.7954 4.3581 Constraint 404 571 9.9907 12.4883 18.7325 4.3344 Constraint 297 480 10.9284 13.6605 20.4907 4.3057 Constraint 279 480 14.0013 17.5016 26.2525 4.3057 Constraint 161 585 9.9082 12.3853 18.5780 4.2513 Constraint 169 571 13.7851 17.2314 25.8471 4.2363 Constraint 169 557 13.3925 16.7407 25.1110 4.2363 Constraint 169 552 12.9210 16.1513 24.2269 4.2363 Constraint 153 604 11.1652 13.9564 20.9347 4.2146 Constraint 153 599 10.8111 13.5139 20.2709 4.2146 Constraint 128 557 11.1402 13.9252 20.8878 4.2009 Constraint 88 668 14.0031 17.5038 26.2557 4.1901 Constraint 88 657 11.7365 14.6706 22.0059 4.1901 Constraint 113 651 12.1829 15.2286 22.8428 4.1881 Constraint 113 644 12.5386 15.6733 23.5099 4.1881 Constraint 104 651 11.1556 13.9445 20.9168 4.1881 Constraint 104 644 12.1683 15.2104 22.8156 4.1881 Constraint 104 636 11.2321 14.0402 21.0603 4.1881 Constraint 237 644 11.9856 14.9821 22.4731 4.1837 Constraint 226 644 12.7780 15.9724 23.9587 4.1837 Constraint 368 557 10.4382 13.0478 19.5717 4.1469 Constraint 88 557 11.8508 14.8135 22.2202 4.1412 Constraint 242 557 12.4259 15.5324 23.2986 4.1258 Constraint 341 657 11.2228 14.0285 21.0428 4.1209 Constraint 201 571 13.3051 16.6313 24.9470 4.1123 Constraint 382 552 10.0240 12.5300 18.7949 4.1105 Constraint 442 651 12.8578 16.0723 24.1084 4.0269 Constraint 442 644 13.9809 17.4761 26.2142 4.0192 Constraint 58 279 14.8066 18.5082 27.7624 4.0163 Constraint 58 242 13.6345 17.0431 25.5646 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 391 15.0745 18.8432 28.2648 4.0163 Constraint 51 375 13.9085 17.3857 26.0785 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 355 11.8633 14.8291 22.2437 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 242 13.8008 17.2510 25.8766 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 182 15.2071 19.0089 28.5133 4.0163 Constraint 51 169 14.9992 18.7489 28.1234 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 375 15.1260 18.9075 28.3612 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 341 15.2699 19.0874 28.6310 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 96 622 11.0935 13.8669 20.8004 4.0016 Constraint 467 668 13.1516 16.4395 24.6592 3.9904 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 350 571 11.7574 14.6968 22.0452 3.9855 Constraint 341 622 13.3094 16.6367 24.9550 3.9840 Constraint 552 651 13.2321 16.5401 24.8102 3.9826 Constraint 519 651 13.0045 16.2557 24.3835 3.9758 Constraint 511 657 12.6569 15.8211 23.7316 3.9758 Constraint 341 706 11.5132 14.3915 21.5873 3.9750 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 330 698 11.2860 14.1075 21.1613 3.9750 Constraint 330 687 11.6327 14.5408 21.8113 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 322 687 13.1670 16.4587 24.6881 3.9750 Constraint 314 706 12.9270 16.1588 24.2381 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 297 706 9.9401 12.4251 18.6376 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 285 706 13.4088 16.7610 25.1415 3.9750 Constraint 279 706 11.6634 14.5792 21.8688 3.9750 Constraint 267 706 13.9092 17.3865 26.0798 3.9750 Constraint 497 657 10.5611 13.2014 19.8021 3.9726 Constraint 497 644 11.6219 14.5274 21.7911 3.9726 Constraint 489 644 12.8650 16.0813 24.1219 3.9726 Constraint 285 585 11.5974 14.4968 21.7452 3.9654 Constraint 267 571 12.6772 15.8465 23.7698 3.9654 Constraint 259 585 11.6190 14.5238 21.7857 3.9654 Constraint 303 636 13.9377 17.4221 26.1332 3.9647 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 303 676 13.1837 16.4796 24.7193 3.9616 Constraint 297 657 10.0349 12.5436 18.8155 3.9616 Constraint 279 676 13.3365 16.6706 25.0058 3.9616 Constraint 279 657 13.6141 17.0176 25.5264 3.9616 Constraint 303 651 13.7974 17.2467 25.8701 3.9570 Constraint 267 590 12.4954 15.6193 23.4289 3.9538 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 104 557 10.1808 12.7260 19.0889 3.9009 Constraint 122 636 11.3771 14.2214 21.3321 3.8587 Constraint 644 742 10.9852 13.7315 20.5972 3.8557 Constraint 629 742 13.7805 17.2256 25.8384 3.8557 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 69 535 15.7994 19.7493 29.6239 3.8531 Constraint 58 382 14.7513 18.4392 27.6588 3.8531 Constraint 161 636 11.9377 14.9221 22.3831 3.8465 Constraint 161 629 11.3242 14.1552 21.2328 3.8465 Constraint 375 557 10.2996 12.8745 19.3117 3.8105 Constraint 350 557 13.3391 16.6739 25.0108 3.8105 Constraint 375 544 13.5737 16.9672 25.4507 3.8096 Constraint 322 557 10.8606 13.5757 20.3636 3.7923 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 461 644 12.4056 15.5071 23.2606 3.7872 Constraint 250 571 10.0982 12.6228 18.9341 3.7788 Constraint 122 622 10.7926 13.4907 20.2361 3.6683 Constraint 404 552 11.0995 13.8743 20.8115 3.6498 Constraint 435 544 10.8331 13.5414 20.3121 3.6479 Constraint 412 544 11.9468 14.9335 22.4003 3.6479 Constraint 237 651 13.5822 16.9778 25.4667 3.5814 Constraint 497 651 11.5614 14.4517 21.6776 3.5678 Constraint 360 676 14.7472 18.4340 27.6509 3.5576 Constraint 355 676 15.2372 19.0464 28.5697 3.5576 Constraint 355 706 14.9485 18.6857 28.0285 3.5499 Constraint 636 742 13.9318 17.4148 26.1221 3.5244 Constraint 226 585 13.0403 16.3004 24.4505 3.4456 Constraint 176 535 13.7619 17.2024 25.8036 3.4267 Constraint 535 651 12.5672 15.7090 23.5635 3.4028 Constraint 259 676 14.8105 18.5132 27.7697 3.3875 Constraint 242 676 15.0940 18.8674 28.3012 3.3875 Constraint 250 657 15.1634 18.9543 28.4314 3.3875 Constraint 272 698 11.9642 14.9552 22.4328 3.3818 Constraint 272 687 14.1573 17.6967 26.5450 3.3818 Constraint 210 687 14.9224 18.6530 27.9795 3.3818 Constraint 201 698 13.6251 17.0314 25.5471 3.3818 Constraint 190 698 12.0980 15.1225 22.6838 3.3818 Constraint 190 687 14.1709 17.7136 26.5704 3.3818 Constraint 182 698 10.4633 13.0791 19.6187 3.3818 Constraint 182 687 11.9522 14.9402 22.4103 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 698 13.2887 16.6109 24.9163 3.3818 Constraint 169 687 13.7257 17.1572 25.7358 3.3818 Constraint 169 676 11.2641 14.0801 21.1202 3.3818 Constraint 259 644 13.4950 16.8687 25.3030 3.3740 Constraint 242 644 12.9057 16.1322 24.1983 3.3740 Constraint 237 668 13.4069 16.7587 25.1380 3.3740 Constraint 221 676 13.3382 16.6728 25.0091 3.3740 Constraint 201 676 12.3335 15.4169 23.1253 3.3740 Constraint 449 657 12.5303 15.6628 23.4943 3.3601 Constraint 449 651 11.5002 14.3753 21.5629 3.3601 Constraint 449 644 12.3425 15.4281 23.1421 3.3601 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 341 13.1862 16.4828 24.7242 3.3388 Constraint 33 322 12.3424 15.4280 23.1419 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 33 113 11.4267 14.2834 21.4251 3.3388 Constraint 33 104 11.6713 14.5891 21.8837 3.3388 Constraint 544 687 14.1563 17.6953 26.5430 3.3315 Constraint 613 713 12.3453 15.4316 23.1475 3.3296 Constraint 571 698 12.5180 15.6475 23.4713 3.3296 Constraint 571 687 11.6965 14.6206 21.9309 3.3296 Constraint 557 706 13.3322 16.6653 24.9979 3.3296 Constraint 557 687 12.7531 15.9414 23.9120 3.3296 Constraint 279 489 13.2031 16.5039 24.7559 3.3076 Constraint 272 489 12.1729 15.2161 22.8242 3.3076 Constraint 272 480 11.9792 14.9740 22.4610 3.3076 Constraint 267 480 13.6630 17.0788 25.6181 3.3076 Constraint 226 480 14.2207 17.7758 26.6638 3.3076 Constraint 221 480 11.9320 14.9150 22.3726 3.3076 Constraint 201 480 13.2349 16.5436 24.8154 3.3076 Constraint 190 535 15.5556 19.4445 29.1668 3.3076 Constraint 190 489 13.9838 17.4797 26.2195 3.3076 Constraint 190 480 13.2781 16.5977 24.8965 3.3076 Constraint 399 571 7.7099 9.6373 14.4560 3.3009 Constraint 144 382 15.2987 19.1234 28.6851 3.2983 Constraint 144 657 12.3557 15.4447 23.1670 3.2611 Constraint 96 657 12.0609 15.0761 22.6142 3.1920 Constraint 96 636 11.6166 14.5207 21.7811 3.1920 Constraint 136 657 10.2395 12.7994 19.1991 3.1901 Constraint 128 657 10.6896 13.3621 20.0431 3.1901 Constraint 122 668 12.9830 16.2288 24.3432 3.1901 Constraint 122 657 10.9685 13.7106 20.5659 3.1901 Constraint 113 676 13.5649 16.9561 25.4342 3.1901 Constraint 113 668 11.8192 14.7740 22.1610 3.1901 Constraint 113 657 9.4139 11.7674 17.6511 3.1901 Constraint 104 676 12.3897 15.4871 23.2307 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 104 657 8.9961 11.2451 16.8676 3.1901 Constraint 88 676 14.3002 17.8753 26.8129 3.1901 Constraint 360 668 13.1210 16.4012 24.6018 3.1383 Constraint 355 668 13.3789 16.7236 25.0854 3.1383 Constraint 350 651 12.1581 15.1976 22.7965 3.1337 Constraint 355 657 11.7553 14.6941 22.0411 3.1305 Constraint 350 657 12.7233 15.9042 23.8562 3.1305 Constraint 242 552 10.3386 12.9232 19.3848 3.1277 Constraint 237 557 12.7965 15.9956 23.9934 3.1277 Constraint 237 552 12.1488 15.1860 22.7790 3.1277 Constraint 350 644 14.3862 17.9828 26.9742 3.1183 Constraint 250 480 12.4504 15.5630 23.3446 3.1125 Constraint 279 461 14.4455 18.0569 27.0853 3.1096 Constraint 144 644 12.6119 15.7649 23.6474 3.0726 Constraint 144 622 12.3255 15.4069 23.1103 3.0726 Constraint 176 720 15.1955 18.9944 28.4915 3.0562 Constraint 161 644 12.0042 15.0053 22.5079 3.0016 Constraint 136 622 10.8896 13.6120 20.4179 3.0016 Constraint 128 644 10.7289 13.4112 20.1168 3.0016 Constraint 128 622 8.7995 10.9994 16.4991 3.0016 Constraint 382 557 8.8518 11.0648 16.5972 3.0009 Constraint 368 552 7.6438 9.5547 14.3321 3.0009 Constraint 355 552 9.3676 11.7095 17.5642 3.0009 Constraint 69 161 15.8337 19.7921 29.6881 3.0000 Constraint 58 272 15.7130 19.6412 29.4618 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 442 14.9773 18.7216 28.0823 3.0000 Constraint 51 435 15.6866 19.6083 29.4124 3.0000 Constraint 51 429 11.6845 14.6056 21.9084 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 412 15.9369 19.9212 29.8817 3.0000 Constraint 51 350 13.6796 17.0995 25.6492 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 449 15.2094 19.0117 28.5176 3.0000 Constraint 41 429 14.3138 17.8923 26.8384 3.0000 Constraint 41 421 14.7267 18.4084 27.6126 3.0000 Constraint 41 399 13.2985 16.6232 24.9347 3.0000 Constraint 41 368 15.4696 19.3369 29.0054 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 350 15.2976 19.1220 28.6831 3.0000 Constraint 41 330 14.9440 18.6800 28.0201 3.0000 Constraint 41 322 13.8643 17.3304 25.9956 3.0000 Constraint 41 144 15.8400 19.8000 29.7000 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 480 14.5110 18.1388 27.2081 3.0000 Constraint 33 473 15.0623 18.8278 28.2417 3.0000 Constraint 33 461 15.5970 19.4962 29.2444 3.0000 Constraint 33 449 15.7955 19.7444 29.6166 3.0000 Constraint 33 429 15.9870 19.9838 29.9757 3.0000 Constraint 33 421 15.3922 19.2402 28.8603 3.0000 Constraint 33 355 11.4914 14.3642 21.5463 3.0000 Constraint 33 350 14.2217 17.7772 26.6657 3.0000 Constraint 33 330 12.2735 15.3418 23.0128 3.0000 Constraint 33 144 15.5803 19.4753 29.2130 3.0000 Constraint 33 136 15.3693 19.2117 28.8175 3.0000 Constraint 33 128 15.1971 18.9963 28.4945 3.0000 Constraint 511 622 9.9739 12.4674 18.7011 2.9922 Constraint 511 613 11.3190 14.1488 21.2232 2.9922 Constraint 176 355 15.9332 19.9165 29.8747 2.9886 Constraint 161 350 13.1662 16.4577 24.6866 2.9886 Constraint 399 676 14.2036 17.7545 26.6318 2.9846 Constraint 341 729 15.5947 19.4934 29.2401 2.9827 Constraint 341 720 12.4049 15.5062 23.2593 2.9827 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 720 11.4433 14.3042 21.4563 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 720 14.9429 18.6787 28.0180 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 314 687 14.5504 18.1880 27.2821 2.9827 Constraint 303 720 13.2566 16.5707 24.8561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 303 687 14.9670 18.7087 28.0631 2.9827 Constraint 297 713 10.9330 13.6663 20.4994 2.9827 Constraint 292 713 13.4471 16.8089 25.2134 2.9827 Constraint 285 720 15.6198 19.5248 29.2872 2.9827 Constraint 285 713 14.5005 18.1257 27.1885 2.9827 Constraint 285 676 14.2290 17.7862 26.6794 2.9827 Constraint 279 713 13.3615 16.7019 25.0529 2.9827 Constraint 259 706 14.4390 18.0487 27.0730 2.9827 Constraint 511 636 13.3774 16.7217 25.0825 2.9777 Constraint 421 706 15.3202 19.1503 28.7254 2.9769 Constraint 360 706 15.6405 19.5506 29.3260 2.9769 Constraint 350 706 14.0808 17.6010 26.4016 2.9769 Constraint 297 687 11.5783 14.4729 21.7094 2.9769 Constraint 279 687 14.7735 18.4669 27.7004 2.9769 Constraint 272 706 10.4848 13.1060 19.6590 2.9769 Constraint 221 706 13.4076 16.7595 25.1393 2.9769 Constraint 210 706 13.5422 16.9278 25.3917 2.9769 Constraint 201 706 14.3364 17.9204 26.8807 2.9769 Constraint 190 706 11.9135 14.8919 22.3378 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 169 706 13.6706 17.0882 25.6324 2.9769 Constraint 497 668 10.1778 12.7222 19.0834 2.9759 Constraint 527 676 12.5910 15.7388 23.6082 2.9758 Constraint 527 657 9.2490 11.5613 17.3419 2.9758 Constraint 527 651 10.0309 12.5387 18.8080 2.9758 Constraint 527 644 11.3009 14.1261 21.1892 2.9758 Constraint 519 687 13.2521 16.5651 24.8477 2.9758 Constraint 519 657 10.9086 13.6358 20.4536 2.9758 Constraint 519 644 13.2772 16.5964 24.8947 2.9758 Constraint 303 657 12.6983 15.8729 23.8093 2.9750 Constraint 285 657 13.3307 16.6634 24.9951 2.9750 Constraint 285 644 13.6734 17.0917 25.6375 2.9692 Constraint 267 644 14.1592 17.6990 26.5485 2.9692 Constraint 201 355 15.2622 19.0777 28.6166 2.9118 Constraint 176 382 15.3874 19.2342 28.8513 2.8709 Constraint 161 657 12.5642 15.7052 23.5578 2.8587 Constraint 136 636 8.9329 11.1661 16.7492 2.8587 Constraint 136 629 8.3249 10.4062 15.6092 2.8587 Constraint 128 636 9.4497 11.8121 17.7182 2.8587 Constraint 128 629 7.9865 9.9831 14.9747 2.8587 Constraint 122 644 11.8086 14.7608 22.1412 2.8587 Constraint 80 613 13.0499 16.3124 24.4685 2.8582 Constraint 69 544 15.7886 19.7358 29.6037 2.8367 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 58 585 15.1166 18.8958 28.3437 2.8367 Constraint 58 557 14.1313 17.6641 26.4962 2.8367 Constraint 58 552 12.3955 15.4944 23.2416 2.8367 Constraint 58 544 15.4290 19.2863 28.9294 2.8367 Constraint 58 535 14.8581 18.5726 27.8589 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 292 557 11.6106 14.5133 21.7699 2.7923 Constraint 285 557 12.9804 16.2255 24.3383 2.7923 Constraint 259 557 12.5788 15.7235 23.5852 2.7923 Constraint 210 557 11.5494 14.4367 21.6551 2.7923 Constraint 182 557 13.5189 16.8987 25.3480 2.7923 Constraint 461 668 14.2481 17.8101 26.7152 2.7872 Constraint 449 668 14.5718 18.2147 27.3220 2.7872 Constraint 250 585 12.0882 15.1103 22.6654 2.7788 Constraint 622 729 12.4512 15.5640 23.3459 2.6629 Constraint 599 729 12.1317 15.1647 22.7470 2.6629 Constraint 590 713 11.4115 14.2643 21.3965 2.6629 Constraint 571 713 10.2855 12.8568 19.2852 2.6629 Constraint 557 713 12.0803 15.1004 22.6505 2.6629 Constraint 169 713 15.0411 18.8013 28.2020 2.6514 Constraint 161 651 12.6817 15.8521 23.7781 2.5968 Constraint 128 651 9.8717 12.3396 18.5094 2.5968 Constraint 80 577 13.0842 16.3552 24.5328 2.5963 Constraint 497 687 11.9138 14.8922 22.3384 2.5710 Constraint 497 676 12.3074 15.3843 23.0764 2.5710 Constraint 341 467 14.9417 18.6772 28.0158 2.5709 Constraint 169 375 15.2995 19.1244 28.6866 2.5709 Constraint 497 636 9.6923 12.1154 18.1730 2.5698 Constraint 421 698 15.0363 18.7953 28.1930 2.5653 Constraint 360 698 14.5322 18.1652 27.2478 2.5653 Constraint 267 511 15.0059 18.7574 28.1361 2.5479 Constraint 237 519 10.2084 12.7605 19.1408 2.5479 Constraint 226 519 12.7136 15.8920 23.8379 2.5479 Constraint 226 511 12.5971 15.7464 23.6196 2.5479 Constraint 201 519 12.3622 15.4528 23.1792 2.5479 Constraint 201 511 12.5551 15.6938 23.5408 2.5479 Constraint 190 511 14.7287 18.4109 27.6164 2.5479 Constraint 176 519 14.6154 18.2693 27.4039 2.5479 Constraint 489 698 10.4019 13.0024 19.5036 2.4029 Constraint 489 668 10.0708 12.5886 18.8828 2.4029 Constraint 242 687 14.9586 18.6982 28.0474 2.4029 Constraint 535 657 10.6905 13.3632 20.0448 2.4028 Constraint 535 644 12.0619 15.0774 22.6160 2.4028 Constraint 314 698 12.3814 15.4768 23.2152 2.3952 Constraint 285 698 12.4884 15.6105 23.4158 2.3952 Constraint 267 698 13.1375 16.4219 24.6329 2.3952 Constraint 259 698 12.7611 15.9514 23.9270 2.3952 Constraint 226 676 14.8095 18.5118 27.7677 2.3894 Constraint 226 657 12.8221 16.0276 24.0414 2.3817 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 585 706 12.0782 15.0977 22.6465 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 552 706 14.1486 17.6857 26.5286 2.3315 Constraint 552 687 13.3483 16.6854 25.0281 2.3315 Constraint 544 706 13.4756 16.8445 25.2668 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 511 706 14.3576 17.9470 26.9204 2.3315 Constraint 144 668 12.3647 15.4559 23.1838 2.2630 Constraint 144 651 12.1540 15.1925 22.7888 2.2630 Constraint 144 636 9.3843 11.7304 17.5955 2.2630 Constraint 144 629 9.0009 11.2511 16.8766 2.2630 Constraint 442 668 14.8416 18.5520 27.8280 2.2320 Constraint 161 668 13.3221 16.6526 24.9789 2.1920 Constraint 136 676 12.0285 15.0356 22.5534 2.1920 Constraint 136 668 10.3614 12.9517 19.4276 2.1920 Constraint 136 651 9.5354 11.9192 17.8788 2.1920 Constraint 136 644 9.3581 11.6976 17.5464 2.1920 Constraint 128 676 11.9492 14.9365 22.4048 2.1920 Constraint 128 668 10.7631 13.4539 20.1808 2.1920 Constraint 122 676 13.7265 17.1582 25.7372 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 96 676 13.2223 16.5278 24.7917 2.1920 Constraint 96 668 12.7114 15.8892 23.8338 2.1920 Constraint 96 651 9.4922 11.8653 17.7979 2.1920 Constraint 96 644 10.9546 13.6932 20.5398 2.1920 Constraint 80 636 11.9829 14.9787 22.4680 2.1914 Constraint 80 629 9.7710 12.2138 18.3207 2.1914 Constraint 80 622 11.2755 14.0944 21.1416 2.1914 Constraint 421 687 13.8678 17.3348 26.0021 2.1687 Constraint 391 668 12.9883 16.2353 24.3530 2.1459 Constraint 382 544 14.6531 18.3164 27.4746 2.1431 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 226 544 14.6284 18.2854 27.4282 2.1431 Constraint 201 544 13.2133 16.5166 24.7749 2.1431 Constraint 350 668 13.2982 16.6228 24.9342 2.1383 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 267 467 12.8439 16.0548 24.0823 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 144 368 15.8136 19.7670 29.6504 2.0002 Constraint 122 687 14.7956 18.4945 27.7417 1.9986 Constraint 497 698 9.9911 12.4889 18.7333 1.9981 Constraint 489 687 11.8799 14.8498 22.2748 1.9981 Constraint 489 676 12.6621 15.8276 23.7414 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 687 12.0985 15.1231 22.6847 1.9981 Constraint 480 676 12.1720 15.2150 22.8225 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 557 676 13.5011 16.8764 25.3145 1.9980 Constraint 544 676 14.8393 18.5491 27.8237 1.9980 Constraint 544 657 11.3592 14.1990 21.2985 1.9980 Constraint 544 651 11.5427 14.4283 21.6425 1.9980 Constraint 544 644 13.3011 16.6264 24.9395 1.9980 Constraint 613 729 13.4003 16.7504 25.1256 1.9962 Constraint 613 720 13.4091 16.7613 25.1420 1.9962 Constraint 571 676 14.2406 17.8007 26.7011 1.9962 Constraint 571 668 13.3454 16.6817 25.0225 1.9962 Constraint 557 698 12.2378 15.2973 22.9460 1.9962 Constraint 303 698 11.8475 14.8093 22.2140 1.9904 Constraint 350 636 13.3899 16.7374 25.1061 1.9878 Constraint 350 613 15.4159 19.2698 28.9047 1.9878 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 355 713 15.3147 19.1433 28.7150 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 350 676 14.2953 17.8691 26.8036 1.9846 Constraint 330 735 14.3219 17.9024 26.8536 1.9846 Constraint 330 729 13.7593 17.1991 25.7986 1.9846 Constraint 322 720 13.0323 16.2904 24.4355 1.9846 Constraint 297 729 14.6404 18.3005 27.4508 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 292 720 14.5620 18.2026 27.3038 1.9846 Constraint 279 729 15.9892 19.9865 29.9798 1.9846 Constraint 279 720 12.1029 15.1287 22.6930 1.9846 Constraint 272 720 13.5825 16.9782 25.4672 1.9846 Constraint 272 713 12.4496 15.5619 23.3429 1.9846 Constraint 267 720 15.8089 19.7612 29.6418 1.9846 Constraint 267 713 15.4782 19.3477 29.0216 1.9846 Constraint 267 676 14.2774 17.8468 26.7701 1.9846 Constraint 226 706 15.5984 19.4980 29.2471 1.9846 Constraint 221 713 15.1487 18.9358 28.4038 1.9846 Constraint 210 713 14.7464 18.4330 27.6494 1.9846 Constraint 190 713 14.0991 17.6239 26.4358 1.9846 Constraint 182 720 13.0729 16.3411 24.5117 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 713 12.8130 16.0163 24.0244 1.9846 Constraint 279 636 12.5267 15.6583 23.4875 1.9801 Constraint 267 636 14.7547 18.4434 27.6651 1.9801 Constraint 527 636 11.8476 14.8095 22.2142 1.9777 Constraint 519 636 12.7619 15.9524 23.9286 1.9777 Constraint 267 657 13.2406 16.5507 24.8260 1.9769 Constraint 527 698 10.0694 12.5867 18.8801 1.9759 Constraint 527 687 9.9418 12.4272 18.6409 1.9759 Constraint 527 668 9.2554 11.5693 17.3539 1.9759 Constraint 519 676 13.6823 17.1029 25.6544 1.9759 Constraint 519 668 11.0903 13.8628 20.7942 1.9759 Constraint 511 668 10.9288 13.6611 20.4916 1.9759 Constraint 511 644 11.8123 14.7654 22.1481 1.9759 Constraint 285 651 14.2835 17.8544 26.7816 1.9724 Constraint 267 651 14.6895 18.3618 27.5427 1.9724 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 585 12.4279 15.5349 23.3023 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 190 571 12.3536 15.4420 23.1630 1.9692 Constraint 176 571 13.5089 16.8862 25.3293 1.9692 Constraint 153 644 11.1258 13.9072 20.8608 1.8812 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 153 613 10.5444 13.1805 19.7707 1.8812 Constraint 355 544 13.1987 16.4984 24.7476 1.8259 Constraint 350 544 12.2307 15.2884 22.9326 1.8259 Constraint 96 571 11.2767 14.0959 21.1438 1.8096 Constraint 96 557 10.6861 13.3577 20.0365 1.8096 Constraint 272 557 14.7947 18.4934 27.7401 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 557 11.5779 14.4724 21.7086 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 226 651 13.2206 16.5258 24.7886 1.7942 Constraint 226 557 13.5689 16.9611 25.4416 1.7942 Constraint 226 552 12.0298 15.0373 22.5559 1.7942 Constraint 221 557 11.8019 14.7524 22.1286 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 201 557 13.4240 16.7800 25.1700 1.7942 Constraint 201 552 12.2026 15.2533 22.8799 1.7942 Constraint 190 557 15.1329 18.9161 28.3741 1.7942 Constraint 190 552 13.5052 16.8815 25.3222 1.7942 Constraint 461 676 13.5810 16.9762 25.4643 1.7872 Constraint 449 676 12.2674 15.3343 23.0014 1.7872 Constraint 442 676 14.9870 18.7338 28.1006 1.7872 Constraint 161 303 15.9525 19.9406 29.9109 1.7872 Constraint 535 636 14.6329 18.2912 27.4367 1.7048 Constraint 599 735 12.9076 16.1346 24.2018 1.6648 Constraint 590 729 12.0658 15.0822 22.6233 1.6648 Constraint 590 720 12.4041 15.5051 23.2577 1.6648 Constraint 585 720 14.5610 18.2012 27.3018 1.6648 Constraint 585 713 11.5818 14.4772 21.7158 1.6648 Constraint 577 729 12.8341 16.0426 24.0639 1.6648 Constraint 577 720 11.4410 14.3012 21.4518 1.6648 Constraint 577 713 8.9813 11.2266 16.8399 1.6648 Constraint 571 742 15.4740 19.3425 29.0137 1.6648 Constraint 571 735 14.1857 17.7321 26.5982 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 557 729 14.4942 18.1178 27.1767 1.6648 Constraint 557 720 14.8688 18.5860 27.8791 1.6648 Constraint 544 742 15.4875 19.3594 29.0391 1.6648 Constraint 544 735 13.6270 17.0337 25.5506 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 535 720 14.3249 17.9061 26.8591 1.6648 Constraint 535 713 11.7108 14.6385 21.9577 1.6648 Constraint 511 742 13.3306 16.6633 24.9950 1.6648 Constraint 511 729 12.9557 16.1946 24.2919 1.6648 Constraint 511 720 14.4537 18.0671 27.1007 1.6648 Constraint 144 676 13.5375 16.9219 25.3829 1.5963 Constraint 461 687 15.2919 19.1149 28.6724 1.5957 Constraint 113 687 12.7264 15.9080 23.8621 1.5938 Constraint 104 687 11.5848 14.4810 21.7215 1.5938 Constraint 88 687 12.5816 15.7270 23.5905 1.5938 Constraint 412 687 13.2828 16.6035 24.9053 1.5730 Constraint 412 668 13.4197 16.7746 25.1620 1.5730 Constraint 399 687 12.0256 15.0320 22.5480 1.5730 Constraint 391 698 14.1791 17.7239 26.5859 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 368 698 13.8551 17.3189 25.9783 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 355 687 12.7945 15.9931 23.9897 1.5730 Constraint 557 668 12.1622 15.2028 22.8042 1.5710 Constraint 511 687 12.7749 15.9686 23.9528 1.5710 Constraint 511 676 13.4560 16.8200 25.2300 1.5710 Constraint 511 651 11.8954 14.8692 22.3039 1.5710 Constraint 355 698 13.7308 17.1635 25.7452 1.5653 Constraint 350 698 14.0713 17.5891 26.3837 1.5653 Constraint 144 267 15.7262 19.6578 29.4867 1.4914 Constraint 153 651 12.1423 15.1779 22.7668 1.4763 Constraint 80 571 12.8119 16.0149 24.0224 1.4048 Constraint 80 557 12.1466 15.1832 22.7749 1.4048 Constraint 535 668 9.0224 11.2780 16.9169 1.4029 Constraint 519 698 9.4958 11.8698 17.8047 1.4029 Constraint 259 687 14.7326 18.4158 27.6236 1.4029 Constraint 250 698 12.3882 15.4852 23.2279 1.4029 Constraint 250 676 15.3597 19.1996 28.7994 1.4029 Constraint 250 668 13.9582 17.4478 26.1717 1.4029 Constraint 242 698 11.5124 14.3905 21.5857 1.4029 Constraint 237 698 12.5643 15.7054 23.5580 1.4029 Constraint 128 698 14.0799 17.5998 26.3998 1.4029 Constraint 122 698 13.8632 17.3289 25.9934 1.4029 Constraint 113 698 14.4626 18.0782 27.1173 1.4029 Constraint 104 698 12.6273 15.7841 23.6762 1.4029 Constraint 226 698 12.9684 16.2105 24.3157 1.3971 Constraint 221 687 15.0044 18.7555 28.1332 1.3971 Constraint 201 687 13.3808 16.7261 25.0891 1.3971 Constraint 250 644 12.9560 16.1950 24.2925 1.3894 Constraint 272 511 15.1332 18.9166 28.3748 1.3335 Constraint 176 511 12.4200 15.5250 23.2875 1.3335 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 161 519 11.4665 14.3332 21.4998 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 706 13.9148 17.3935 26.0902 1.3335 Constraint 144 706 14.3802 17.9752 26.9628 1.3335 Constraint 136 382 10.9813 13.7266 20.5899 1.2981 Constraint 279 519 14.4759 18.0949 27.1423 1.2144 Constraint 272 519 13.0663 16.3329 24.4994 1.2144 Constraint 267 519 12.3521 15.4401 23.1601 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 190 519 12.2729 15.3412 23.0117 1.2144 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 668 12.2359 15.2948 22.9423 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 644 11.2896 14.1120 21.1680 1.1914 Constraint 442 687 14.1465 17.6832 26.5247 1.1687 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 226 735 15.3750 19.2187 28.8281 1.0715 Constraint 226 729 14.0097 17.5122 26.2682 1.0715 Constraint 210 729 14.8616 18.5770 27.8655 1.0715 Constraint 201 742 11.9025 14.8781 22.3172 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 201 720 13.4999 16.8749 25.3123 1.0715 Constraint 190 742 13.7931 17.2414 25.8620 1.0715 Constraint 190 735 14.5357 18.1696 27.2544 1.0715 Constraint 190 729 14.1905 17.7382 26.6073 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 176 729 12.3370 15.4212 23.1319 1.0715 Constraint 169 742 12.8056 16.0070 24.0105 1.0715 Constraint 169 735 13.0624 16.3280 24.4920 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 169 720 12.9801 16.2251 24.3377 1.0715 Constraint 161 742 11.0485 13.8107 20.7160 1.0715 Constraint 161 735 10.8157 13.5196 20.2794 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 668 11.8279 14.7849 22.1773 1.0715 Constraint 153 657 12.1059 15.1323 22.6985 1.0715 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 144 720 13.9889 17.4862 26.2292 1.0715 Constraint 128 729 14.9336 18.6670 28.0005 1.0715 Constraint 128 720 15.5805 19.4757 29.2135 1.0715 Constraint 190 375 15.6675 19.5843 29.3765 1.0163 Constraint 69 577 13.9825 17.4781 26.2171 1.0163 Constraint 58 267 14.8008 18.5010 27.7515 1.0163 Constraint 58 250 13.9829 17.4786 26.2179 1.0163 Constraint 58 237 15.1981 18.9976 28.4965 1.0163 Constraint 51 382 13.7682 17.2103 25.8154 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 279 13.9507 17.4384 26.1576 1.0163 Constraint 51 272 14.7981 18.4977 27.7465 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 237 11.5867 14.4834 21.7251 1.0163 Constraint 51 226 14.0355 17.5444 26.3166 1.0163 Constraint 51 221 12.1783 15.2229 22.8343 1.0163 Constraint 51 201 15.2557 19.0696 28.6044 1.0163 Constraint 41 303 14.7562 18.4452 27.6678 1.0163 Constraint 41 292 15.0292 18.7865 28.1798 1.0163 Constraint 41 285 12.9875 16.2344 24.3516 1.0163 Constraint 41 267 15.5634 19.4542 29.1813 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 41 237 13.6592 17.0740 25.6110 1.0163 Constraint 41 221 15.1614 18.9518 28.4277 1.0163 Constraint 41 210 14.4949 18.1186 27.1780 1.0163 Constraint 144 687 14.5262 18.1577 27.2366 1.0005 Constraint 136 687 13.0106 16.2633 24.3949 1.0005 Constraint 128 687 13.1704 16.4630 24.6945 1.0005 Constraint 96 687 14.0483 17.5604 26.3406 1.0005 Constraint 467 706 14.4293 18.0366 27.0550 1.0000 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 687 13.2135 16.5168 24.7752 1.0000 Constraint 467 676 13.0097 16.2622 24.3933 1.0000 Constraint 461 698 14.6299 18.2874 27.4310 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 435 687 13.4996 16.8745 25.3117 1.0000 Constraint 435 676 15.5965 19.4956 29.2434 1.0000 Constraint 435 668 12.8660 16.0825 24.1238 1.0000 Constraint 429 706 15.2027 19.0034 28.5051 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 429 687 12.2809 15.3511 23.0266 1.0000 Constraint 412 698 13.2225 16.5282 24.7923 1.0000 Constraint 412 676 15.0632 18.8290 28.2435 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 399 706 14.0172 17.5215 26.2822 1.0000 Constraint 399 698 11.3454 14.1818 21.2726 1.0000 Constraint 391 676 13.9218 17.4023 26.1034 1.0000 Constraint 382 706 13.8797 17.3496 26.0244 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 706 14.5687 18.2109 27.3164 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 599 742 11.4013 14.2516 21.3774 0.9981 Constraint 590 742 13.6744 17.0930 25.6395 0.9981 Constraint 590 735 13.3750 16.7187 25.0781 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 735 13.6112 17.0140 25.5210 0.9981 Constraint 585 729 13.9763 17.4704 26.2057 0.9981 Constraint 577 735 15.9344 19.9180 29.8770 0.9981 Constraint 557 742 15.0244 18.7805 28.1708 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 552 735 13.8193 17.2741 25.9111 0.9981 Constraint 552 713 13.4750 16.8438 25.2657 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 676 13.7563 17.1954 25.7931 0.9981 Constraint 552 668 12.1345 15.1682 22.7522 0.9981 Constraint 544 698 11.5817 14.4771 21.7156 0.9981 Constraint 544 668 11.6643 14.5804 21.8706 0.9981 Constraint 535 742 11.6473 14.5592 21.8388 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 729 13.5009 16.8761 25.3142 0.9981 Constraint 527 720 13.3832 16.7289 25.0934 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 519 742 14.9527 18.6909 28.0363 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 729 14.3587 17.9484 26.9226 0.9981 Constraint 519 720 15.2543 19.0679 28.6018 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 706 12.2041 15.2551 22.8827 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 314 729 15.9634 19.9543 29.9314 0.9981 Constraint 303 729 15.7527 19.6908 29.5363 0.9981 Constraint 285 687 14.1882 17.7353 26.6029 0.9981 Constraint 259 713 14.8390 18.5488 27.8232 0.9981 Constraint 242 713 15.9624 19.9529 29.9294 0.9981 Constraint 242 706 14.7702 18.4628 27.6942 0.9981 Constraint 113 713 14.6851 18.3564 27.5346 0.9981 Constraint 113 706 15.9373 19.9216 29.8823 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 267 557 12.7585 15.9481 23.9222 0.9846 Constraint 259 651 14.3365 17.9206 26.8809 0.9846 Constraint 259 544 12.5763 15.7204 23.5806 0.8096 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 221 544 12.2386 15.2983 22.9475 0.8096 Constraint 176 557 14.1181 17.6476 26.4715 0.8096 Constraint 552 720 15.6599 19.5749 29.3623 0.6667 Constraint 544 729 12.9019 16.1274 24.1911 0.6667 Constraint 544 720 12.6604 15.8255 23.7383 0.6667 Constraint 242 742 15.5200 19.4000 29.1000 0.6667 Constraint 237 742 12.1392 15.1740 22.7609 0.6667 Constraint 237 735 14.2288 17.7860 26.6790 0.6667 Constraint 226 742 12.6866 15.8582 23.7873 0.6667 Constraint 221 742 15.9447 19.9309 29.8963 0.6667 Constraint 210 742 14.4409 18.0512 27.0768 0.6667 Constraint 210 735 15.5733 19.4667 29.2000 0.6667 Constraint 182 742 15.3611 19.2014 28.8020 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 742 12.1154 15.1443 22.7164 0.6667 Constraint 153 735 11.9781 14.9726 22.4588 0.6667 Constraint 153 713 14.0784 17.5981 26.3971 0.6667 Constraint 144 742 15.0435 18.8044 28.2066 0.6667 Constraint 144 735 13.9828 17.4785 26.2178 0.6667 Constraint 144 729 13.7368 17.1710 25.7565 0.6667 Constraint 144 713 15.5813 19.4767 29.2150 0.6667 Constraint 136 742 14.8526 18.5657 27.8486 0.6667 Constraint 136 735 13.6536 17.0670 25.6005 0.6667 Constraint 136 729 14.8572 18.5715 27.8572 0.6667 Constraint 136 720 13.9665 17.4581 26.1872 0.6667 Constraint 128 742 14.8056 18.5070 27.7605 0.6667 Constraint 128 735 14.6901 18.3626 27.5439 0.6667 Constraint 449 687 12.4188 15.5235 23.2852 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 421 742 15.9400 19.9250 29.8875 0.5730 Constraint 421 735 15.9848 19.9810 29.9715 0.5730 Constraint 399 742 15.8754 19.8442 29.7664 0.5730 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 382 742 14.9153 18.6442 27.9663 0.5730 Constraint 375 742 15.5064 19.3830 29.0745 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 735 12.6027 15.7534 23.6301 0.5730 Constraint 350 687 13.7045 17.1306 25.6959 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 341 735 13.4893 16.8616 25.2924 0.5730 Constraint 272 729 14.0280 17.5351 26.3026 0.4048 Constraint 250 687 14.1963 17.7454 26.6180 0.4048 Constraint 237 720 13.4446 16.8058 25.2087 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 226 720 14.7331 18.4163 27.6245 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 221 729 14.6076 18.2596 27.3893 0.4048 Constraint 210 720 14.7114 18.3893 27.5839 0.4048 Constraint 190 720 14.4045 18.0056 27.0085 0.4048 Constraint 182 729 13.8402 17.3002 25.9503 0.4048 Constraint 161 698 11.5867 14.4834 21.7251 0.4048 Constraint 161 687 12.2665 15.3331 22.9997 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 144 698 13.7421 17.1776 25.7664 0.4048 Constraint 136 698 14.0537 17.5672 26.3508 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 404 15.5970 19.4962 29.2443 0.3388 Constraint 33 391 15.9901 19.9877 29.9815 0.3388 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 368 13.2850 16.6062 24.9093 0.3388 Constraint 33 297 15.4197 19.2746 28.9119 0.3388 Constraint 33 292 13.1632 16.4540 24.6810 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 279 13.8904 17.3630 26.0445 0.3388 Constraint 33 272 15.2930 19.1162 28.6744 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 226 14.5041 18.1302 27.1952 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 33 210 13.7334 17.1667 25.7501 0.3388 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: