# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0299/ # command:# Making conformation for sequence T0299 numbered 1 through 180 Created new target T0299 from T0299.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0299/ # command:# reading script from file T0299.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/T0299-1vjrA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjrA expands to /projects/compbio/data/pdb/1vjr.pdb.gz 1vjrA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 172, because occupancy 0.33 <= existing 0.340 in 1vjrA Skipped atom 173, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 177, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 178, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 180, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 181, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 183, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 184, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 186, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 187, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 237, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 241, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 243, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 245, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 247, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 249, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1601, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1605, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1607, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1616, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1620, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1622, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1624, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1626, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1628, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1630, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1868, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1872, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1874, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1876, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1878, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1880, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1912, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1914, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1916, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1918, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1920, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1922, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1930, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1934, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1936, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1938, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1940, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1942, because occupancy 0.500 <= existing 0.500 in 1vjrA # T0299 read from 1vjrA/T0299-1vjrA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vjrA read from 1vjrA/T0299-1vjrA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vjrA to template set # found chain 1vjrA in template set T0299 3 :RYALLVRG 1vjrA 39 :RFVFFTNN # choosing archetypes in rotamer library T0299 17 :NKVVMAELRQELTNLGL 1vjrA 47 :SSLGAQDYVRKLRNMGV T0299 34 :EKVES 1vjrA 68 :DAVVT T0299 63 :FFAVHYP 1vjrA 80 :HMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLD 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLT T0299 112 :DQVIATVESLELKDEVLYFGK 1vjrA 127 :YERLKKACILLRKGKFYIATH T0299 138 :GKFSEESYSK 1vjrA 151 :NCPSKEGPVP T0299 148 :TAYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 166 :MAAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 8 number of extra gaps= 0 total=8 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_271059426.pdb -s /var/tmp/to_scwrl_271059426.seq -o /var/tmp/from_scwrl_271059426.pdb > /var/tmp/scwrl_271059426.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_271059426.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fp1D expands to /projects/compbio/data/pdb/1fp1.pdb.gz 1fp1D:# T0299 read from 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fp1D read from 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1fp1D to template set # found chain 1fp1D in template set T0299 23 :ELRQE 1fp1D 199 :RMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLEL 1fp1D 279 :NWSDEKCIEFLSNCHK T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLK 1fp1D 297 :SPNGKVIIVEFILPEEPNTSEESKLVST T0299 157 :VPF 1fp1D 332 :TVG T0299 163 :ITIRNAKTFDKIGQMLK 1fp1D 335 :GRERTEKQYEKLSKLSG Number of specific fragments extracted= 10 number of extra gaps= 0 total=18 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_992028067.pdb -s /var/tmp/to_scwrl_992028067.seq -o /var/tmp/from_scwrl_992028067.pdb > /var/tmp/scwrl_992028067.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_992028067.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atg/T0299-1atg-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1atg/T0299-1atg-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1atg read from 1atg/T0299-1atg-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1atg in training set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 13 :GTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 89 :L 1atg 48 :A T0299 99 :RKDFLFYTEG 1atg 49 :PYNVFFSADE T0299 113 :QVIATVESLEL 1atg 59 :KSPEKLDNQGF T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYHK 1atg 73 :GSRFTYAIGKLVLWSAKPGLVDNQGKVLA T0299 156 :KVPFYR 1atg 102 :GNGWRH T0299 163 :ITIRN 1atg 108 :IAISN T0299 168 :AKTFDKIGQMLK 1atg 119 :GLAGTQVLTHLG Number of specific fragments extracted= 8 number of extra gaps= 0 total=26 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_180785147.pdb -s /var/tmp/to_scwrl_180785147.seq -o /var/tmp/from_scwrl_180785147.pdb > /var/tmp/scwrl_180785147.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_180785147.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xzoA/T0299-1xzoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1xzoA/T0299-1xzoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xzoA read from 1xzoA/T0299-1xzoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 T0299 6 :LLVRGINVG 1xzoA 36 :WLADFIFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYINSGN 1xzoA 70 :VRIISFSVD T0299 50 :ID 1xzoA 79 :PE T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVES 1xzoA 101 :WDFLTGYSQSEIEEFALK T0299 124 :KD 1xzoA 128 :EG T0299 127 :VLYFGK 1xzoA 139 :FYLVGP T0299 133 :LGIFWGKFSEESYSKTAYHKYL 1xzoA 146 :GKVLKDYNGVENTPYDDIISDV Number of specific fragments extracted= 10 number of extra gaps= 3 total=36 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1675575222.pdb -s /var/tmp/to_scwrl_1675575222.seq -o /var/tmp/from_scwrl_1675575222.pdb > /var/tmp/scwrl_1675575222.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1675575222.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ccwA/T0299-1ccwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ccwA/T0299-1ccwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ccwA read from 1ccwA/T0299-1ccwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ccwA in training set Warning: unaligning (T0299)T2 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)Q72 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 Warning: unaligning (T0299)E107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGL 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGF T0299 35 :KVESY 1ccwA 33 :NVVNI T0299 40 :IN 1ccwA 39 :VL T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 73 :SFSLLS 1ccwA 57 :AILVSS T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFYT 1ccwA 82 :GLEGILLYVGG T0299 108 :GLDVDQVIATVESLEL 1ccwA 98 :KQHWPDVEKRFKDMGY T0299 138 :GKFSEESYSKTAYHKYLLK 1ccwA 114 :DRVYAPGTPPEVGIADLKK Number of specific fragments extracted= 11 number of extra gaps= 3 total=47 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1687776786.pdb -s /var/tmp/to_scwrl_1687776786.seq -o /var/tmp/from_scwrl_1687776786.pdb > /var/tmp/scwrl_1687776786.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1687776786.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i6wA/T0299-1i6wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i6wA expands to /projects/compbio/data/pdb/1i6w.pdb.gz 1i6wA:# T0299 read from 1i6wA/T0299-1i6wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1i6wA read from 1i6wA/T0299-1i6wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1i6wA to template set # found chain 1i6wA in template set T0299 5 :ALLVRGI 1i6wA 6 :VVMVHGI T0299 14 :GGKN 1i6wA 13 :GGAS T0299 21 :MAELRQELTNLGLEKVESYI 1i6wA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1i6wA 39 :VDFWDKT T0299 52 :S 1i6wA 47 :T T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSL 1i6wA 52 :GPVLSRFVQKVLDETGAKKVDIVAHSM T0299 82 :FEAELENLPAWWS 1i6wA 83 :TLYYIKNLDGGNK T0299 95 :RDLARKDFLFYT 1i6wA 118 :DPNQKILYTSIY Number of specific fragments extracted= 8 number of extra gaps= 0 total=55 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1470332230.pdb -s /var/tmp/to_scwrl_1470332230.seq -o /var/tmp/from_scwrl_1470332230.pdb > /var/tmp/scwrl_1470332230.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1470332230.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1k68A/T0299-1k68A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1k68A expands to /projects/compbio/data/pdb/1k68.pdb.gz 1k68A:Bad short name: P for alphabet: pdb_atoms Bad short name: OP1 for alphabet: pdb_atoms Bad short name: OP2 for alphabet: pdb_atoms Bad short name: OP3 for alphabet: pdb_atoms Skipped atom 719, because occupancy 0.500 <= existing 0.500 in 1k68A # T0299 read from 1k68A/T0299-1k68A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1k68A read from 1k68A/T0299-1k68A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1k68A to template set # found chain 1k68A in template set T0299 2 :TRYALLVR 1k68A 10 :HKKIFLVE T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1k68A 18 :DNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYAN T0299 95 :RDLARKDFLFYTEGLD 1k68A 89 :PTLKRIPVVVLSTSIN T0299 112 :DQVIATVESLEL 1k68A 105 :EDDIFHSYDLHV T0299 138 :GKFSEESYSKTAYHKYLL 1k68A 117 :NCYITKSANLSQLFQIVK Number of specific fragments extracted= 5 number of extra gaps= 0 total=60 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1954696531.pdb -s /var/tmp/to_scwrl_1954696531.seq -o /var/tmp/from_scwrl_1954696531.pdb > /var/tmp/scwrl_1954696531.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1954696531.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zghA expands to /projects/compbio/data/pdb/1zgh.pdb.gz 1zghA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0299 read from 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zghA read from 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1zghA to template set # found chain 1zghA in template set Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 8 :VRGINVGGKN 1zghA 100 :ISAIKVDGGI T0299 41 :NSGNIFFT 1zghA 110 :DTGDIFFK T0299 49 :S 1zghA 121 :D T0299 50 :IDSKAQLVEKLETFFAVHY 1zghA 123 :YGTAEEIFMRASKIIFNDM T0299 82 :FEAELENLPAWWSRDLARKDF 1zghA 142 :IPELLTKRPVPQKQEGEATVF T0299 105 :YTEGLDVDQVIATVESLELKD 1zghA 172 :ISPDFDLEKIYDYIRMLDGEG T0299 126 :EV 1zghA 195 :RA T0299 130 :FGK 1zghA 199 :KYG T0299 133 :LGIFWGKF 1zghA 203 :YRLEFSRA Number of specific fragments extracted= 9 number of extra gaps= 1 total=69 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1862292121.pdb -s /var/tmp/to_scwrl_1862292121.seq -o /var/tmp/from_scwrl_1862292121.pdb > /var/tmp/scwrl_1862292121.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1862292121.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1t6nA expands to /projects/compbio/data/pdb/1t6n.pdb.gz 1t6nA:# T0299 read from 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1t6nA read from 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1t6nA to template set # found chain 1t6nA in template set T0299 4 :YALLVR 1t6nA 116 :VLVMCH T0299 20 :V 1t6nA 122 :T T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELENL 1t6nA 164 :NCPHIVVGTPGRILALARNK T0299 94 :SRDLARKDFLFYTE 1t6nA 184 :SLNLKHIKHFILDE T0299 111 :VDQVIATVESLEL 1t6nA 204 :QLDMRRDVQEIFR T0299 124 :KDEV 1t6nA 220 :HEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPFY 1t6nA 236 :RPVCRKFMQDPME Number of specific fragments extracted= 11 number of extra gaps= 0 total=80 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_134591281.pdb -s /var/tmp/to_scwrl_134591281.seq -o /var/tmp/from_scwrl_134591281.pdb > /var/tmp/scwrl_134591281.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_134591281.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ctf/T0299-1ctf-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ctf/T0299-1ctf-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ctf read from 1ctf/T0299-1ctf-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ctf in training set T0299 44 :NIFFT 1ctf 55 :DVILK T0299 49 :SIDSKAQLVEKLETFF 1ctf 61 :AGANKVAVIKAVRGAT T0299 69 :P 1ctf 77 :G T0299 77 :LSLEDFEAELENLPAW 1ctf 78 :LGLKEAKDLVESAPAA T0299 105 :YTEGLDVDQVIATVESLELKDEVLY 1ctf 94 :LKEGVSKDDAEALKKALEEAGAEVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=85 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_101323875.pdb -s /var/tmp/to_scwrl_101323875.seq -o /var/tmp/from_scwrl_101323875.pdb > /var/tmp/scwrl_101323875.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_101323875.pdb Number of alignments=10 # command:# reading script from file T0299.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/T0299-1fp1D-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1fp1D/T0299-1fp1D-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fp1D read from 1fp1D/T0299-1fp1D-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1fp1D in template set T0299 21 :MAELRQE 1fp1D 197 :MKRMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLEL 1fp1D 279 :NWSDEKCIEFLSNCHK T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLK 1fp1D 297 :SPNGKVIIVEFILPEEPNTSEESKLVST T0299 157 :VPF 1fp1D 332 :TVG T0299 163 :ITIRNAKTFDKIGQMLK 1fp1D 335 :GRERTEKQYEKLSKLSG Number of specific fragments extracted= 10 number of extra gaps= 0 total=95 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1131884849.pdb -s /var/tmp/to_scwrl_1131884849.seq -o /var/tmp/from_scwrl_1131884849.pdb > /var/tmp/scwrl_1131884849.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1131884849.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atg/T0299-1atg-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1atg/T0299-1atg-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1atg read from 1atg/T0299-1atg-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1atg in training set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAEL 1atg 13 :GTLEQLAGQFAKQTGHAVVISSGSSGPVYAQI T0299 87 :ENLPA 1atg 46 :NGAPY T0299 101 :DFLFYTEG 1atg 51 :NVFFSADE T0299 113 :QVIATVESLEL 1atg 59 :KSPEKLDNQGF T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAY 1atg 73 :GSRFTYAIGKLVLWSAKPGLVDNQGKV T0299 155 :LKVPFYRHITIRN 1atg 100 :LAGNGWRHIAISN Number of specific fragments extracted= 6 number of extra gaps= 0 total=101 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_380390179.pdb -s /var/tmp/to_scwrl_380390179.seq -o /var/tmp/from_scwrl_380390179.pdb > /var/tmp/scwrl_380390179.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_380390179.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ccwA read from 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ccwA in training set Warning: unaligning (T0299)T2 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)I71 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGLE 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGFN T0299 36 :VESY 1ccwA 34 :VVNI T0299 44 :N 1ccwA 39 :V T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 72 :QSFSLLS 1ccwA 57 :AILVSSL T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFY 1ccwA 82 :GLEGILLYVG T0299 106 :TEGLDVDQVIATVESLEL 1ccwA 96 :VGKQHWPDVEKRFKDMGY T0299 138 :GKFSEESYSKTAYHKYLLKV 1ccwA 114 :DRVYAPGTPPEVGIADLKKD Number of specific fragments extracted= 11 number of extra gaps= 2 total=112 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1992576589.pdb -s /var/tmp/to_scwrl_1992576589.seq -o /var/tmp/from_scwrl_1992576589.pdb > /var/tmp/scwrl_1992576589.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1992576589.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ispA read from 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1ispA 39 :VDFWDKT T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSL 1ispA 52 :GPVLSRFVQKVLDETGAKKVDIVAHSM T0299 85 :ELENLPAWWS 1ispA 86 :YIKNLDGGNK T0299 95 :RDLARKDFLFYTEG 1ispA 118 :DPNQKILYTSIYSS T0299 109 :LDVDQ 1ispA 136 :VMNYL T0299 121 :LELKDEVL 1ispA 141 :SRLDGARN T0299 140 :FSEESYSKTAYHK 1ispA 149 :VQIHGVGHIGLLY T0299 167 :NAKTFDKIGQMLK 1ispA 162 :SSQVNSLIKEGLN Number of specific fragments extracted= 10 number of extra gaps= 0 total=122 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_235202254.pdb -s /var/tmp/to_scwrl_235202254.seq -o /var/tmp/from_scwrl_235202254.pdb > /var/tmp/scwrl_235202254.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_235202254.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xzoA read from 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)D125 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)E126 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 3 :RYALLV 1xzoA 35 :VWLADF T0299 11 :INVG 1xzoA 41 :IFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYINSGN 1xzoA 70 :VRIISFSVD T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 124 :K 1xzoA 135 :H T0299 127 :VLYF 1xzoA 138 :SFYL T0299 131 :GKLGIFWGKFSEESYSKTAYHKYLL 1xzoA 144 :PDGKVLKDYNGVENTPYDDIISDVK Number of specific fragments extracted= 10 number of extra gaps= 3 total=132 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_833215350.pdb -s /var/tmp/to_scwrl_833215350.seq -o /var/tmp/from_scwrl_833215350.pdb > /var/tmp/scwrl_833215350.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_833215350.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tib/T0299-1tib-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tib expands to /projects/compbio/data/pdb/1tib.pdb.gz 1tib:Warning: there is no chain 1tib will retry with 1tibA # T0299 read from 1tib/T0299-1tib-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1tib read from 1tib/T0299-1tib-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1tib to template set # found chain 1tib in template set Warning: unaligning (T0299)E58 because of BadResidue code BAD_PEPTIDE in next template residue (1tib)K127 Warning: unaligning (T0299)K59 because of BadResidue code BAD_PEPTIDE at template residue (1tib)K127 Warning: unaligning (T0299)F104 because of BadResidue code BAD_PEPTIDE in next template residue (1tib)Y171 Warning: unaligning (T0299)Y105 because of BadResidue code BAD_PEPTIDE at template residue (1tib)Y171 T0299 53 :KAQLV 1tib 121 :ADTLR T0299 60 :LETFFAVHYPFIQSFSLL 1tib 128 :VEDAVREHPDYRVVFTGH T0299 92 :WWSRDLARKDFL 1tib 158 :DLRGNGYDIDVF T0299 106 :TEGL 1tib 172 :GAPR T0299 111 :VDQVIATVESLEL 1tib 178 :NRAFAEFLTVQTG Number of specific fragments extracted= 5 number of extra gaps= 2 total=137 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1280311130.pdb -s /var/tmp/to_scwrl_1280311130.seq -o /var/tmp/from_scwrl_1280311130.pdb > /var/tmp/scwrl_1280311130.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1280311130.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t6nA/T0299-1t6nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1t6nA/T0299-1t6nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1t6nA read from 1t6nA/T0299-1t6nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1t6nA in template set T0299 4 :YALLVR 1t6nA 116 :VLVMCH T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELEN 1t6nA 164 :NCPHIVVGTPGRILALARN T0299 94 :SRDLARKDFLFYTE 1t6nA 184 :SLNLKHIKHFILDE T0299 112 :DQVIATVES 1t6nA 205 :LDMRRDVQE T0299 121 :LELKDEV 1t6nA 217 :MTPHEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPFYRH 1t6nA 236 :RPVCRKFMQDPMEIF Number of specific fragments extracted= 10 number of extra gaps= 0 total=147 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1370973812.pdb -s /var/tmp/to_scwrl_1370973812.seq -o /var/tmp/from_scwrl_1370973812.pdb > /var/tmp/scwrl_1370973812.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1370973812.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cydA/T0299-1cydA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1cydA/T0299-1cydA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1cydA read from 1cydA/T0299-1cydA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1cydA in training set Warning: unaligning (T0299)L31 because first residue in template chain is (1cydA)L3 T0299 32 :GLEKVESYINSGN 1cydA 4 :NFSGLRALVTGAG T0299 55 :QLVEKLETFFAV 1cydA 18 :GIGRDTVKALHA T0299 68 :YPFIQSFSLLSLEDFEAELENLPAW 1cydA 30 :SGAKVVAVTRTNSDLVSLAKECPGI T0299 102 :FLFYTEGLDVDQVIATVESLE 1cydA 55 :EPVCVDLGDWDATEKALGGIG T0299 132 :KLGIFWG 1cydA 76 :PVDLLVN T0299 139 :KFSEESYSKTAY 1cydA 89 :MQPFLEVTKEAF T0299 152 :KYLL 1cydA 101 :DRSF T0299 167 :NAKTFDKIGQML 1cydA 107 :NLRSVFQVSQMV Number of specific fragments extracted= 8 number of extra gaps= 0 total=155 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1503967856.pdb -s /var/tmp/to_scwrl_1503967856.seq -o /var/tmp/from_scwrl_1503967856.pdb > /var/tmp/scwrl_1503967856.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1503967856.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mzhA/T0299-1mzhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mzhA expands to /projects/compbio/data/pdb/1mzh.pdb.gz 1mzhA:# T0299 read from 1mzhA/T0299-1mzhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1mzhA read from 1mzhA/T0299-1mzhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1mzhA to template set # found chain 1mzhA in template set T0299 13 :VGGKNKVVMAELRQEL 1mzhA 111 :AALKPHLSEKEIEEFV T0299 29 :TNLGLEKV 1mzhA 130 :EELGIYAV T0299 39 :YINS 1mzhA 138 :CVNP T0299 45 :IFFT 1mzhA 158 :CVIG T0299 49 :SIDSKAQLVEKLETFFAVH 1mzhA 165 :GLNKTSVKVKEAVEAVRDG T0299 70 :FIQSFSLLS 1mzhA 184 :AQELDIVWN T0299 79 :LEDFEAELENLPAWWS 1mzhA 201 :YDFVVEELKEIFRETP T0299 97 :LARKDFLFYTEGLDVDQVIATVESLEL 1mzhA 217 :SAVHKVIVETPYLNEEEIKKAVEICIE T0299 130 :FGKLGIFWGKFSEES 1mzhA 244 :AGADFIKTSTGFAPR T0299 145 :YSK 1mzhA 260 :TTL T0299 148 :TAYHKYLLKVPFYRHIT 1mzhA 265 :VRLIKSSAKGRIKVKAS T0299 165 :IRNAKTFDKIGQ 1mzhA 284 :IRDLETAISMIE Number of specific fragments extracted= 12 number of extra gaps= 0 total=167 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1158381493.pdb -s /var/tmp/to_scwrl_1158381493.seq -o /var/tmp/from_scwrl_1158381493.pdb > /var/tmp/scwrl_1158381493.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1158381493.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jysA/T0299-1jysA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jysA expands to /projects/compbio/data/pdb/1jys.pdb.gz 1jysA:# T0299 read from 1jysA/T0299-1jysA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1jysA read from 1jysA/T0299-1jysA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1jysA to template set # found chain 1jysA in template set Warning: unaligning (T0299)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jysA)S206 T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1jysA 126 :IAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 68 :YPF 1jysA 165 :FPQ T0299 72 :QSFSLLSLEDFEAEL 1jysA 168 :AIAVEMEATAIAHVC T0299 93 :WSRDLARKDFLFYTE 1jysA 183 :HNFNVPFVVVRAISD T0299 111 :VDQVIATVES 1jysA 207 :FDEFLAVAAK Number of specific fragments extracted= 5 number of extra gaps= 0 total=172 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_873199181.pdb -s /var/tmp/to_scwrl_873199181.seq -o /var/tmp/from_scwrl_873199181.pdb > /var/tmp/scwrl_873199181.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_873199181.pdb Number of alignments=20 # command:# reading script from file T0299.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1atg read from 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1atg in training set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 14 :TLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 98 :ARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1atg 47 :GAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGK T0299 154 :LLKVPFYRHITIRN 1atg 99 :VLAGNGWRHIAISN T0299 168 :AKTFDKIGQMLK 1atg 119 :GLAGTQVLTHLG Number of specific fragments extracted= 4 number of extra gaps= 0 total=176 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1766146080.pdb -s /var/tmp/to_scwrl_1766146080.seq -o /var/tmp/from_scwrl_1766146080.pdb > /var/tmp/scwrl_1766146080.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1766146080.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qapA/T0299-1qapA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qapA expands to /projects/compbio/data/pdb/1qap.pdb.gz 1qapA:# T0299 read from 1qapA/T0299-1qapA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1qapA read from 1qapA/T0299-1qapA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1qapA to template set # found chain 1qapA in template set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1qapA 195 :VRQAVEKAFWLHPDVPVEVEVENLDELDDALKA T0299 100 :KDFLFYTEGLDVDQVIATVESLELKDE 1qapA 228 :GADIIMLDNFNTDQMREAVKRVNGQAR Number of specific fragments extracted= 2 number of extra gaps= 0 total=178 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1240554602.pdb -s /var/tmp/to_scwrl_1240554602.seq -o /var/tmp/from_scwrl_1240554602.pdb > /var/tmp/scwrl_1240554602.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1240554602.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1prxB/T0299-1prxB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1prxB expands to /projects/compbio/data/pdb/1prx.pdb.gz 1prxB:# T0299 read from 1prxB/T0299-1prxB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1prxB read from 1prxB/T0299-1prxB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1prxB to template set # found chain 1prxB in template set Warning: unaligning (T0299)Q55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1prxB)T48 Warning: unaligning (T0299)V57 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1prxB)T48 Warning: unaligning (T0299)D125 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1prxB)M127 Warning: unaligning (T0299)Y129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1prxB)M127 T0299 16 :KNKVVMAELRQ 1prxB 20 :VGRIRFHDFLG T0299 41 :NSGNIFFTSID 1prxB 31 :DSWGILFSHPR T0299 52 :SKA 1prxB 43 :FTP T0299 58 :EKLETFFA 1prxB 49 :TELGRAAK T0299 68 :YPFIQSFSLL 1prxB 62 :AKRNVKLIAL T0299 78 :SLEDFEAELENLPAWWSRDLARKD 1prxB 75 :SVEDHLAWSKDINAYNSEEPTEKL T0299 102 :FLFYTEG 1prxB 101 :PIIDDRN T0299 112 :DQVIATVESLELK 1prxB 108 :RELAILLGMLDPA T0299 130 :FGKLGIFWGKFSEES 1prxB 128 :PVTARVVFVFGPDKK Number of specific fragments extracted= 9 number of extra gaps= 0 total=187 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1979015719.pdb -s /var/tmp/to_scwrl_1979015719.seq -o /var/tmp/from_scwrl_1979015719.pdb > /var/tmp/scwrl_1979015719.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1979015719.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xzoA/T0299-1xzoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1xzoA/T0299-1xzoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xzoA read from 1xzoA/T0299-1xzoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 6 :LLVRGINVG 1xzoA 36 :WLADFIFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYI 1xzoA 70 :VRIIS T0299 47 :FTSID 1xzoA 75 :FSVDP T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 122 :ELKD 1xzoA 126 :KPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFWGKFSEES 1xzoA 138 :SFYLVGPDGKV Number of specific fragments extracted= 10 number of extra gaps= 4 total=197 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_476152433.pdb -s /var/tmp/to_scwrl_476152433.seq -o /var/tmp/from_scwrl_476152433.pdb > /var/tmp/scwrl_476152433.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_476152433.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i6wA/T0299-1i6wA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1i6wA/T0299-1i6wA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1i6wA read from 1i6wA/T0299-1i6wA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1i6wA in template set T0299 5 :ALLVRGINVGGKN 1i6wA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYIN 1i6wA 19 :FAGIKSYLVSQGWSRDKLYAV T0299 46 :FFTSID 1i6wA 40 :DFWDKT T0299 52 :SKAQ 1i6wA 47 :TNYN T0299 56 :LVEKLETFFAVHYPFIQSFSLLSL 1i6wA 55 :LSRFVQKVLDETGAKKVDIVAHSM T0299 82 :FEAELENL 1i6wA 83 :TLYYIKNL T0299 96 :DLARKDFLFYTEG 1i6wA 91 :DGGNKVANVVTLG Number of specific fragments extracted= 7 number of extra gaps= 0 total=204 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1694887981.pdb -s /var/tmp/to_scwrl_1694887981.seq -o /var/tmp/from_scwrl_1694887981.pdb > /var/tmp/scwrl_1694887981.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1694887981.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/T0299-1vjrA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1vjrA/T0299-1vjrA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vjrA read from 1vjrA/T0299-1vjrA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vjrA in template set T0299 3 :RYALLVR 1vjrA 39 :RFVFFTN T0299 13 :VGG 1vjrA 46 :NSS T0299 19 :VVMAELRQELTNLGL 1vjrA 49 :LGAQDYVRKLRNMGV T0299 34 :EKVES 1vjrA 68 :DAVVT T0299 63 :FFAVHYPF 1vjrA 80 :HMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSRDL 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDEEN T0299 99 :RKDFLFYTEGLDVDQVIATVESLELKDEVLYFGK 1vjrA 114 :PDFVVLGFDKTLTYERLKKACILLRKGKFYIATH T0299 138 :GKFSEESYS 1vjrA 151 :NCPSKEGPV T0299 147 :KTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLKK 1vjrA 165 :IMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGV Number of specific fragments extracted= 9 number of extra gaps= 0 total=213 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_803590181.pdb -s /var/tmp/to_scwrl_803590181.seq -o /var/tmp/from_scwrl_803590181.pdb > /var/tmp/scwrl_803590181.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_803590181.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z5oA/T0299-1z5oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z5oA expands to /projects/compbio/data/pdb/1z5o.pdb.gz 1z5oA:# T0299 read from 1z5oA/T0299-1z5oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z5oA read from 1z5oA/T0299-1z5oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1z5oA to template set # found chain 1z5oA in template set T0299 21 :MAELRQELTNLGLEKVESYINSGNIFF 1z5oA 126 :IAAAEACIAELNLNAVRGLIVSGDAFI T0299 52 :SKAQLVE 1z5oA 154 :GSVGLAK T0299 64 :FAVHYP 1z5oA 161 :IRHNFP T0299 71 :IQSFSLLSLEDFEAELENL 1z5oA 167 :QAIAVEMEATAIAHVCHNF T0299 96 :DLARKDFLFYTEGLDVD 1z5oA 186 :NVPFVVVRAISNVADQQ T0299 113 :QVIATVE 1z5oA 205 :LSFDEFL Number of specific fragments extracted= 6 number of extra gaps= 0 total=219 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_820097487.pdb -s /var/tmp/to_scwrl_820097487.seq -o /var/tmp/from_scwrl_820097487.pdb > /var/tmp/scwrl_820097487.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_820097487.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yqgA/T0299-1yqgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yqgA expands to /projects/compbio/data/pdb/1yqg.pdb.gz 1yqgA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0299 read from 1yqgA/T0299-1yqgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yqgA read from 1yqgA/T0299-1yqgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1yqgA to template set # found chain 1yqgA in template set T0299 4 :YALLVRG 1yqgA 2 :NVYFLGG T0299 21 :MAELRQELTNL 1yqgA 12 :AAAVAGGLVKQ T0299 34 :EKVESYINS 1yqgA 23 :GGYRIYIAN T0299 51 :DSKAQ 1yqgA 32 :RGAEK T0299 61 :ETFFAVHYPFIQS 1yqgA 37 :RERLEKELGVETS T0299 74 :FSLLSLEDFEAELENL 1yqgA 62 :ILAVKPQDMEAACKNI T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1yqgA 78 :RTNGALVLSVAAGLSVGTLSRYLGGTRR Number of specific fragments extracted= 7 number of extra gaps= 0 total=226 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_209359415.pdb -s /var/tmp/to_scwrl_209359415.seq -o /var/tmp/from_scwrl_209359415.pdb > /var/tmp/scwrl_209359415.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_209359415.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z5nA/T0299-1z5nA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z5nA expands to /projects/compbio/data/pdb/1z5n.pdb.gz 1z5nA:# T0299 read from 1z5nA/T0299-1z5nA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z5nA read from 1z5nA/T0299-1z5nA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1z5nA to template set # found chain 1z5nA in template set T0299 54 :AQLVEKLETFFAVH 1z5nA 123 :DKLIAAAEACIAEL T0299 68 :YPFIQSFSLLS 1z5nA 138 :LNAVRGLIVSG T0299 79 :LEDFEAELENLPA 1z5nA 155 :SVGLAKIRHNFPQ T0299 102 :FLFYTE 1z5nA 168 :AIAVEM Number of specific fragments extracted= 4 number of extra gaps= 0 total=230 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1735079295.pdb -s /var/tmp/to_scwrl_1735079295.seq -o /var/tmp/from_scwrl_1735079295.pdb > /var/tmp/scwrl_1735079295.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1735079295.pdb Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1k68A/T0299-1k68A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1k68A/T0299-1k68A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1k68A read from 1k68A/T0299-1k68A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1k68A in template set Warning: unaligning (T0299)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)E107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 46 :FFT 1k68A 14 :FLV T0299 50 :IDS 1k68A 17 :EDN T0299 54 :AQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 20 :KADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEY T0299 95 :RDLARKDFLF 1k68A 59 :ANASRPDLIL T0299 108 :GLDVDQVIATVESLELKD 1k68A 72 :NLPKKDGREVLAEIKSDP Number of specific fragments extracted= 5 number of extra gaps= 0 total=235 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_831768825.pdb -s /var/tmp/to_scwrl_831768825.seq -o /var/tmp/from_scwrl_831768825.pdb > /var/tmp/scwrl_831768825.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_831768825.pdb Number of alignments=30 # command:# reading script from file T0299.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1atg read from 1atg/T0299-1atg-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1atg in training set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 14 :TLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 98 :ARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1atg 47 :GAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGK T0299 154 :LLKVPFYRHITIRN 1atg 99 :VLAGNGWRHIAISN T0299 168 :AKTFDKIGQMLK 1atg 119 :GLAGTQVLTHLG Number of specific fragments extracted= 4 number of extra gaps= 0 total=239 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1604765403.pdb -s /var/tmp/to_scwrl_1604765403.seq -o /var/tmp/from_scwrl_1604765403.pdb > /var/tmp/scwrl_1604765403.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1604765403.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fp1D read from 1fp1D/T0299-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1fp1D in template set T0299 23 :ELRQE 1fp1D 199 :RMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLEL 1fp1D 279 :NWSDEKCIEFLSNCHK T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLK 1fp1D 297 :SPNGKVIIVEFILPEEPNTSEESKLVST T0299 157 :VPF 1fp1D 332 :TVG T0299 163 :ITIRNAKTFDKIGQMLK 1fp1D 335 :GRERTEKQYEKLSKLSG Number of specific fragments extracted= 10 number of extra gaps= 0 total=249 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_2006138721.pdb -s /var/tmp/to_scwrl_2006138721.seq -o /var/tmp/from_scwrl_2006138721.pdb > /var/tmp/scwrl_2006138721.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2006138721.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/T0299-1vjrA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1vjrA/T0299-1vjrA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vjrA read from 1vjrA/T0299-1vjrA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vjrA in template set T0299 21 :MAELRQELTNLGL 1vjrA 26 :SLEFLETLKEKNK T0299 37 :ESYINSGN 1vjrA 39 :RFVFFTNN T0299 49 :SIDSKAQLVEKLET 1vjrA 47 :SSLGAQDYVRKLRN T0299 63 :FFAVHYP 1vjrA 80 :HMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQ 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYER T0299 115 :IATVESLELKDEVL 1vjrA 130 :LKKACILLRKGKFY T0299 138 :GKFSEES 1vjrA 151 :NCPSKEG T0299 146 :SKTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 164 :SIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 8 number of extra gaps= 0 total=257 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1823796891.pdb -s /var/tmp/to_scwrl_1823796891.seq -o /var/tmp/from_scwrl_1823796891.pdb > /var/tmp/scwrl_1823796891.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1823796891.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xzoA read from 1xzoA/T0299-1xzoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)D125 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)E126 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 3 :RYALLV 1xzoA 35 :VWLADF T0299 11 :INVG 1xzoA 41 :IFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYINSGN 1xzoA 70 :VRIISFSVD T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 124 :K 1xzoA 135 :H T0299 127 :VLYF 1xzoA 138 :SFYL T0299 131 :GKLGIFWGKFSEESYSKTAYHKYLL 1xzoA 144 :PDGKVLKDYNGVENTPYDDIISDVK Number of specific fragments extracted= 10 number of extra gaps= 3 total=267 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1785550550.pdb -s /var/tmp/to_scwrl_1785550550.seq -o /var/tmp/from_scwrl_1785550550.pdb > /var/tmp/scwrl_1785550550.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1785550550.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zghA read from 1zghA/T0299-1zghA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zghA in template set Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 8 :VRGINVGGKN 1zghA 100 :ISAIKVDGGI T0299 41 :NSGNIFFT 1zghA 110 :DTGDIFFK T0299 49 :S 1zghA 121 :D T0299 50 :IDSKAQLVEKLETFFAVHY 1zghA 123 :YGTAEEIFMRASKIIFNDM T0299 82 :FEAELENLPAWWSRDLARKDF 1zghA 142 :IPELLTKRPVPQKQEGEATVF T0299 105 :YTEGLDVDQVIATVESLELKD 1zghA 172 :ISPDFDLEKIYDYIRMLDGEG T0299 126 :EV 1zghA 195 :RA T0299 130 :FGK 1zghA 199 :KYG T0299 133 :LGIFWGKF 1zghA 203 :YRLEFSRA Number of specific fragments extracted= 9 number of extra gaps= 1 total=276 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1534230296.pdb -s /var/tmp/to_scwrl_1534230296.seq -o /var/tmp/from_scwrl_1534230296.pdb > /var/tmp/scwrl_1534230296.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1534230296.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1t6nA read from 1t6nA/T0299-1t6nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1t6nA in template set T0299 4 :YALLVR 1t6nA 116 :VLVMCH T0299 20 :V 1t6nA 122 :T T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELENL 1t6nA 164 :NCPHIVVGTPGRILALARNK T0299 94 :SRDLARKDFLFYTE 1t6nA 184 :SLNLKHIKHFILDE T0299 111 :VDQVIATVESLEL 1t6nA 204 :QLDMRRDVQEIFR T0299 124 :KDEV 1t6nA 220 :HEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPFY 1t6nA 236 :RPVCRKFMQDPME Number of specific fragments extracted= 11 number of extra gaps= 0 total=287 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1364090031.pdb -s /var/tmp/to_scwrl_1364090031.seq -o /var/tmp/from_scwrl_1364090031.pdb > /var/tmp/scwrl_1364090031.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1364090031.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ispA read from 1ispA/T0299-1ispA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1ispA 39 :VDFWDKT T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSL 1ispA 52 :GPVLSRFVQKVLDETGAKKVDIVAHSM T0299 85 :ELENLPAWWS 1ispA 86 :YIKNLDGGNK T0299 95 :RDLARKDFLFYTEG 1ispA 118 :DPNQKILYTSIYSS T0299 109 :LDVDQ 1ispA 136 :VMNYL T0299 121 :LELKDEVL 1ispA 141 :SRLDGARN T0299 140 :FSEESYSKTAYHK 1ispA 149 :VQIHGVGHIGLLY T0299 167 :NAKTFDKIGQMLK 1ispA 162 :SSQVNSLIKEGLN Number of specific fragments extracted= 10 number of extra gaps= 0 total=297 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1108399133.pdb -s /var/tmp/to_scwrl_1108399133.seq -o /var/tmp/from_scwrl_1108399133.pdb > /var/tmp/scwrl_1108399133.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1108399133.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ccwA read from 1ccwA/T0299-1ccwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ccwA in training set Warning: unaligning (T0299)T2 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)I71 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGLE 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGFN T0299 36 :VESY 1ccwA 34 :VVNI T0299 44 :N 1ccwA 39 :V T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 72 :QSFSLLS 1ccwA 57 :AILVSSL T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFY 1ccwA 82 :GLEGILLYVG T0299 106 :TEGLDVDQVIATVESLEL 1ccwA 96 :VGKQHWPDVEKRFKDMGY T0299 138 :GKFSEESYSKTAYHKYLLKV 1ccwA 114 :DRVYAPGTPPEVGIADLKKD Number of specific fragments extracted= 11 number of extra gaps= 2 total=308 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1341443180.pdb -s /var/tmp/to_scwrl_1341443180.seq -o /var/tmp/from_scwrl_1341443180.pdb > /var/tmp/scwrl_1341443180.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1341443180.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u0sA/T0299-1u0sA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u0sA expands to /projects/compbio/data/pdb/1u0s.pdb.gz 1u0sA:Skipped atom 1009, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1011, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1013, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1015, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1017, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1019, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1021, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1023, because occupancy 0.500 <= existing 0.500 in 1u0sA Skipped atom 1025, because occupancy 0.500 <= existing 0.500 in 1u0sA # T0299 read from 1u0sA/T0299-1u0sA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1u0sA read from 1u0sA/T0299-1u0sA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1u0sA to template set # found chain 1u0sA in template set T0299 45 :IFFT 1u0sA 183 :VILK T0299 49 :SIDSKAQLVEKLETFFAV 1u0sA 188 :GTQLKSARIYLVFHKLEE T0299 68 :YPFIQSFSLLSLEDFE 1u0sA 206 :LKCEVVRTIPSVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVLYFGK 1u0sA 251 :DIERVIIKE Number of specific fragments extracted= 5 number of extra gaps= 0 total=313 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1078898505.pdb -s /var/tmp/to_scwrl_1078898505.seq -o /var/tmp/from_scwrl_1078898505.pdb > /var/tmp/scwrl_1078898505.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1078898505.pdb Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/T0299-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wdjA expands to /projects/compbio/data/pdb/1wdj.pdb.gz 1wdjA:# T0299 read from 1wdjA/T0299-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wdjA read from 1wdjA/T0299-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1wdjA to template set # found chain 1wdjA in template set T0299 16 :KNKVVMAELRQELTNLG 1wdjA 8 :ARPVSEEELRRLSELNP T0299 43 :GNIFFT 1wdjA 34 :GRLWVS T0299 49 :SIDSK 1wdjA 41 :TGGES T0299 54 :AQLVEKLETFFAVH 1wdjA 50 :LQLAYQLARWNEER T0299 68 :YP 1wdjA 77 :FP T0299 71 :IQSFSLLSLED 1wdjA 84 :SPDAAFVERGA T0299 86 :LENLPAWWS 1wdjA 95 :WEALSEAER T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESL 1wdjA 108 :PLAPKAVFEVRSASQDPEELRAKMGIY T0299 122 :ELK 1wdjA 136 :RNG T0299 127 :VLYFGKLGIFW 1wdjA 144 :LVDPYARAVEV T0299 140 :FSEESY 1wdjA 155 :FRPGKP Number of specific fragments extracted= 11 number of extra gaps= 0 total=324 # request to SCWRL produces command: ulimit -t 162 ; scwrl3 -i /var/tmp/to_scwrl_1242990414.pdb -s /var/tmp/to_scwrl_1242990414.seq -o /var/tmp/from_scwrl_1242990414.pdb > /var/tmp/scwrl_1242990414.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1242990414.pdb Number of alignments=40 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0299//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0299/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0299//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0299/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0299/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0299/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t6nA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1t6nA/merged-local-a2m # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 1 :MTRYALLVRGINVGGKNKVVMAE 1t6nA 68 :PSEVQHECIPQAILGMDVLCQAK Number of specific fragments extracted= 1 number of extra gaps= 0 total=325 Number of alignments=41 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=325 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 114 :VIATVESLE 1t6nA 169 :VVGTPGRIL T0299 123 :LKDEVLYFGKLGIF 1t6nA 180 :ARNKSLNLKHIKHF Number of specific fragments extracted= 2 number of extra gaps= 0 total=327 Number of alignments=42 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 100 :KDFLFYTEGLDVDQVIATVESL 1t6nA 155 :KKDEEVLKKNCPHIVVGTPGRI Number of specific fragments extracted= 1 number of extra gaps= 0 total=328 Number of alignments=43 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 91 :AWWSRDLARKDFLFYTEGLDVDQVIATVESL 1t6nA 146 :AVFFGGLSIKKDEEVLKKNCPHIVVGTPGRI T0299 122 :ELKDEVLYFGKLGIF 1t6nA 179 :LARNKSLNLKHIKHF Number of specific fragments extracted= 2 number of extra gaps= 0 total=330 Number of alignments=44 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 89 :LPAWWSRDLARKDFLFYTEGLDVDQVIATVESLE 1t6nA 144 :KVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRIL T0299 123 :LKDEVLYFGKL 1t6nA 180 :ARNKSLNLKHI Number of specific fragments extracted= 2 number of extra gaps= 0 total=332 Number of alignments=45 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 14 :GGKNKVVMAELRQELTNLGLEKVE 1t6nA 46 :GFRDFLLKPELLRAIVDCGFEHPS Number of specific fragments extracted= 1 number of extra gaps= 0 total=333 Number of alignments=46 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=333 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 72 :QSFSLLSLEDFEAELENLPA 1t6nA 116 :VLVMCHTRELAFQISKEYER T0299 93 :WSRDLARKDFLFYTEGLDVDQVIATVESLE 1t6nA 136 :FSKYMPNVKVAVFFGGLSIKKDEEVLKKNC Number of specific fragments extracted= 2 number of extra gaps= 0 total=335 Number of alignments=47 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 4 :YALLVR 1t6nA 116 :VLVMCH T0299 20 :V 1t6nA 122 :T T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELENL 1t6nA 164 :NCPHIVVGTPGRILALARNK T0299 94 :SRDLARKDFLFYTE 1t6nA 184 :SLNLKHIKHFILDE T0299 111 :VDQVIATVESLEL 1t6nA 204 :QLDMRRDVQEIFR T0299 124 :KDEV 1t6nA 220 :HEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPFY 1t6nA 236 :RPVCRKFMQDPME Number of specific fragments extracted= 11 number of extra gaps= 0 total=346 Number of alignments=48 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 14 :GGKNKVVMAELRQELTNLGLEKVE 1t6nA 46 :GFRDFLLKPELLRAIVDCGFEHPS Number of specific fragments extracted= 1 number of extra gaps= 0 total=347 Number of alignments=49 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=347 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 33 :LEKVES 1t6nA 140 :MPNVKV T0299 45 :IFFTSIDSKAQLVEKLET 1t6nA 146 :AVFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELENLPAW 1t6nA 164 :NCPHIVVGTPGRILALARNKSLN T0299 97 :LARKDFLFY 1t6nA 187 :LKHIKHFIL T0299 107 :EGLDVDQVIATVESLELKDEV 1t6nA 203 :EQLDMRRDVQEIFRMTPHEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPF 1t6nA 236 :RPVCRKFMQDPM Number of specific fragments extracted= 7 number of extra gaps= 0 total=354 Number of alignments=50 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 4 :YALLVR 1t6nA 116 :VLVMCH T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELEN 1t6nA 164 :NCPHIVVGTPGRILALARN T0299 94 :SRDLARKDFLFYTE 1t6nA 184 :SLNLKHIKHFILDE T0299 112 :DQVIATVES 1t6nA 205 :LDMRRDVQE T0299 121 :LELKDEV 1t6nA 217 :MTPHEKQ T0299 134 :GIFWGKFSEESY 1t6nA 224 :VMMFSATLSKEI T0299 148 :TAYHKYLLKVPFYRH 1t6nA 236 :RPVCRKFMQDPMEIF Number of specific fragments extracted= 10 number of extra gaps= 0 total=364 Number of alignments=51 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 14 :GGKNKVVMAELRQELTNLGLEKVE 1t6nA 46 :GFRDFLLKPELLRAIVDCGFEHPS Number of specific fragments extracted= 1 number of extra gaps= 0 total=365 Number of alignments=52 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=365 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLE 1t6nA 139 :YMPNVKVAVFFGGLSIKKDEEVLKKNC Number of specific fragments extracted= 1 number of extra gaps= 0 total=366 Number of alignments=53 # 1t6nA read from 1t6nA/merged-local-a2m # found chain 1t6nA in template set T0299 21 :MAELRQELTNL 1t6nA 126 :AFQISKEYERF T0299 32 :GLEKVESY 1t6nA 139 :YMPNVKVA T0299 46 :FFTSIDSKAQLVEKLET 1t6nA 147 :VFFGGLSIKKDEEVLKK T0299 70 :FIQSFSLLSLEDFEAELENLPA 1t6nA 164 :NCPHIVVGTPGRILALARNKSL T0299 96 :DLARKDFLFYTE 1t6nA 186 :NLKHIKHFILDE T0299 110 :DVDQVIATVESLE 1t6nA 203 :EQLDMRRDVQEIF Number of specific fragments extracted= 6 number of extra gaps= 0 total=372 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z5nA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1z5nA/merged-local-a2m # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1z5nA 122 :DDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=373 Number of alignments=55 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 20 :VMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLE 1z5nA 125 :LIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFP Number of specific fragments extracted= 1 number of extra gaps= 0 total=374 Number of alignments=56 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 23 :ELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1z5nA 128 :AAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=375 Number of alignments=57 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 19 :VVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1z5nA 124 :KLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN Number of specific fragments extracted= 1 number of extra gaps= 0 total=376 Number of alignments=58 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=377 Number of alignments=59 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=378 Number of alignments=60 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1z5nA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH T0299 67 :HY 1z5nA 164 :NF Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=61 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 22 :AELRQELTNL 1z5nA 123 :DKLIAAAEAC T0299 32 :GLEKVESYINSGNIFFTSIDSKAQLVEK 1z5nA 137 :NLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 68 :Y 1z5nA 165 :F T0299 70 :FIQSFSLLSLEDFEAELEN 1z5nA 166 :PQAIAVEMEATAIAHVCHN T0299 95 :RDLARKDFLFYTEGLD 1z5nA 185 :FNVPFVVVRAISDVAD T0299 111 :VDQVIATVES 1z5nA 207 :FDEFLAVAAK Number of specific fragments extracted= 6 number of extra gaps= 0 total=386 Number of alignments=62 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=387 Number of alignments=63 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=388 Number of alignments=64 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1z5nA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH T0299 67 :HYPF 1z5nA 164 :NFPQ T0299 73 :SFSL 1z5nA 168 :AIAV Number of specific fragments extracted= 3 number of extra gaps= 0 total=391 Number of alignments=65 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 5 :ALLVRG 1z5nA 43 :VALLKS T0299 15 :GKNKVVMAELRQELTNL 1z5nA 49 :GIGKVAAALGATLLLEH T0299 35 :KVESYINSGNIFFTSID 1z5nA 67 :KPDVIINTGSAGGLAPT T0299 72 :QSFSLLS 1z5nA 87 :GDIVVSD T0299 80 :EDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLE 1z5nA 123 :DKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNF T0299 124 :K 1z5nA 166 :P T0299 132 :KLGIFW 1z5nA 167 :QAIAVE T0299 145 :YSKTAYHKYLLKVPFYR 1z5nA 173 :MEATAIAHVCHNFNVPF Number of specific fragments extracted= 8 number of extra gaps= 0 total=399 Number of alignments=66 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=400 Number of alignments=67 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1z5nA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=401 Number of alignments=68 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1z5nA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH T0299 67 :HYP 1z5nA 164 :NFP Number of specific fragments extracted= 2 number of extra gaps= 0 total=403 Number of alignments=69 # 1z5nA read from 1z5nA/merged-local-a2m # found chain 1z5nA in template set T0299 54 :AQLVEKLETFFAVH 1z5nA 123 :DKLIAAAEACIAEL T0299 68 :YPFIQSFSLLS 1z5nA 138 :LNAVRGLIVSG T0299 79 :LEDFEAELENLPA 1z5nA 155 :SVGLAKIRHNFPQ T0299 102 :FLFYTE 1z5nA 168 :AIAVEM Number of specific fragments extracted= 4 number of extra gaps= 0 total=407 Number of alignments=70 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1eqcA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1eqcA expands to /projects/compbio/data/pdb/1eqc.pdb.gz 1eqcA:Skipped atom 282, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 284, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 286, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 625, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 627, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 629, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 631, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 796, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 798, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 800, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1013, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1015, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1017, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1322, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1324, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1326, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 1701, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 2115, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 2610, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 2612, because occupancy 0.500 <= existing 0.500 in 1eqcA Skipped atom 2614, because occupancy 0.500 <= existing 0.500 in 1eqcA # T0299 read from 1eqcA/merged-local-a2m # 1eqcA read from 1eqcA/merged-local-a2m # adding 1eqcA to template set # found chain 1eqcA in template set T0299 7 :LVRGI 1eqcA 213 :SLRQT T0299 14 :GGKNKVVMAELRQE 1eqcA 218 :GSVTPVIIHDAFQV T0299 134 :GIFWGKFSE 1eqcA 232 :FGYWNNFLT Number of specific fragments extracted= 3 number of extra gaps= 0 total=410 Number of alignments=71 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 14 :GGKNKVVMAELRQE 1eqcA 218 :GSVTPVIIHDAFQV T0299 90 :PAWWSRDLAR 1eqcA 232 :FGYWNNFLTV Number of specific fragments extracted= 2 number of extra gaps= 0 total=412 Number of alignments=72 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 6 :LLVRGINVGG 1eqcA 13 :NVIRGVNLGG Number of specific fragments extracted= 1 number of extra gaps= 0 total=413 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 6 :LLVRGINVGGK 1eqcA 13 :NVIRGVNLGGW T0299 63 :FFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFL 1eqcA 41 :GNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFK Number of specific fragments extracted= 2 number of extra gaps= 0 total=415 Number of alignments=73 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqcA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqcA)S364 T0299 76 :LLSLEDFEAELENLPAW 1eqcA 307 :VNRGARYEGAYDNAPYI T0299 98 :ARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqcA 324 :GSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqcA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=418 Number of alignments=74 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqcA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqcA)S364 T0299 78 :SLEDFEAELENLPAWWSRD 1eqcA 309 :RGARYEGAYDNAPYIGSCQ T0299 102 :FLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqcA 328 :PLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqcA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=421 Number of alignments=75 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 12 :NVGGKNKVVMAELRQELT 1eqcA 191 :NEPLGPVLNMDKLKQFFL T0299 59 :KLETFFA 1eqcA 209 :DGYNSLR T0299 67 :HYPFIQSFSLLSL 1eqcA 216 :QTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYT 1eqcA 233 :GYWNNFLTVAEGQWNVVVDH Number of specific fragments extracted= 4 number of extra gaps= 0 total=425 Number of alignments=76 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 3 :RYALLVRGINVGGKNK 1eqcA 129 :RVWIDLHGAPGSQNGF T0299 21 :MAELRQELTNL 1eqcA 161 :TQVTLNVLNTI T0299 32 :GLEKVESYINSGNIFFTSI 1eqcA 179 :EYSDVVIGIELLNEPLGPV T0299 52 :SKAQLVEKLETFFAV 1eqcA 199 :NMDKLKQFFLDGYNS T0299 67 :HYPFIQSFSLLSL 1eqcA 216 :QTGSVTPVIIHDA T0299 89 :LPA 1eqcA 230 :QVF T0299 95 :RDLARKDFLFYTE 1eqcA 241 :VAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqcA 264 :SRNINDHISVACNW Number of specific fragments extracted= 8 number of extra gaps= 0 total=433 Number of alignments=77 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqcA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqcA)S364 T0299 76 :LLSLEDFEAELENLPA 1eqcA 307 :VNRGARYEGAYDNAPY T0299 97 :LARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqcA 323 :IGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqcA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=436 Number of alignments=78 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqcA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqcA)S364 T0299 78 :SLEDFEAELENLPAWWSRD 1eqcA 309 :RGARYEGAYDNAPYIGSCQ T0299 98 :A 1eqcA 328 :P T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqcA 329 :LLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqcA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 4 number of extra gaps= 1 total=440 Number of alignments=79 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 34 :EKVESYINSGNIFFTSIDSKAQLVEKLETFFA 1eqcA 181 :SDVVIGIELLNEPLGPVLNMDKLKQFFLDGYN T0299 66 :VHYPFIQSFSLLSL 1eqcA 215 :RQTGSVTPVIIHDA T0299 91 :A 1eqcA 232 :F T0299 92 :WWS 1eqcA 234 :YWN T0299 95 :RDLARKDFLFYTE 1eqcA 242 :AEGQWNVVVDHHH T0299 108 :GLDVDQVIA 1eqcA 264 :SRNINDHIS Number of specific fragments extracted= 6 number of extra gaps= 0 total=446 Number of alignments=80 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 4 :YALLVRGI 1eqcA 90 :FVRIPIGY T0299 12 :NVGGKNKVV 1eqcA 101 :QLLDNDPYV T0299 21 :MAELRQELTNLG 1eqcA 116 :LEKALGWARKNN T0299 36 :VESYINSGNI 1eqcA 128 :IRVWIDLHGA T0299 47 :FTSIDSKAQLVEKLETFFAVHYPFI 1eqcA 155 :FQNGDNTQVTLNVLNTIFKKYGGNE T0299 72 :QSFSL 1eqcA 184 :VIGIE T0299 77 :LSLEDFEAELEN 1eqcA 198 :LNMDKLKQFFLD T0299 91 :A 1eqcA 229 :F T0299 92 :WWS 1eqcA 231 :VFG T0299 95 :RDLARKDFLFYTE 1eqcA 241 :VAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqcA 264 :SRNINDHISVACNW Number of specific fragments extracted= 11 number of extra gaps= 0 total=457 Number of alignments=81 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 8 :VRGINVGG 1eqcA 15 :IRGVNLGG Number of specific fragments extracted= 1 number of extra gaps= 0 total=458 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqcA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqcA)S364 T0299 78 :SLEDFEAELENLPAWWSRDLARKD 1eqcA 309 :RGARYEGAYDNAPYIGSCQPLLDI T0299 107 :EGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqcA 333 :SQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 139 :KFSEESYS 1eqcA 365 :WKTENAPE T0299 148 :TAYHKYLLKVPFYRHITIR 1eqcA 373 :WSFQTLTYNGLFPQPVTDR Number of specific fragments extracted= 4 number of extra gaps= 1 total=462 Number of alignments=82 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 51 :DSKAQLVEKLETFFA 1eqcA 198 :LNMDKLKQFFLDGYN T0299 66 :VHYPFIQSFSLLSL 1eqcA 215 :RQTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYTEG 1eqcA 233 :GYWNNFLTVAEGQWNVVVDHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=465 Number of alignments=83 # 1eqcA read from 1eqcA/merged-local-a2m # found chain 1eqcA in template set T0299 4 :YALLVRGINVGGKN 1eqcA 130 :VWIDLHGAPGSQNG T0299 19 :V 1eqcA 144 :F T0299 21 :MAELRQELTNL 1eqcA 161 :TQVTLNVLNTI T0299 32 :GLEKVESYINSGN 1eqcA 179 :EYSDVVIGIELLN T0299 48 :TSID 1eqcA 194 :LGPV T0299 52 :SKAQLVEKLETFFAV 1eqcA 199 :NMDKLKQFFLDGYNS T0299 67 :HYPFIQSFSLLSL 1eqcA 216 :QTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYTE 1eqcA 233 :GYWNNFLTVAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqcA 264 :SRNINDHISVACNW Number of specific fragments extracted= 9 number of extra gaps= 0 total=474 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u0sA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1u0sA/merged-local-a2m # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 150 :YHKYLLKVPFYRHITIRNAKTF 1u0sA 176 :FKTFYIKVILKEGTQLKSARIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=475 Number of alignments=85 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=475 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 150 :YHKYLLKVPFYRHITIRNAKTF 1u0sA 176 :FKTFYIKVILKEGTQLKSARIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=476 Number of alignments=86 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=476 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 28 :LTNLGLEKVESYINS 1u0sA 234 :ISPVDLEKLSEALSS Number of specific fragments extracted= 1 number of extra gaps= 0 total=477 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=477 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1u0sA 217 :VEEIEEEKFENEVELFVISPVDLEKLSEALSSIADIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=478 Number of alignments=87 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 59 :KLETFF 1u0sA 216 :SVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVL 1u0sA 251 :DIERV Number of specific fragments extracted= 3 number of extra gaps= 0 total=481 Number of alignments=88 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 45 :IFFT 1u0sA 183 :VILK T0299 49 :SIDSKAQLVEKLETFFAV 1u0sA 188 :GTQLKSARIYLVFHKLEE T0299 68 :YPFIQSFSLLSLEDFE 1u0sA 206 :LKCEVVRTIPSVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVLYFGK 1u0sA 251 :DIERVIIKE Number of specific fragments extracted= 5 number of extra gaps= 0 total=486 Number of alignments=89 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 45 :IFFT 1u0sA 183 :VILK T0299 49 :SIDSKAQLVEKLETFFAV 1u0sA 188 :GTQLKSARIYLVFHKLEE T0299 68 :YPFIQSFSLLSLEDFE 1u0sA 206 :LKCEVVRTIPSVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVLYFGK 1u0sA 251 :DIERVIIKE Number of specific fragments extracted= 5 number of extra gaps= 0 total=491 Number of alignments=90 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1u0sA 217 :VEEIEEEKFENEVELFVISPVDLEKLSEALSSIADIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=492 Number of alignments=91 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 59 :KLETFFA 1u0sA 216 :SVEEIEE T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 223 :EKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEV 1u0sA 251 :DIER Number of specific fragments extracted= 3 number of extra gaps= 0 total=495 Number of alignments=92 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 45 :IFFT 1u0sA 183 :VILK T0299 49 :SIDSKAQLVEKLETFFAV 1u0sA 188 :GTQLKSARIYLVFHKLEE T0299 68 :YPFIQSFSLLSLEDFE 1u0sA 206 :LKCEVVRTIPSVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVLYFGK 1u0sA 251 :DIERVIIKE Number of specific fragments extracted= 5 number of extra gaps= 0 total=500 Number of alignments=93 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 45 :IFFT 1u0sA 183 :VILK T0299 49 :SIDSKAQL 1u0sA 189 :TQLKSARI T0299 58 :EKLETFFAV 1u0sA 197 :YLVFHKLEE T0299 68 :YPFIQSFSLLSLEDFE 1u0sA 206 :LKCEVVRTIPSVEEIE T0299 94 :SRDLARKDFLFYTEGLDVDQVIATVESLE 1u0sA 222 :EEKFENEVELFVISPVDLEKLSEALSSIA T0299 124 :KDEVLYFGK 1u0sA 251 :DIERVIIKE Number of specific fragments extracted= 6 number of extra gaps= 0 total=506 Number of alignments=94 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENL 1u0sA 217 :VEEIEEEKFENEVELFVISPVDLEKLSEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=507 Number of alignments=95 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENL 1u0sA 217 :VEEIEEEKFENEVELFVISPVDLEKLSEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=508 Number of alignments=96 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 23 :ELRQELTNLGLEKVESY 1u0sA 198 :LVFHKLEELKCEVVRTI T0299 51 :DSKAQL 1u0sA 215 :PSVEEI T0299 93 :WSRDLARKDFLFYTEGLDV 1u0sA 221 :EEEKFENEVELFVISPVDL T0299 113 :QVIATVESLELKDEVLYFGK 1u0sA 240 :EKLSEALSSIADIERVIIKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=512 Number of alignments=97 # 1u0sA read from 1u0sA/merged-local-a2m # found chain 1u0sA in template set T0299 22 :AELRQELTNLGLE 1u0sA 197 :YLVFHKLEELKCE T0299 46 :FFTSIDSKAQLV 1u0sA 210 :VVRTIPSVEEIE T0299 65 :AVHYPFIQSFSL 1u0sA 222 :EEKFENEVELFV T0299 78 :SLEDFEAELENLPAW 1u0sA 238 :DLEKLSEALSSIADI T0299 126 :E 1u0sA 253 :E Number of specific fragments extracted= 5 number of extra gaps= 0 total=517 Number of alignments=98 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atg/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1atg/merged-local-a2m # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 45 :IFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 3 :LKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 99 :RKDFLFYTEG 1atg 49 :PYNVFFSADE T0299 109 :LDVDQVIATVESLE 1atg 145 :NSVGQAHSQTASGA T0299 131 :GKLGIFWGKFSEESY 1atg 174 :AKIPGSHWFPPANYY Number of specific fragments extracted= 4 number of extra gaps= 0 total=521 Number of alignments=99 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 40 :INSGNIFFTSIDSKAQLVEKLETFF 1atg 53 :FFSADEKSPEKLDNQGFALPGSRFT T0299 128 :LYFGKLGIFWGK 1atg 78 :YAIGKLVLWSAK Number of specific fragments extracted= 2 number of extra gaps= 0 total=523 Number of alignments=100 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 46 :FFTSIDSKAQLVEKLETFF 1atg 59 :KSPEKLDNQGFALPGSRFT T0299 128 :LYFGKLGIFWGK 1atg 78 :YAIGKLVLWSAK Number of specific fragments extracted= 2 number of extra gaps= 0 total=525 Number of alignments=101 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 14 :GGK 1atg 104 :GWR T0299 18 :KVVMAELRQELTNLGLEKVE 1atg 107 :HIAISNPQIAPYGLAGTQVL T0299 169 :KTFDKIGQMLKK 1atg 127 :THLGLLDKLTAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=528 Number of alignments=102 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 91 :AWWSRD 1atg 78 :YAIGKL T0299 97 :LARK 1atg 86 :WSAK T0299 101 :DFL 1atg 91 :GLV T0299 107 :EGLD 1atg 94 :DNQG T0299 112 :DQVIA 1atg 98 :KVLAG T0299 169 :KTFDKIGQM 1atg 127 :THLGLLDKL Number of specific fragments extracted= 6 number of extra gaps= 0 total=534 Number of alignments=103 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 107 :EGLDVDQVIATVESLELKDEVLYF 1atg 143 :EANSVGQAHSQTASGAADLGFVAL T0299 131 :GKLGIFWGKFSEESYSKTAYHKYLLK 1atg 174 :AKIPGSHWFPPANYYEPIVQQAVITK Number of specific fragments extracted= 2 number of extra gaps= 0 total=536 Number of alignments=104 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 39 :YINSGNIF 1atg 86 :WSAKPGLV T0299 50 :IDSKAQLVEKLETFFAVHYPFIQSFSLLSLE 1atg 94 :DNQGKVLAGNGWRHIAISNPQIAPYGLAGTQ T0299 85 :ELENLPAWWSR 1atg 125 :VLTHLGLLDKL T0299 98 :ARKDFLFY 1atg 136 :TAQERIVE T0299 108 :GLDVDQVIATVESLELK 1atg 144 :ANSVGQAHSQTASGAAD T0299 125 :DEVLYFGKLGIFWGKFSEESYSKTAYH 1atg 168 :QIIQAAAKIPGSHWFPPANYYEPIVQQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=542 Number of alignments=105 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 90 :PAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSE 1atg 39 :PVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=543 Number of alignments=106 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 78 :SLEDFEAELENLPAW 1atg 37 :SGPVYAQIVNGAPYN T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSE 1atg 52 :VFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=545 Number of alignments=107 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 57 :VEKLETFFAVHYPFIQSFSLLSLED 1atg 15 :LEQLAGQFAKQTGHAVVISSGSSGP T0299 82 :FEAELENLPAW 1atg 41 :YAQIVNGAPYN T0299 102 :FLFYTEG 1atg 52 :VFFSADE T0299 110 :DVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYH 1atg 59 :KSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVL T0299 155 :LK 1atg 101 :AG Number of specific fragments extracted= 5 number of extra gaps= 0 total=550 Number of alignments=108 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 13 :GTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 89 :L 1atg 48 :A T0299 99 :RKDFLFYTEG 1atg 49 :PYNVFFSADE T0299 113 :QVIATVESLEL 1atg 59 :KSPEKLDNQGF T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYHK 1atg 73 :GSRFTYAIGKLVLWSAKPGLVDNQGKVLA T0299 156 :KVPFYR 1atg 102 :GNGWRH T0299 163 :ITIRN 1atg 108 :IAISN T0299 168 :AKTFDKIGQMLK 1atg 119 :GLAGTQVLTHLG Number of specific fragments extracted= 8 number of extra gaps= 0 total=558 Number of alignments=109 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 90 :PAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSE 1atg 39 :PVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=559 Number of alignments=110 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 78 :SLEDFEAELENLPAW 1atg 37 :SGPVYAQIVNGAPYN T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSE 1atg 52 :VFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=561 Number of alignments=111 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 57 :VEKLETFFAVHYPFIQSFSLLSLED 1atg 15 :LEQLAGQFAKQTGHAVVISSGSSGP T0299 82 :FEAELENLPAW 1atg 41 :YAQIVNGAPYN T0299 102 :FLFYTEG 1atg 52 :VFFSADE T0299 110 :DVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYH 1atg 59 :KSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVL Number of specific fragments extracted= 4 number of extra gaps= 0 total=565 Number of alignments=112 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAEL 1atg 13 :GTLEQLAGQFAKQTGHAVVISSGSSGPVYAQI T0299 87 :ENLPA 1atg 46 :NGAPY T0299 101 :DFLFYTEG 1atg 51 :NVFFSADE T0299 113 :QVIATVESLEL 1atg 59 :KSPEKLDNQGF T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAY 1atg 73 :GSRFTYAIGKLVLWSAKPGLVDNQGKV T0299 155 :LKVPFYRHITIRN 1atg 100 :LAGNGWRHIAISN Number of specific fragments extracted= 6 number of extra gaps= 0 total=571 Number of alignments=113 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 90 :PAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1atg 39 :PVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQG Number of specific fragments extracted= 1 number of extra gaps= 0 total=572 Number of alignments=114 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 88 :NLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1atg 37 :SGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGK Number of specific fragments extracted= 1 number of extra gaps= 0 total=573 Number of alignments=115 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 58 :EKLETFFAVHYPFIQSFSLLSLED 1atg 16 :EQLAGQFAKQTGHAVVISSGSSGP T0299 82 :FEAELENLPAW 1atg 41 :YAQIVNGAPYN T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAY 1atg 52 :VFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKV Number of specific fragments extracted= 3 number of extra gaps= 0 total=576 Number of alignments=116 # 1atg read from 1atg/merged-local-a2m # found chain 1atg in training set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1atg 14 :TLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVN T0299 98 :ARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1atg 47 :GAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGK T0299 154 :LLKVPFYRHITIRN 1atg 99 :VLAGNGWRHIAISN T0299 168 :AKTFDKIGQMLK 1atg 119 :GLAGTQVLTHLG Number of specific fragments extracted= 4 number of extra gaps= 0 total=580 Number of alignments=117 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fxlA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1fxlA/merged-local-a2m # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 102 :FLFYTEGLDVDQVIATVESLELKDE 1fxlA 84 :FVNYIDPKDAEKAINTLNGLRLQTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=581 Number of alignments=118 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 86 :LENLPAWWSRDLARKDFLFYTEGLDVDQVI 1fxlA 129 :VSGLPKTMTQKELEQLFSQYGRIITSRILV Number of specific fragments extracted= 1 number of extra gaps= 0 total=582 Number of alignments=119 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 81 :DFEAELENLPAWWSRDLARKDFLFYTEGLDVDQ 1fxlA 124 :DANLYVSGLPKTMTQKELEQLFSQYGRIITSRI Number of specific fragments extracted= 1 number of extra gaps= 0 total=583 Number of alignments=120 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 10 :GINVGGKNKVVMAELRQELT 1fxlA 102 :GLRLQTKTIKVSYARPSSAS T0299 79 :LEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVI 1fxlA 122 :IRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILV Number of specific fragments extracted= 2 number of extra gaps= 0 total=585 Number of alignments=121 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 79 :LEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQV 1fxlA 122 :IRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRIL Number of specific fragments extracted= 1 number of extra gaps= 0 total=586 Number of alignments=122 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 10 :GINVGGKNKVVMAELRQELTNLG 1fxlA 102 :GLRLQTKTIKVSYARPSSASIRD T0299 82 :FEAELENLPAWWSRDLARKDFLFYTEGLDVDQVI 1fxlA 125 :ANLYVSGLPKTMTQKELEQLFSQYGRIITSRILV Number of specific fragments extracted= 2 number of extra gaps= 0 total=588 Number of alignments=123 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 13 :VGGKNKVVMAELRQELTNLG 1fxlA 105 :LQTKTIKVSYARPSSASIRD T0299 82 :FEAELENLPAWWSRDLARKDFLFYTEGLDVDQV 1fxlA 125 :ANLYVSGLPKTMTQKELEQLFSQYGRIITSRIL Number of specific fragments extracted= 2 number of extra gaps= 0 total=590 Number of alignments=124 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 14 :GGKNKVVMAELRQELTNLG 1fxlA 131 :GLPKTMTQKELEQLFSQYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=591 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 102 :FLFYTEGLDVDQVIATVESLELKDEVLYFG 1fxlA 84 :FVNYIDPKDAEKAINTLNGLRLQTKTIKVS Number of specific fragments extracted= 1 number of extra gaps= 0 total=592 Number of alignments=125 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 77 :LSLEDFEAELENLPAWWS 1fxlA 50 :MTQEEFRSLFGSIGEIES T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGK 1fxlA 77 :GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSY T0299 133 :LGIFWG 1fxlA 125 :ANLYVS T0299 140 :FSEESYSKTAYHKYLLK 1fxlA 131 :GLPKTMTQKELEQLFSQ T0299 159 :FYRHITIR 1fxlA 148 :YGRIITSR Number of specific fragments extracted= 5 number of extra gaps= 0 total=597 Number of alignments=126 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 11 :INVGGKN 1fxlA 43 :VNYLPQN T0299 19 :VVMAELRQELTNL 1fxlA 50 :MTQEEFRSLFGSI T0299 32 :GLEKVESYI 1fxlA 64 :EIESCKLVR T0299 41 :NSGNIFFTS 1fxlA 79 :SLGYGFVNY T0299 51 :DSKA 1fxlA 88 :IDPK T0299 59 :KLETFFAVHYPFIQ 1fxlA 92 :DAEKAINTLNGLRL T0299 73 :SFSLLSL 1fxlA 109 :TIKVSYA T0299 89 :LPA 1fxlA 116 :RPS T0299 94 :SRDLARKDFLF 1fxlA 119 :SASIRDANLYV T0299 105 :YTEGLDVDQVIATVESLEL 1fxlA 132 :LPKTMTQKELEQLFSQYGR T0299 124 :KDEVLYFGK 1fxlA 152 :ITSRILVDQ T0299 133 :LGIFW 1fxlA 167 :GVGFI T0299 140 :FSEESYSKTAYHKYLLKVPF 1fxlA 172 :RFDKRIEAEEAIKGLNGQKP Number of specific fragments extracted= 13 number of extra gaps= 0 total=610 Number of alignments=127 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 14 :GGKNKVVMAELRQELTNLG 1fxlA 131 :GLPKTMTQKELEQLFSQYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=611 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 102 :FLFYTEGLDVDQVIATVESLELKDEVLYFG 1fxlA 84 :FVNYIDPKDAEKAINTLNGLRLQTKTIKVS Number of specific fragments extracted= 1 number of extra gaps= 0 total=612 Number of alignments=128 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 78 :SLEDFEAELENLPAWWS 1fxlA 51 :TQEEFRSLFGSIGEIES T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFG 1fxlA 77 :GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVS T0299 132 :KLGIFWGK 1fxlA 124 :DANLYVSG T0299 141 :SEESYSKTAYHKYLL 1fxlA 132 :LPKTMTQKELEQLFS T0299 158 :PFYRHITIR 1fxlA 147 :QYGRIITSR Number of specific fragments extracted= 5 number of extra gaps= 0 total=617 Number of alignments=129 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 12 :NVGGKN 1fxlA 44 :NYLPQN T0299 19 :VVMAELRQELTNL 1fxlA 50 :MTQEEFRSLFGSI T0299 32 :GLEKVESYI 1fxlA 64 :EIESCKLVR T0299 41 :NSGNIFFTSIDSK 1fxlA 79 :SLGYGFVNYIDPK T0299 59 :KLETFFAVHYPFIQ 1fxlA 92 :DAEKAINTLNGLRL T0299 73 :SFSLLS 1fxlA 109 :TIKVSY T0299 89 :LPAWWSRDLARKDFLFYTEGLDVDQVIATVESLEL 1fxlA 116 :RPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGR T0299 124 :KDEVLYFGK 1fxlA 152 :ITSRILVDQ T0299 133 :LGIFW 1fxlA 167 :GVGFI T0299 140 :FSEESYSKTAYHKYLLKVPF 1fxlA 172 :RFDKRIEAEEAIKGLNGQKP Number of specific fragments extracted= 10 number of extra gaps= 0 total=627 Number of alignments=130 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 14 :GGKNKVVMAELRQELTNLG 1fxlA 131 :GLPKTMTQKELEQLFSQYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=628 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=628 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 11 :INVGGKN 1fxlA 43 :VNYLPQN T0299 19 :VVMAELRQELTNLGLEK 1fxlA 50 :MTQEEFRSLFGSIGEIE T0299 36 :VE 1fxlA 68 :CK T0299 43 :GNIFFTSIDSK 1fxlA 81 :GYGFVNYIDPK T0299 59 :KLETFFAVHYPF 1fxlA 92 :DAEKAINTLNGL T0299 73 :SF 1fxlA 111 :KV T0299 89 :LPAWW 1fxlA 116 :RPSSA T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFG 1fxlA 121 :SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRIL T0299 132 :KLGIFWGKFSEESYSKTA 1fxlA 166 :RGVGFIRFDKRIEAEEAI T0299 152 :KYLLKVP 1fxlA 184 :KGLNGQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=638 Number of alignments=131 # 1fxlA read from 1fxlA/merged-local-a2m # found chain 1fxlA in training set T0299 11 :INVGGKN 1fxlA 43 :VNYLPQN T0299 19 :VVMAELRQELTNLG 1fxlA 50 :MTQEEFRSLFGSIG T0299 33 :LEKVESYI 1fxlA 65 :IESCKLVR T0299 41 :NSGNIFFTSIDSK 1fxlA 79 :SLGYGFVNYIDPK T0299 59 :KLETFFAVHYPFIQ 1fxlA 92 :DAEKAINTLNGLRL T0299 73 :SFSLLSL 1fxlA 109 :TIKVSYA T0299 89 :LPAW 1fxlA 116 :RPSS T0299 95 :RDLARKDFLF 1fxlA 120 :ASIRDANLYV T0299 105 :YTEGLDVDQVIATVESLELKDEVLYFG 1fxlA 132 :LPKTMTQKELEQLFSQYGRIITSRILV T0299 132 :KLGIFWGKFSEE 1fxlA 166 :RGVGFIRFDKRI Number of specific fragments extracted= 10 number of extra gaps= 0 total=648 Number of alignments=132 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1vjrA/merged-local-a2m # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 7 :LVRGINVGGKNKVVMAELRQELTNLGL 1vjrA 81 :MLKRFGRCRIFLLGTPQLKKVFEAYGH T0299 96 :DLARKDFLFYTEG 1vjrA 108 :VIDEENPDFVVLG T0299 111 :VDQVIATVESLELKDEVL 1vjrA 121 :FDKTLTYERLKKACILLR T0299 130 :FGKLGIFWGKFSE 1vjrA 139 :KGKFYIATHPDIN Number of specific fragments extracted= 4 number of extra gaps= 0 total=652 Number of alignments=133 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 15 :GKNKVVMAELRQELTNLGL 1vjrA 89 :RIFLLGTPQLKKVFEAYGH T0299 96 :DLARKDFLFYTEG 1vjrA 108 :VIDEENPDFVVLG T0299 111 :VDQVIATVESLELKDEVL 1vjrA 121 :FDKTLTYERLKKACILLR T0299 130 :FGKLGIFWGKFSE 1vjrA 139 :KGKFYIATHPDIN Number of specific fragments extracted= 4 number of extra gaps= 0 total=656 Number of alignments=134 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 5 :ALLVRGINVGGKNKVVMAELRQ 1vjrA 127 :YERLKKACILLRKGKFYIATHP T0299 27 :ELTNLGLEKVESYINSGNI 1vjrA 159 :VPDAGSIMAAIEASTGRKP T0299 46 :FF 1vjrA 179 :LI Number of specific fragments extracted= 3 number of extra gaps= 0 total=659 Number of alignments=135 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 79 :LEDFEAELEN 1vjrA 111 :EENPDFVVLG Number of specific fragments extracted= 1 number of extra gaps= 0 total=660 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELK 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=661 Number of alignments=136 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 62 :TFFAVHYP 1vjrA 79 :EHMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLEL 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRK T0299 133 :L 1vjrA 140 :G Number of specific fragments extracted= 3 number of extra gaps= 0 total=664 Number of alignments=137 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 2 :TRYALLVRG 1vjrA 38 :KRFVFFTNN T0299 17 :NKVVMAELRQELTNLGLEKV 1vjrA 47 :SSLGAQDYVRKLRNMGVDVP T0299 37 :ESYINSGNI 1vjrA 68 :DAVVTSGEI T0299 60 :LETFFAVHYPF 1vjrA 77 :TAEHMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQ 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYER T0299 115 :IATVESLELKDEVLYFGKLGI 1vjrA 130 :LKKACILLRKGKFYIATHPDI T0299 138 :GKFSEESYSK 1vjrA 151 :NCPSKEGPVP T0299 148 :T 1vjrA 162 :A T0299 149 :AYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 167 :AAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 9 number of extra gaps= 0 total=673 Number of alignments=138 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 3 :RYALLVRG 1vjrA 39 :RFVFFTNN T0299 17 :NKVVMAELRQELTNLGL 1vjrA 47 :SSLGAQDYVRKLRNMGV T0299 34 :EKVES 1vjrA 68 :DAVVT T0299 63 :FFAVHYP 1vjrA 80 :HMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLD 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLT T0299 112 :DQVIATVESLELKDEVLYFGK 1vjrA 127 :YERLKKACILLRKGKFYIATH T0299 138 :GKFSEESYSK 1vjrA 151 :NCPSKEGPVP T0299 148 :TAYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 166 :MAAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 8 number of extra gaps= 0 total=681 Number of alignments=139 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELK 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=682 Number of alignments=140 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 62 :TFFAVHYP 1vjrA 79 :EHMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLEL 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRK T0299 133 :LG 1vjrA 140 :GK Number of specific fragments extracted= 3 number of extra gaps= 0 total=685 Number of alignments=141 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 2 :TRYALLVRG 1vjrA 38 :KRFVFFTNN T0299 17 :NKVVMAELRQELTNLGLE 1vjrA 47 :SSLGAQDYVRKLRNMGVD T0299 37 :ESYINSGNI 1vjrA 68 :DAVVTSGEI T0299 60 :LETFFAVHYPF 1vjrA 77 :TAEHMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQ 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYER T0299 115 :IATVESLELKDEVLYFGKLGI 1vjrA 130 :LKKACILLRKGKFYIATHPDI T0299 138 :GKFSEESYSK 1vjrA 151 :NCPSKEGPVP T0299 148 :T 1vjrA 162 :A T0299 149 :AYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 167 :AAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 9 number of extra gaps= 0 total=694 Number of alignments=142 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 21 :MAELRQELTNLGL 1vjrA 26 :SLEFLETLKEKNK T0299 37 :ESYINSGN 1vjrA 39 :RFVFFTNN T0299 49 :SIDSKAQLVEKLET 1vjrA 47 :SSLGAQDYVRKLRN T0299 63 :FFAVHYP 1vjrA 80 :HMLKRFG T0299 71 :IQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQ 1vjrA 87 :RCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYER T0299 115 :IATVESLELKDEVL 1vjrA 130 :LKKACILLRKGKFY T0299 138 :GKFSEES 1vjrA 151 :NCPSKEG T0299 146 :SKTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 164 :SIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 8 number of extra gaps= 0 total=702 Number of alignments=143 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFS 1vjrA 15 :TFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQD Number of specific fragments extracted= 1 number of extra gaps= 0 total=703 Number of alignments=144 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 63 :FFAVHYPF 1vjrA 80 :HMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTE 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDK T0299 109 :LDVDQVIATVESLELKDE 1vjrA 124 :TLTYERLKKACILLRKGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=706 Number of alignments=145 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 2 :TRYALLVRGI 1vjrA 38 :KRFVFFTNNS T0299 18 :KVVMAELRQELTNLGLE 1vjrA 48 :SLGAQDYVRKLRNMGVD T0299 35 :KV 1vjrA 69 :AV T0299 40 :INSGN 1vjrA 71 :VTSGE T0299 59 :KLETFFAVHYPF 1vjrA 76 :ITAEHMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSR 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDE T0299 97 :LARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKL 1vjrA 112 :ENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHP T0299 138 :GKFSEESYS 1vjrA 151 :NCPSKEGPV T0299 147 :KTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1vjrA 165 :IMAAIEASTGRKPDLIAGKPNPLVVDVISEKFG Number of specific fragments extracted= 9 number of extra gaps= 0 total=715 Number of alignments=146 # 1vjrA read from 1vjrA/merged-local-a2m # found chain 1vjrA in template set T0299 3 :RYALLVR 1vjrA 39 :RFVFFTN T0299 13 :VGG 1vjrA 46 :NSS T0299 19 :VVMAELRQELTNLGL 1vjrA 49 :LGAQDYVRKLRNMGV T0299 34 :EKVES 1vjrA 68 :DAVVT T0299 63 :FFAVHYPF 1vjrA 80 :HMLKRFGR T0299 72 :QSFSLLSLEDFEAELENLPAWWSRDL 1vjrA 88 :CRIFLLGTPQLKKVFEAYGHVIDEEN T0299 99 :RKDFLFYTEGLDVDQVIATVESLELKDEVLYFGK 1vjrA 114 :PDFVVLGFDKTLTYERLKKACILLRKGKFYIATH T0299 138 :GKFSEESYS 1vjrA 151 :NCPSKEGPV T0299 147 :KTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLKK 1vjrA 165 :IMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGV Number of specific fragments extracted= 9 number of extra gaps= 0 total=724 Number of alignments=147 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w3iA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1w3iA/merged-local-a2m # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)I71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 T0299 20 :VMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFA 1w3iA 22 :KLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTN T0299 69 :P 1w3iA 68 :K T0299 72 :QSFSLLSLED 1w3iA 71 :FQVGGLNLDD Number of specific fragments extracted= 3 number of extra gaps= 1 total=727 Number of alignments=148 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)I71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFA 1w3iA 24 :KIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTN T0299 69 :P 1w3iA 68 :K T0299 72 :QSFSLLSLEDFEA 1w3iA 71 :FQVGGLNLDDAIR Number of specific fragments extracted= 3 number of extra gaps= 1 total=730 Number of alignments=149 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1w3iA 23 :LKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLK Number of specific fragments extracted= 1 number of extra gaps= 0 total=731 Number of alignments=150 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=731 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)I71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 T0299 20 :VMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFA 1w3iA 22 :KLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTN T0299 69 :P 1w3iA 68 :K T0299 72 :QSFSLLSLED 1w3iA 71 :FQVGGLNLDD Number of specific fragments extracted= 3 number of extra gaps= 1 total=734 Number of alignments=151 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=734 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETF 1w3iA 16 :NRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=735 Number of alignments=152 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F102 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)L103 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHY 1w3iA 16 :NRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTN T0299 101 :D 1w3iA 68 :K T0299 104 :FYTEGLDVDQVIA 1w3iA 71 :FQVGGLNLDDAIR T0299 118 :VESLELKDEVLYFG 1w3iA 84 :LAKLSKDFDIVGIA T0299 134 :GIFW 1w3iA 100 :APYY Number of specific fragments extracted= 5 number of extra gaps= 2 total=740 Number of alignments=153 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)F104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 13 :VGGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDS 1w3iA 12 :FTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLS T0299 57 :VEKLETFFAVHYPFIQS 1w3iA 52 :PEEKLENLKAVYDVTNK T0299 76 :L 1w3iA 71 :F T0299 77 :LSLEDFEAELEN 1w3iA 76 :LNLDDAIRLAKL T0299 94 :SRDLARKDFL 1w3iA 88 :SKDFDIVGIA T0299 106 :T 1w3iA 100 :A T0299 107 :EGLDVDQVIATV 1w3iA 105 :PRMSEKHLVKYF Number of specific fragments extracted= 7 number of extra gaps= 2 total=747 Number of alignments=154 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)F104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 5 :ALLVRGINVGGKNKVVMAELRQELTNL 1w3iA 4 :IITPIITPFTKDNRIDKEKLKIHAENL T0299 32 :GL 1w3iA 34 :GI T0299 37 :ESYINSGNIFFTSIDSKAQLV 1w3iA 36 :DKLFVNGTTGLGPSLSPEEKL T0299 62 :TFFAVHYPFIQS 1w3iA 57 :ENLKAVYDVTNK T0299 76 :LL 1w3iA 71 :FQ T0299 78 :SLEDFEAELEN 1w3iA 77 :NLDDAIRLAKL T0299 94 :SRDLARKDFL 1w3iA 88 :SKDFDIVGIA T0299 106 :T 1w3iA 100 :A T0299 107 :EGLDVDQVIATVESLE 1w3iA 105 :PRMSEKHLVKYFKTLC Number of specific fragments extracted= 9 number of extra gaps= 2 total=756 Number of alignments=155 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETF 1w3iA 16 :NRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=757 Number of alignments=156 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F102 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)L103 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYP 1w3iA 16 :NRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNK T0299 104 :FYTEGLDVDQVIA 1w3iA 71 :FQVGGLNLDDAIR T0299 118 :VESLELKDEVLYFG 1w3iA 84 :LAKLSKDFDIVGIA T0299 134 :GIFW 1w3iA 100 :APYY Number of specific fragments extracted= 4 number of extra gaps= 2 total=761 Number of alignments=157 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)F104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 13 :VGGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1w3iA 12 :FTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLE T0299 63 :FFAVHYPFIQS 1w3iA 58 :NLKAVYDVTNK T0299 76 :LL 1w3iA 71 :FQ T0299 78 :SLEDFEAELEN 1w3iA 77 :NLDDAIRLAKL T0299 94 :SRDLARKDFL 1w3iA 88 :SKDFDIVGIA T0299 106 :TEGLDVDQVIATV 1w3iA 104 :YPRMSEKHLVKYF Number of specific fragments extracted= 6 number of extra gaps= 2 total=767 Number of alignments=158 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)F104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 5 :ALLVRGINVGGKNKVVMAELR 1w3iA 4 :IITPIITPFTKDNRIDKEKLK T0299 26 :QELTNLGLEK 1w3iA 28 :ENLIRKGIDK T0299 39 :YINSGNIFFTSIDSKAQL 1w3iA 38 :LFVNGTTGLGPSLSPEEK T0299 61 :ETFFAVHYPFIQS 1w3iA 56 :LENLKAVYDVTNK T0299 76 :LL 1w3iA 71 :FQ T0299 78 :SLEDFEAELEN 1w3iA 77 :NLDDAIRLAKL T0299 94 :SRDLARKDFL 1w3iA 88 :SKDFDIVGIA T0299 106 :T 1w3iA 100 :A T0299 107 :EGLDVDQVIATVESL 1w3iA 105 :PRMSEKHLVKYFKTL Number of specific fragments extracted= 9 number of extra gaps= 2 total=776 Number of alignments=159 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set T0299 48 :TSIDSKAQLVEKLETFFAVHYP 1w3iA 15 :DNRIDKEKLKIHAENLIRKGID Number of specific fragments extracted= 1 number of extra gaps= 0 total=777 Number of alignments=160 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=777 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)T106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 14 :GGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDS 1w3iA 13 :TKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLS T0299 57 :VEKLETFFAVHYPFIQS 1w3iA 52 :PEEKLENLKAVYDVTNK T0299 76 :LL 1w3iA 71 :FQ T0299 78 :SLEDFEAELEN 1w3iA 77 :NLDDAIRLAKL T0299 95 :RDLARKDFLF 1w3iA 88 :SKDFDIVGIA T0299 107 :EGLDVDQVIATV 1w3iA 100 :APYYYPRMSEKH Number of specific fragments extracted= 6 number of extra gaps= 2 total=783 Number of alignments=161 # 1w3iA read from 1w3iA/merged-local-a2m # found chain 1w3iA in training set Warning: unaligning (T0299)F74 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)I70 Warning: unaligning (T0299)S75 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)I70 Warning: unaligning (T0299)F104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1w3iA)Y99 Warning: unaligning (T0299)Y105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1w3iA)Y99 T0299 5 :ALLVRGINVGGKNKVVMAELR 1w3iA 4 :IITPIITPFTKDNRIDKEKLK T0299 26 :QELTNLGLEK 1w3iA 28 :ENLIRKGIDK T0299 39 :YINSGNIFFTSIDSKAQ 1w3iA 38 :LFVNGTTGLGPSLSPEE T0299 60 :LETFFAVHYPFIQS 1w3iA 55 :KLENLKAVYDVTNK T0299 76 :LL 1w3iA 71 :FQ T0299 78 :SLEDFEAELEN 1w3iA 77 :NLDDAIRLAKL T0299 94 :SRDLARKDFL 1w3iA 88 :SKDFDIVGIA T0299 106 :TE 1w3iA 100 :AP T0299 108 :GLDVDQVIATVESL 1w3iA 106 :RMSEKHLVKYFKTL Number of specific fragments extracted= 9 number of extra gaps= 2 total=792 Number of alignments=162 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bqcA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1bqcA/merged-local-a2m # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 6 :LLVRGINVGGKNKVVMAELRQELTNLGLEKVESYI 1bqcA 19 :FIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVL T0299 42 :SGNIF 1bqcA 54 :SNGVR Number of specific fragments extracted= 2 number of extra gaps= 0 total=794 Number of alignments=163 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 8 :VRGINVGGKNKVVMAELRQELTNLGLEKVESYI 1bqcA 21 :IRGVSHPHNWYPQHTQAFADIKSHGANTVRVVL T0299 42 :SGNIFFTS 1bqcA 54 :SNGVRWSK Number of specific fragments extracted= 2 number of extra gaps= 0 total=796 Number of alignments=164 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 6 :LLVRGINVGGKNKVVMAELRQELTNLGLEKVESYI 1bqcA 19 :FIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVL T0299 99 :RKDFLFYTEGL 1bqcA 54 :SNGVRWSKNGP T0299 110 :DVDQVIATVESLELK 1bqcA 66 :DVANVISLCKQNRLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=799 Number of alignments=165 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 6 :LLVRGINVGGKNKVVMAELRQELTNLGLEKVESYI 1bqcA 19 :FIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVL T0299 67 :HYPFIQSF 1bqcA 56 :GVRWSKNG T0299 76 :LLSLEDFEAEL 1bqcA 64 :PSDVANVISLC T0299 87 :ENLPAWWSRDLARKDFLFYTEGL 1bqcA 88 :TTGYGEQSGASTLDQAVDYWIEL T0299 118 :VESLELKDEVLYFGKL 1bqcA 120 :YVLINIGNEPYGNDSA Number of specific fragments extracted= 5 number of extra gaps= 0 total=804 Number of alignments=166 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 6 :LLVRGINVGGKNKVVMAELRQELTNLGLEKV 1bqcA 19 :FIIRGVSHPHNWYPQHTQAFADIKSHGANTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=805 Number of alignments=167 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=805 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 42 :SGNIFFT 1bqcA 188 :TGNTVFS T0299 49 :SIDSKAQLVEKLETFFAVHYPFIQSFSL 1bqcA 196 :HMYGVYSQASTITSYLEHFVNAGLPLII Number of specific fragments extracted= 2 number of extra gaps= 0 total=807 Number of alignments=168 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set Warning: unaligning (T0299)D125 because of BadResidue code BAD_PEPTIDE in next template residue (1bqcA)S255 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE at template residue (1bqcA)S255 Warning: unaligning (T0299)L133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bqcA)V263 Warning: unaligning (T0299)G134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bqcA)V263 Warning: unaligning (T0299)I135 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1bqcA)E264 T0299 42 :SGNIFFT 1bqcA 188 :TGNTVFS T0299 49 :SIDSKAQLVEKLETFFAVHYPFIQSFSLLSLED 1bqcA 196 :HMYGVYSQASTITSYLEHFVNAGLPLIIGEFGH T0299 84 :AELENLPAWWS 1bqcA 229 :DHSDGNPDEDT T0299 110 :DVDQ 1bqcA 240 :IMAE T0299 115 :IATVESLELK 1bqcA 244 :AERLKLGYIG T0299 127 :VLYFGK 1bqcA 256 :WSGNGG T0299 136 :FWGKFSEE 1bqcA 265 :YLDMVYNF T0299 144 :SYSKTAYHKYLLK 1bqcA 274 :GDNLSPWGERIFY Number of specific fragments extracted= 8 number of extra gaps= 2 total=815 Number of alignments=169 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 39 :YINSGNIFFT 1bqcA 122 :LINIGNEPYG T0299 49 :SIDSKAQLVEKLETFFAV 1bqcA 133 :DSATVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPAW 1bqcA 176 :RNNADQVYASDPTG Number of specific fragments extracted= 4 number of extra gaps= 0 total=819 Number of alignments=170 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 5 :ALLVRG 1bqcA 80 :ICMLEV T0299 14 :GGKNKVVMAELRQELTNL 1bqcA 93 :EQSGASTLDQAVDYWIEL T0299 32 :GLEK 1bqcA 116 :GEED T0299 37 :ESYINSGNIFFT 1bqcA 120 :YVLINIGNEPYG T0299 49 :SIDSKAQLVEKLETFFAV 1bqcA 133 :DSATVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPA 1bqcA 176 :RNNADQVYASDPT T0299 98 :ARKDFLFYTEG 1bqcA 189 :GNTVFSIHMYG T0299 109 :LDVDQVIATVESLELKD 1bqcA 202 :SQASTITSYLEHFVNAG T0299 133 :LGIFWGKFSEES 1bqcA 219 :LPLIIGEFGHDH Number of specific fragments extracted= 10 number of extra gaps= 0 total=829 Number of alignments=171 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 42 :SGNIFFT 1bqcA 188 :TGNTVFS T0299 49 :SIDSKAQLVEKLETFFAVHYPFIQSFSL 1bqcA 196 :HMYGVYSQASTITSYLEHFVNAGLPLII Number of specific fragments extracted= 2 number of extra gaps= 0 total=831 Number of alignments=172 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set Warning: unaligning (T0299)D125 because of BadResidue code BAD_PEPTIDE in next template residue (1bqcA)S255 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE at template residue (1bqcA)S255 Warning: unaligning (T0299)L133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bqcA)V263 Warning: unaligning (T0299)G134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bqcA)V263 Warning: unaligning (T0299)I135 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1bqcA)E264 T0299 42 :SGNIFFT 1bqcA 188 :TGNTVFS T0299 49 :SIDSKAQLVEKLETFFAVHYPFIQSFSLLSLED 1bqcA 196 :HMYGVYSQASTITSYLEHFVNAGLPLIIGEFGH T0299 84 :AELENLPAWWS 1bqcA 229 :DHSDGNPDEDT T0299 110 :DVDQ 1bqcA 240 :IMAE T0299 115 :IATVESLELK 1bqcA 244 :AERLKLGYIG T0299 127 :VLYFGK 1bqcA 256 :WSGNGG T0299 136 :FWGKFSEE 1bqcA 265 :YLDMVYNF T0299 144 :SYSKTAYHKYLL 1bqcA 274 :GDNLSPWGERIF Number of specific fragments extracted= 8 number of extra gaps= 2 total=839 Number of alignments=173 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 23 :ELRQELT 1bqcA 109 :ELKSVLQ T0299 32 :GLEK 1bqcA 116 :GEED T0299 38 :SYINSGNIFFT 1bqcA 121 :VLINIGNEPYG T0299 49 :SIDSKAQLVEKLETFFAV 1bqcA 133 :DSATVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPAW 1bqcA 176 :RNNADQVYASDPTG T0299 99 :RKDFL 1bqcA 190 :NTVFS Number of specific fragments extracted= 7 number of extra gaps= 0 total=846 Number of alignments=174 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 5 :ALLVR 1bqcA 80 :ICMLE T0299 14 :GGKNKVVMAELRQELTNL 1bqcA 93 :EQSGASTLDQAVDYWIEL T0299 32 :GLE 1bqcA 116 :GEE T0299 38 :SYINSGNIFFT 1bqcA 121 :VLINIGNEPYG T0299 49 :SIDSKAQLVEKLETFFAV 1bqcA 133 :DSATVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPA 1bqcA 176 :RNNADQVYASDPT T0299 98 :ARKDFLFYTEG 1bqcA 189 :GNTVFSIHMYG T0299 109 :LDVDQVIATVESLEL 1bqcA 202 :SQASTITSYLEHFVN T0299 125 :DE 1bqcA 218 :GL T0299 133 :LGIFWGKFSEE 1bqcA 220 :PLIIGEFGHDH T0299 144 :SYSKTAYHKYLLKVPFY 1bqcA 234 :NPDEDTIMAEAERLKLG Number of specific fragments extracted= 12 number of extra gaps= 0 total=858 Number of alignments=175 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 42 :SGNIFFTSID 1bqcA 188 :TGNTVFSIHM T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSL 1bqcA 199 :GVYSQASTITSYLEHFVNAGLPLII Number of specific fragments extracted= 2 number of extra gaps= 0 total=860 Number of alignments=176 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set Warning: unaligning (T0299)D125 because of BadResidue code BAD_PEPTIDE in next template residue (1bqcA)S255 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE at template residue (1bqcA)S255 Warning: unaligning (T0299)L133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bqcA)V263 Warning: unaligning (T0299)G134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bqcA)V263 Warning: unaligning (T0299)I135 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1bqcA)E264 T0299 42 :SGNIFFTSID 1bqcA 188 :TGNTVFSIHM T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLE 1bqcA 199 :GVYSQASTITSYLEHFVNAGLPLIIGEFG T0299 83 :EAELENLPAWWSRDLAR 1bqcA 228 :HDHSDGNPDEDTIMAEA T0299 116 :ATVESLELK 1bqcA 245 :ERLKLGYIG T0299 127 :VLYFGK 1bqcA 256 :WSGNGG T0299 136 :FWGKFSEESYSKTA 1bqcA 265 :YLDMVYNFDGDNLS T0299 153 :YLLKVPFYR 1bqcA 279 :PWGERIFYG Number of specific fragments extracted= 7 number of extra gaps= 2 total=867 Number of alignments=177 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 39 :YINSGNIFFTSID 1bqcA 122 :LINIGNEPYGNDS T0299 52 :SKAQLVEKLETFFAV 1bqcA 136 :TVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPAW 1bqcA 176 :RNNADQVYASDPTG T0299 100 :KDFLFYT 1bqcA 190 :NTVFSIH Number of specific fragments extracted= 5 number of extra gaps= 0 total=872 Number of alignments=178 # 1bqcA read from 1bqcA/merged-local-a2m # found chain 1bqcA in training set T0299 5 :ALLVR 1bqcA 80 :ICMLE T0299 13 :VGGKNKVVMAELRQELTNL 1bqcA 92 :GEQSGASTLDQAVDYWIEL T0299 32 :GLEK 1bqcA 116 :GEED T0299 37 :ESYINSGNIFFTSID 1bqcA 120 :YVLINIGNEPYGNDS T0299 52 :SKAQLVEKLETFFAV 1bqcA 136 :TVAAWATDTSAAIQR T0299 67 :HYPFIQSFSLLS 1bqcA 153 :AAGFEHTLVVDA T0299 79 :LEDFEAELENLPAW 1bqcA 176 :RNNADQVYASDPTG T0299 100 :KDFLFYTEG 1bqcA 190 :NTVFSIHMY T0299 109 :LDVDQVIATVE 1bqcA 202 :SQASTITSYLE Number of specific fragments extracted= 9 number of extra gaps= 0 total=881 Number of alignments=179 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1fp1D/merged-local-a2m # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0299)K53 because last residue in template chain is (1fp1D)K372 T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFTSIDS 1fp1D 340 :EKQYEKLSKLSGFSKFQVACRAFNSLGVMEFY Number of specific fragments extracted= 1 number of extra gaps= 0 total=882 Number of alignments=180 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSI 1fp1D 341 :KQYEKLSKLSGFSKFQVACRAFNSLGVME Number of specific fragments extracted= 1 number of extra gaps= 0 total=883 Number of alignments=181 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFT 1fp1D 340 :EKQYEKLSKLSGFSKFQVACRAFNSLGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=884 Number of alignments=182 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=884 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 108 :GLDVDQVIATVESL 1fp1D 238 :NFDLPQVIENAPPL T0299 131 :GKLGIFWGKFS 1fp1D 252 :SGIEHVGGDMF T0299 143 :ESYS 1fp1D 263 :ASVP T0299 149 :AYHKYLLKVPFYRHITIRNAKTFDKIGQMLK 1fp1D 267 :QGDAMILKAVCHNWSDEKCIEFLSNCHKALS Number of specific fragments extracted= 4 number of extra gaps= 0 total=888 Number of alignments=183 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0299)F63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0299 64 :FAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEMKRMLEIYT T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESL 1fp1D 225 :ELIISKYPLIKGINFDLPQVIENAPPL T0299 131 :GKLGIFWGKFS 1fp1D 252 :SGIEHVGGDMF T0299 143 :E 1fp1D 263 :A Number of specific fragments extracted= 4 number of extra gaps= 0 total=892 Number of alignments=184 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSK 1fp1D 281 :SDEKCIEFLSNCHKALSPNGKVIIVEFIL T0299 80 :EDFEAELENLPA 1fp1D 337 :ERTEKQYEKLSK Number of specific fragments extracted= 2 number of extra gaps= 0 total=894 Number of alignments=185 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 32 :GLEKVESYINSG 1fp1D 206 :GFEGISTLVDVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=895 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 23 :ELRQELTNL 1fp1D 196 :EMKRMLEIY T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 51 :DSKAQLVEKLETF 1fp1D 219 :GSGRNLELIISKY T0299 64 :FAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1fp1D 233 :LIKGINFDLPQVIENAPPLSGIEHVGGDMFA T0299 95 :RDLARKDFLFYTEGLDVDQVIATV 1fp1D 266 :PQGDAMILKAVCHNWSDEKCIEFL T0299 122 :ELKDEVLYFGKLGIFWGKFSEESYSKTAY 1fp1D 290 :SNCHKALSPNGKVIIVEFILPEEPNTSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=901 Number of alignments=186 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 24 :LRQELTNL 1fp1D 197 :MKRMLEIY T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 59 :KLETFFAVHYPFIQSFSLLS 1fp1D 222 :RNLELIISKYPLIKGINFDL T0299 83 :EAELENLPAWWS 1fp1D 242 :PQVIENAPPLSG T0299 95 :RDLARKDFLFYT 1fp1D 263 :ASVPQGDAMILK T0299 107 :EGLDVDQVIATVESLEL 1fp1D 278 :HNWSDEKCIEFLSNCHK T0299 127 :VLYFGKLGIFWGKFSEESYSKTAYHKYLL 1fp1D 295 :ALSPNGKVIIVEFILPEEPNTSEESKLVS T0299 170 :TFDKIGQM 1fp1D 324 :TLDNLMFI Number of specific fragments extracted= 8 number of extra gaps= 0 total=909 Number of alignments=187 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 23 :ELRQE 1fp1D 199 :RMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLEL 1fp1D 279 :NWSDEKCIEFLSNCHK T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLK 1fp1D 297 :SPNGKVIIVEFILPEEPNTSEESKLVST T0299 157 :VPF 1fp1D 332 :TVG T0299 163 :ITIRNAKTFDKIGQMLK 1fp1D 335 :GRERTEKQYEKLSKLSG Number of specific fragments extracted= 10 number of extra gaps= 0 total=919 Number of alignments=188 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 32 :GLEKVESYINSG 1fp1D 206 :GFEGISTLVDVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=920 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 23 :ELRQELTNL 1fp1D 196 :EMKRMLEIY T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 51 :DSKAQLVEKLET 1fp1D 219 :GSGRNLELIISK T0299 63 :FFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1fp1D 232 :PLIKGINFDLPQVIENAPPLSGIEHVGGDMFA T0299 95 :RDLARKDFLFYTEGLDVDQVIATV 1fp1D 266 :PQGDAMILKAVCHNWSDEKCIEFL T0299 122 :ELKDEVLYFGKLGIFWGKFSEESYSKTAY 1fp1D 290 :SNCHKALSPNGKVIIVEFILPEEPNTSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=926 Number of alignments=189 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 23 :ELRQELTNL 1fp1D 196 :EMKRMLEIY T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 59 :KLETFFAVHYPFIQSFSLLS 1fp1D 222 :RNLELIISKYPLIKGINFDL T0299 83 :EAELENLPAWWS 1fp1D 242 :PQVIENAPPLSG T0299 95 :RDLARKDFLFYT 1fp1D 263 :ASVPQGDAMILK T0299 107 :EGLDVDQVIATVES 1fp1D 278 :HNWSDEKCIEFLSN T0299 128 :LYFGKLGIFWGKFSEESYSKTAYHKYL 1fp1D 296 :LSPNGKVIIVEFILPEEPNTSEESKLV T0299 169 :KTFDKIG 1fp1D 323 :STLDNLM Number of specific fragments extracted= 8 number of extra gaps= 0 total=934 Number of alignments=190 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 21 :MAELRQE 1fp1D 197 :MKRMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLEL 1fp1D 279 :NWSDEKCIEFLSNCHK T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLK 1fp1D 297 :SPNGKVIIVEFILPEEPNTSEESKLVST T0299 157 :VPF 1fp1D 332 :TVG T0299 163 :ITIRNAKTFDKIGQMLK 1fp1D 335 :GRERTEKQYEKLSKLSG Number of specific fragments extracted= 10 number of extra gaps= 0 total=944 Number of alignments=191 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 32 :GLEKVESYINSG 1fp1D 206 :GFEGISTLVDVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=945 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 30 :NLGLEKVESYINSGN 1fp1D 204 :YTGFEGISTLVDVGG T0299 51 :DSKAQLVEKLETF 1fp1D 219 :GSGRNLELIISKY T0299 64 :FAVHYPFIQSFSLLSLEDFEAE 1fp1D 233 :LIKGINFDLPQVIENAPPLSGI T0299 96 :DLARKDF 1fp1D 255 :EHVGGDM Number of specific fragments extracted= 4 number of extra gaps= 0 total=949 Number of alignments=192 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 24 :LRQELTNL 1fp1D 197 :MKRMLEIY T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 59 :KLETFFAVHYPFIQSFSLLS 1fp1D 222 :RNLELIISKYPLIKGINFDL T0299 83 :EAELENLPAWWS 1fp1D 242 :PQVIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESL 1fp1D 278 :HNWSDEKCIEFLSN T0299 127 :VLYFGKLGIFWGKFSEESYSKTA 1fp1D 295 :ALSPNGKVIIVEFILPEEPNTSE T0299 151 :HKYLL 1fp1D 318 :ESKLV T0299 169 :KTFDKIG 1fp1D 323 :STLDNLM Number of specific fragments extracted= 9 number of extra gaps= 0 total=958 Number of alignments=193 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0299 22 :AELRQE 1fp1D 198 :KRMLEI T0299 32 :GLEKVESYINSGN 1fp1D 206 :GFEGISTLVDVGG T0299 58 :EKLE 1fp1D 222 :RNLE T0299 63 :FFAVHYPFIQSFSLLSLE 1fp1D 226 :LIISKYPLIKGINFDLPQ T0299 85 :ELENLPAWWS 1fp1D 244 :VIENAPPLSG T0299 95 :RDLARKDFLFYTE 1fp1D 263 :ASVPQGDAMILKA T0299 108 :GLDVDQVIATVESLELK 1fp1D 279 :NWSDEKCIEFLSNCHKA T0299 128 :LYFGKLGIFWGK 1fp1D 296 :LSPNGKVIIVEF T0299 140 :FSEESYSKTAY 1fp1D 310 :PEEPNTSEESK T0299 151 :HKYLLKVPFYRH 1fp1D 325 :LDNLMFITVGGR T0299 165 :IRNAKTFDKIGQMLK 1fp1D 337 :ERTEKQYEKLSKLSG Number of specific fragments extracted= 11 number of extra gaps= 0 total=969 Number of alignments=194 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wekA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wekA expands to /projects/compbio/data/pdb/1wek.pdb.gz 1wekA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0299 read from 1wekA/merged-local-a2m # 1wekA read from 1wekA/merged-local-a2m # adding 1wekA to template set # found chain 1wekA in template set T0299 134 :GIFWGKFSEESYS 1wekA 93 :GVSVGLNIELPHE T0299 148 :TAYHKYLLKVPFYRHITIRN 1wekA 106 :QKPNPYQTHALSLRYFFVRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=971 Number of alignments=195 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=971 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 46 :FFTSIDSKAQLVEKLE 1wekA 196 :LFRLTDEPEEVVQALK Number of specific fragments extracted= 1 number of extra gaps= 0 total=972 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=972 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 129 :YFGKLGIFWGKFSEESYSKTAYHKYLLKVP 1wekA 172 :YWEGLVRWLAFLRDQKAVGPEDLQLFRLTD Number of specific fragments extracted= 1 number of extra gaps= 0 total=973 Number of alignments=196 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=973 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEGLD 1wekA 189 :VGPEDLQLFRLTDEPE Number of specific fragments extracted= 2 number of extra gaps= 0 total=975 Number of alignments=197 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEGL 1wekA 189 :VGPEDLQLFRLTDEP T0299 112 :DQVIA 1wekA 204 :EEVVQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=978 Number of alignments=198 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)S120 because last residue in template chain is (1wekA)A212 T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEG 1wekA 189 :VGPEDLQLFRLTDE T0299 111 :VDQVIATVE 1wekA 203 :PEEVVQALK Number of specific fragments extracted= 3 number of extra gaps= 0 total=981 Number of alignments=199 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)S120 because last residue in template chain is (1wekA)A212 T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAF T0299 95 :RDLARKDF 1wekA 192 :EDLQLFRL T0299 106 :TE 1wekA 200 :TD T0299 110 :DVDQVIATVE 1wekA 202 :EPEEVVQALK Number of specific fragments extracted= 4 number of extra gaps= 0 total=985 Number of alignments=200 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEGLD 1wekA 189 :VGPEDLQLFRLTDEPE Number of specific fragments extracted= 2 number of extra gaps= 0 total=987 Number of alignments=201 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEGL 1wekA 189 :VGPEDLQLFRLTDEP T0299 112 :DQVI 1wekA 204 :EEVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=990 Number of alignments=202 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)S120 because last residue in template chain is (1wekA)A212 T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRD T0299 95 :RDLARKDFLFYTEG 1wekA 189 :VGPEDLQLFRLTDE T0299 111 :VDQVIATVE 1wekA 203 :PEEVVQALK Number of specific fragments extracted= 3 number of extra gaps= 0 total=993 Number of alignments=203 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)S120 because last residue in template chain is (1wekA)A212 T0299 42 :SGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1wekA 133 :VGFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAF T0299 92 :WWSRDLARKD 1wekA 188 :AVGPEDLQLF T0299 104 :FYTE 1wekA 198 :RLTD T0299 110 :DVDQVIATVE 1wekA 202 :EPEEVVQALK Number of specific fragments extracted= 4 number of extra gaps= 0 total=997 Number of alignments=204 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)L121 because last residue in template chain is (1wekA)A212 T0299 70 :FIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVES 1wekA 161 :HRFPVFLLDRGYWEGLVRWLAFLRDQKAVGPEDLQLFRLTDEPEEVVQALK Number of specific fragments extracted= 1 number of extra gaps= 0 total=998 Number of alignments=205 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 63 :FFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIA 1wekA 154 :LLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRDQKAVGPEDLQLFRLTDEPEEVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=999 Number of alignments=206 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set T0299 44 :NIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLAR 1wekA 135 :FVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRDQKAVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1000 Number of alignments=207 # 1wekA read from 1wekA/merged-local-a2m # found chain 1wekA in template set Warning: unaligning (T0299)S120 because last residue in template chain is (1wekA)A212 T0299 43 :GNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1wekA 134 :GFVFLPGGFGTLDELSEVLVLLQTEKVHRFPVFLLDRGYWEGLVRWLAFLRDQK T0299 97 :LARKDFL 1wekA 194 :LQLFRLT T0299 109 :LDVDQVIATVE 1wekA 201 :DEPEEVVQALK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1003 Number of alignments=208 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g40A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g40A expands to /projects/compbio/data/pdb/2g40.pdb.gz 2g40A:Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 811, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 815, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 817, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 819, because occupancy 0.500 <= existing 0.500 in 2g40A Skipped atom 821, because occupancy 0.500 <= existing 0.500 in 2g40A # T0299 read from 2g40A/merged-local-a2m # 2g40A read from 2g40A/merged-local-a2m # adding 2g40A to template set # found chain 2g40A in template set T0299 11 :INVGGKNKVV 2g40A 151 :ICVVREDQIV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1004 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 61 :ETFFAVHYPFIQSFSLLSLEDFEAELENLP 2g40A 66 :ELPGAIAKALGNARRVIVPAGIPAPWLTVG T0299 91 :AWWSRDLARKDFL 2g40A 99 :LRDEPPLSHAELD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1006 Number of alignments=209 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 2g40A 65 :AELPGAIAKALGNARRVIVPAGIPAPWLTVGMD T0299 93 :WSRDLARKDFL 2g40A 101 :DEPPLSHAELD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1008 Number of alignments=210 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 67 :HYPFIQSFSLLSLEDFEAELENLPAWW 2g40A 72 :AKALGNARRVIVPAGIPAPWLTVGMDV T0299 94 :SRDLARKDFL 2g40A 102 :EPPLSHAELD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1010 Number of alignments=211 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 40 :INSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDV 2g40A 44 :ILHQFEDRILDYGAAYTHVSAAELPGAIAKALGNARRVIVPAGIPAPWLTVGMDVLRDEPPLSHAELDRADA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1011 Number of alignments=212 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1011 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 41 :NSGNIFFTSIDS 2g40A 126 :ETGTIILDHRAD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1012 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1012 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Warning: unaligning (T0299)I50 because first residue in template chain is (2g40A)P38 T0299 51 :DSKAQLVEKLETFFAVHY 2g40A 39 :LSRAEILHQFEDRILDYG T0299 72 :QSFSLLSLEDFEAELEN 2g40A 57 :AAYTHVSAAELPGAIAK T0299 89 :LPAWWSRD 2g40A 87 :IPAPWLTV T0299 99 :RKDFLFYTEGLDVDQ 2g40A 95 :GMDVLRDEPPLSHAE T0299 118 :VESLE 2g40A 110 :LDRAD T0299 126 :EVLYFGKLGIFWG 2g40A 121 :AVAISETGTIILD T0299 140 :FSEES 2g40A 134 :HRADQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1019 Number of alignments=213 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Warning: unaligning (T0299)I50 because first residue in template chain is (2g40A)P38 T0299 51 :DSKAQLVEKLETFFAVH 2g40A 39 :LSRAEILHQFEDRILDY T0299 71 :IQSFSLLSLEDFEAELEN 2g40A 56 :GAAYTHVSAAELPGAIAK T0299 89 :LPAWWSRDLA 2g40A 83 :VPAGIPAPWL T0299 99 :RKDFLFYTEGLDVDQV 2g40A 95 :GMDVLRDEPPLSHAEL T0299 116 :ATVE 2g40A 111 :DRAD T0299 124 :KDEVLYFGKLGIFWG 2g40A 119 :GCAVAISETGTIILD T0299 140 :FSEESYSKT 2g40A 134 :HRADQGRRA Number of specific fragments extracted= 7 number of extra gaps= 0 total=1026 Number of alignments=214 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 41 :NSGNIFFTSIDS 2g40A 126 :ETGTIILDHRAD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1027 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1027 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Warning: unaligning (T0299)I50 because first residue in template chain is (2g40A)P38 T0299 51 :DSKAQLVEKLETFFAVHYPFI 2g40A 39 :LSRAEILHQFEDRILDYGAAY T0299 75 :SLLSLEDFEAELEN 2g40A 60 :THVSAAELPGAIAK T0299 89 :LPAWWS 2g40A 87 :IPAPWL T0299 97 :LARKDFLFYTEGLDVDQVIA 2g40A 93 :TVGMDVLRDEPPLSHAELDR T0299 118 :V 2g40A 113 :A T0299 122 :E 2g40A 114 :D T0299 126 :EVLYFGKLGIFWG 2g40A 121 :AVAISETGTIILD T0299 140 :FSEE 2g40A 134 :HRAD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1035 Number of alignments=215 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 19 :VVMAELRQELTNL 2g40A 39 :LSRAEILHQFEDR T0299 32 :GLE 2g40A 56 :GAA T0299 47 :FT 2g40A 59 :YT T0299 49 :SIDS 2g40A 63 :SAAE T0299 60 :LETFFAVHYPFIQSFSLL 2g40A 67 :LPGAIAKALGNARRVIVP T0299 87 :ENLPAWWSRDL 2g40A 85 :AGIPAPWLTVG T0299 100 :KDFLFYTEGLDVDQVIA 2g40A 96 :MDVLRDEPPLSHAELDR T0299 121 :LE 2g40A 113 :AD T0299 124 :KDEVLYFGKLGIFWG 2g40A 119 :GCAVAISETGTIILD T0299 140 :FSEESYSK 2g40A 134 :HRADQGRR T0299 149 :AYH 2g40A 142 :ALS Number of specific fragments extracted= 11 number of extra gaps= 0 total=1046 Number of alignments=216 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 41 :NSGNIFFTSIDS 2g40A 126 :ETGTIILDHRAD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1047 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1047 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set T0299 22 :AELRQELTNLGL 2g40A 46 :HQFEDRILDYGA T0299 36 :VESYI 2g40A 58 :AYTHV T0299 52 :SKAQLVEKLETFF 2g40A 63 :SAAELPGAIAKAL T0299 69 :PFIQSFSLL 2g40A 76 :GNARRVIVP T0299 87 :ENLPAWWSRDLARK 2g40A 85 :AGIPAPWLTVGMDV T0299 105 :YTEGLDVDQV 2g40A 99 :LRDEPPLSHA T0299 117 :TVESL 2g40A 109 :ELDRA T0299 125 :DEVLYFGKLGIFWGKFSEESYSKTA 2g40A 120 :CAVAISETGTIILDHRADQGRRALS Number of specific fragments extracted= 8 number of extra gaps= 0 total=1055 Number of alignments=217 # 2g40A read from 2g40A/merged-local-a2m # found chain 2g40A in template set Warning: unaligning (T0299)I50 because first residue in template chain is (2g40A)P38 T0299 51 :DSKAQLVEKLETFFAV 2g40A 39 :LSRAEILHQFEDRILD T0299 70 :FIQSFSLLSLEDFEAELEN 2g40A 55 :YGAAYTHVSAAELPGAIAK T0299 89 :LPAWWSRDL 2g40A 87 :IPAPWLTVG T0299 102 :FLFYTEGLDVD 2g40A 96 :MDVLRDEPPLS T0299 113 :QVIATVE 2g40A 108 :AELDRAD T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTA 2g40A 119 :GCAVAISETGTIILDHRADQGRRALS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1061 Number of alignments=218 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oxkB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1oxkB expands to /projects/compbio/data/pdb/1oxk.pdb.gz 1oxkB:# T0299 read from 1oxkB/merged-local-a2m # 1oxkB read from 1oxkB/merged-local-a2m # adding 1oxkB to template set # found chain 1oxkB in template set T0299 45 :IFFTSIDSKAQLVEKLE 1oxkB 1170 :VALTAFADDSNIKECLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1062 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1062 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYIN 1oxkB 1096 :NHVNQEVIKRMLNLEGIENIELACD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1063 Number of alignments=219 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1063 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYIN 1oxkB 1096 :NHVNQEVIKRMLNLEGIENIELACD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1064 Number of alignments=220 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1064 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1oxkB 1090 :ILVVEDNHVNQEVIKRMLNLEGIENIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1065 Number of alignments=221 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 44 :NIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELE 1oxkB 1139 :NMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1066 Number of alignments=222 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 17 :NKVVMAELRQELTNLGLEKVESY 1oxkB 1096 :NHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLS 1oxkB 1119 :CDGQEAFDKVKELTSKGENYNMIFMDVQ T0299 79 :LEDFEAELENLPA 1oxkB 1153 :LLSTKMIRRDLGY T0299 99 :RKDFLFYTEGLDVDQVIATVESLE 1oxkB 1166 :TSPIVALTAFADDSNIKECLESGM T0299 138 :GKFSEESYSKTAYHKYLLKVPF 1oxkB 1190 :NGFLSKPIKRPKLKTILTEFCA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1071 Number of alignments=223 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 5 :ALLVR 1oxkB 1090 :ILVVE T0299 16 :KNKVVMAELRQELTNLGLEKVESY 1oxkB 1095 :DNHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLS 1oxkB 1119 :CDGQEAFDKVKELTSKGENYNMIFMDVQ T0299 79 :LEDFEAELENLPA 1oxkB 1153 :LLSTKMIRRDLGY T0299 99 :RKDFLFYTEGLDVDQ 1oxkB 1166 :TSPIVALTAFADDSN T0299 115 :IATVESLEL 1oxkB 1181 :IKECLESGM T0299 138 :GKFSEESYSKTAYHKYLLK 1oxkB 1190 :NGFLSKPIKRPKLKTILTE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1078 Number of alignments=224 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1oxkB 1090 :ILVVEDNHVNQEVIKRMLNLEGIENIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1079 Number of alignments=225 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 44 :NIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1oxkB 1139 :NMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1080 Number of alignments=226 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 16 :KNKVVMAELRQELTNLGLEKVESY 1oxkB 1095 :DNHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLS 1oxkB 1119 :CDGQEAFDKVKELTSKGENYNMIFMDVQ T0299 79 :LEDFEAELENLPA 1oxkB 1153 :LLSTKMIRRDLGY T0299 99 :RKDFLFYTEGLDVDQVIATVESLE 1oxkB 1166 :TSPIVALTAFADDSNIKECLESGM T0299 138 :GKFSEESYSKTAYHKYLLKVP 1oxkB 1190 :NGFLSKPIKRPKLKTILTEFC Number of specific fragments extracted= 5 number of extra gaps= 0 total=1085 Number of alignments=227 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 5 :ALLVR 1oxkB 1090 :ILVVE T0299 16 :KNKVVMAELRQELTNLGLEKVESY 1oxkB 1095 :DNHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLS 1oxkB 1119 :CDGQEAFDKVKELTSKGENYNMIFMDVQ T0299 79 :LEDFEAELENLPA 1oxkB 1153 :LLSTKMIRRDLGY T0299 99 :RKDFLFYTEGLDVDQ 1oxkB 1166 :TSPIVALTAFADDSN T0299 115 :IATVESLELK 1oxkB 1181 :IKECLESGMN T0299 139 :KFSEESYSKTAYHKYLLK 1oxkB 1191 :GFLSKPIKRPKLKTILTE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1092 Number of alignments=228 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1oxkB 1090 :ILVVEDNHVNQEVIKRMLNLEGIENIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1093 Number of alignments=229 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1093 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 17 :NKVVMAELRQELTNLGLEKVESY 1oxkB 1096 :NHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLS 1oxkB 1119 :CDGQEAFDKVKELTSKGENYNMIFMDVQ T0299 79 :LEDFEAELEN 1oxkB 1153 :LLSTKMIRRD T0299 97 :LARKDFLFYTEGLDVDQVIATVESL 1oxkB 1163 :LGYTSPIVALTAFADDSNIKECLES Number of specific fragments extracted= 4 number of extra gaps= 0 total=1097 Number of alignments=230 # 1oxkB read from 1oxkB/merged-local-a2m # found chain 1oxkB in template set T0299 5 :ALLVR 1oxkB 1090 :ILVVE T0299 16 :KNKVVMAELRQELTNLGLEKVESY 1oxkB 1095 :DNHVNQEVIKRMLNLEGIENIELA T0299 51 :DSKAQLVEKLETFFAV 1oxkB 1119 :CDGQEAFDKVKELTSK T0299 69 :PFIQSFSLLS 1oxkB 1135 :GENYNMIFMD T0299 82 :FEAELE 1oxkB 1152 :GLLSTK T0299 92 :WWSRDLARKDFLFYTEGLDVDQVIATVESLE 1oxkB 1158 :MIRRDLGYTSPIVALTAFADDSNIKECLESG Number of specific fragments extracted= 6 number of extra gaps= 0 total=1103 Number of alignments=231 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yqgA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1yqgA/merged-local-a2m # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 7 :LVRGINVGGKNKVVMAELRQELTNLGLEKV 1yqgA 15 :VAGGLVKQGGYRIYIANRGAEKRERLEKEL T0299 98 :ARKDFLFYTEGLDVDQVIATV 1yqgA 45 :GVETSATLPELHSDDVLILAV T0299 120 :SLELKDEVL 1yqgA 66 :KPQDMEAAC Number of specific fragments extracted= 3 number of extra gaps= 0 total=1106 Number of alignments=232 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 17 :NKVVMAELRQELTNLGLEKV 1yqgA 25 :YRIYIANRGAEKRERLEKEL T0299 83 :EAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESL 1yqgA 161 :TGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLAT Number of specific fragments extracted= 2 number of extra gaps= 0 total=1108 Number of alignments=233 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 30 :NLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFF 1yqgA 10 :NMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKEL T0299 167 :NAKTFDKIGQMLKK 1yqgA 45 :GVETSATLPELHSD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1110 Number of alignments=234 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 33 :LEKV 1yqgA 41 :EKEL T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVES 1yqgA 131 :SETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLA T0299 126 :EVLYFGKLGI 1yqgA 220 :NVTSKGGTTH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1113 Number of alignments=235 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVESYIN 1yqgA 27 :IYIANRGAEKRERLEKELGVETSATLPELHS T0299 43 :GNIFFTSID 1yqgA 58 :DDVLILAVK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1115 Number of alignments=236 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYIN 1yqgA 33 :GAEKRERLEKELGVETSATLPELHS T0299 43 :GNIFFTSID 1yqgA 58 :DDVLILAVK T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1yqgA 67 :PQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGT Number of specific fragments extracted= 3 number of extra gaps= 0 total=1118 Number of alignments=237 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1yqgA 41 :EKELGVETSATLPELHSDDVLILAVKPQDMEAACKNI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1119 Number of alignments=238 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 66 :VHYPFIQSFSLLSLEDFEAELENLPAWWS 1yqgA 87 :VAAGLSVGTLSRYLGGTRRIVRVMPNTPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1120 Number of alignments=239 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 57 :VEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARK 1yqgA 12 :AAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPEL T0299 101 :DFLFYT 1yqgA 59 :DVLILA T0299 109 :LDVDQVIATVESLELKD 1yqgA 65 :VKPQDMEAACKNIRTNG Number of specific fragments extracted= 3 number of extra gaps= 0 total=1123 Number of alignments=240 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 4 :YALLVRG 1yqgA 2 :NVYFLGG T0299 21 :MAELRQELTNL 1yqgA 12 :AAAVAGGLVKQ T0299 34 :EKVESYINS 1yqgA 23 :GGYRIYIAN T0299 51 :DSKAQ 1yqgA 32 :RGAEK T0299 61 :ETFFAVHYPFIQS 1yqgA 37 :RERLEKELGVETS T0299 74 :FSLLSLEDFEAELENL 1yqgA 62 :ILAVKPQDMEAACKNI T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLE 1yqgA 78 :RTNGALVLSVAAGLSVGTLSRYLGGTR T0299 126 :EVLYFGK 1yqgA 105 :RIVRVMP T0299 134 :GIFW 1yqgA 121 :VSGM T0299 140 :FSEESYSKTAYH 1yqgA 125 :YAEAEVSETDRR Number of specific fragments extracted= 10 number of extra gaps= 0 total=1133 Number of alignments=241 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1yqgA 41 :EKELGVETSATLPELHSDDVLILAVKPQDMEAACKNI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1134 Number of alignments=242 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 66 :VHYPFIQSFSLLSLEDFEAELENLPAWWS 1yqgA 87 :VAAGLSVGTLSRYLGGTRRIVRVMPNTPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1135 Number of alignments=243 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 60 :LETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARK 1yqgA 15 :VAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPEL T0299 101 :DFLFYT 1yqgA 59 :DVLILA T0299 109 :LDVDQVIATVESLELKDE 1yqgA 65 :VKPQDMEAACKNIRTNGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1138 Number of alignments=244 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 4 :YALLVRG 1yqgA 2 :NVYFLGG T0299 21 :MAELRQELTNL 1yqgA 12 :AAAVAGGLVKQ T0299 34 :EKVESYINS 1yqgA 23 :GGYRIYIAN T0299 51 :DSKAQL 1yqgA 32 :RGAEKR T0299 62 :TFFAVHYPFIQS 1yqgA 38 :ERLEKELGVETS T0299 74 :FSLLSLEDFEAELENL 1yqgA 62 :ILAVKPQDMEAACKNI T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1yqgA 78 :RTNGALVLSVAAGLSVGTLSRYLGGTRR T0299 134 :GIFW 1yqgA 121 :VSGM T0299 140 :FSEESYSKT 1yqgA 125 :YAEAEVSET T0299 149 :AYHKYLL 1yqgA 136 :RIADRIM Number of specific fragments extracted= 10 number of extra gaps= 0 total=1148 Number of alignments=245 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1yqgA 41 :EKELGVETSATLPELHSDDVLILAVKPQDMEAACKNI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1149 Number of alignments=246 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1149 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1yqgA 11 :MAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSAT T0299 97 :LARKDFLFYTEG 1yqgA 55 :LHSDDVLILAVK T0299 111 :VDQVIATVESLE 1yqgA 67 :PQDMEAACKNIR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1152 Number of alignments=247 # 1yqgA read from 1yqgA/merged-local-a2m # found chain 1yqgA in template set T0299 4 :YALLVRG 1yqgA 2 :NVYFLGG T0299 21 :MAELRQELTNL 1yqgA 12 :AAAVAGGLVKQ T0299 34 :EKVESYINS 1yqgA 23 :GGYRIYIAN T0299 51 :DSKAQ 1yqgA 32 :RGAEK T0299 61 :ETFFAVHYPFIQS 1yqgA 37 :RERLEKELGVETS T0299 74 :FSLLSLEDFEAELENL 1yqgA 62 :ILAVKPQDMEAACKNI T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1yqgA 78 :RTNGALVLSVAAGLSVGTLSRYLGGTRR Number of specific fragments extracted= 7 number of extra gaps= 0 total=1159 Number of alignments=248 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qtqA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qtqA expands to /projects/compbio/data/pdb/1qtq.pdb.gz 1qtqA:# T0299 read from 1qtqA/merged-local-a2m # 1qtqA read from 1qtqA/merged-local-a2m # adding 1qtqA to template set # found chain 1qtqA in template set T0299 103 :LFYTEGLDVDQVIATVE 1qtqA 225 :THSLCTLEFQDNRRLYD T0299 121 :LELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRH 1qtqA 249 :IPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1161 Number of alignments=249 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set Warning: unaligning (T0299)L24 because of BadResidue code BAD_PEPTIDE in next template residue (1qtqA)N397 Warning: unaligning (T0299)R25 because of BadResidue code BAD_PEPTIDE at template residue (1qtqA)N397 T0299 18 :KVVMAE 1qtqA 390 :ADFREE T0299 26 :QELTNLGLEKVESYINSGNIFFTSI 1qtqA 398 :KQYKRLVLGKEVRLRNAYVIKAERV T0299 51 :DSKAQLVEKLETFFAVHYPFIQS 1qtqA 463 :HALPVEIRLYDRLFSVPNPGAAD Number of specific fragments extracted= 3 number of extra gaps= 1 total=1164 Number of alignments=250 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set Warning: unaligning (T0299)L24 because of BadResidue code BAD_PEPTIDE in next template residue (1qtqA)N397 Warning: unaligning (T0299)R25 because of BadResidue code BAD_PEPTIDE at template residue (1qtqA)N397 T0299 19 :VVMAE 1qtqA 391 :DFREE T0299 26 :QELTNLGLEKVESYINSGNIFFTSI 1qtqA 398 :KQYKRLVLGKEVRLRNAYVIKAERV T0299 51 :DSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEA 1qtqA 463 :HALPVEIRLYDRLFSVPNPGAADDFLSVINPESL Number of specific fragments extracted= 3 number of extra gaps= 1 total=1167 Number of alignments=251 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 24 :LRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLF 1qtqA 306 :IREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSRQVPFSGEIW Number of specific fragments extracted= 1 number of extra gaps= 0 total=1168 Number of alignments=252 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set Warning: unaligning (T0299)I71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qtqA)G454 Warning: unaligning (T0299)Q72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qtqA)G454 T0299 39 :YINSGNIFFTSIDSKAQL 1qtqA 411 :LRNAYVIKAERVEKDAEG T0299 58 :EKLETFFAVHYPF 1qtqA 429 :NITTIFCTYDADT T0299 73 :SFSLLSLEDFE 1qtqA 455 :VIHWVSAAHAL T0299 87 :ENLPAWWSRDLARKDFL 1qtqA 466 :PVEIRLYDRLFSVPNPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1172 Number of alignments=253 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 142 :EESYSKTAYHKYLLK 1qtqA 231 :LEFQDNRRLYDWVLD T0299 157 :VPFYRHITI 1qtqA 252 :HPRQYEFSR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1174 Number of alignments=254 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set Warning: unaligning (T0299)I115 because of BadResidue code BAD_PEPTIDE in next template residue (1qtqA)N397 Warning: unaligning (T0299)A116 because of BadResidue code BAD_PEPTIDE at template residue (1qtqA)N397 T0299 48 :TSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFL 1qtqA 322 :IEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSR T0299 104 :FYTEGLDVDQV 1qtqA 385 :IWIDRADFREE T0299 117 :TVESLELKDEVL 1qtqA 398 :KQYKRLVLGKEV Number of specific fragments extracted= 3 number of extra gaps= 1 total=1177 Number of alignments=255 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 91 :AWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFG 1qtqA 51 :FGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1178 Number of alignments=256 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 42 :SGNIFFTSID 1qtqA 93 :SGNVRYSSDY Number of specific fragments extracted= 1 number of extra gaps= 0 total=1179 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 24 :LRQELTNLGLEKV 1qtqA 306 :IREFCKRIGVTKQ T0299 48 :TSIDSKAQLVEKLETFFAVHYPFIQSFS 1qtqA 319 :DNTIEMASLESCIREDLNENAPRAMAVI T0299 92 :WWSRDLARKDFLFYTEGLD 1qtqA 353 :IENYQGEGEMVTMPNHPNK T0299 112 :DQ 1qtqA 372 :PE T0299 124 :KDEVLYFGKLGIFWGK 1qtqA 374 :MGSRQVPFSGEIWIDR Number of specific fragments extracted= 5 number of extra gaps= 0 total=1184 Number of alignments=257 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 21 :MAELRQELTNLGLE 1qtqA 78 :VESIKNDVEWLGFH T0299 41 :NSGNIFFTS 1qtqA 92 :WSGNVRYSS T0299 51 :DSKAQLVEKLETFFAVHY 1qtqA 101 :DYFDQLHAYAIELINKGL T0299 73 :SF 1qtqA 120 :YV T0299 77 :LSLEDFEAEL 1qtqA 124 :LTPEQIREYR T0299 93 :WSRDLARKD 1qtqA 134 :GTLTQPGKN T0299 106 :TEGLDVDQVIATVESLELKD 1qtqA 145 :YRDRSVEENLALFEKMRAGG T0299 131 :GKLGIFW 1qtqA 168 :GKACLRA T0299 140 :FSE 1qtqA 175 :KID Number of specific fragments extracted= 9 number of extra gaps= 0 total=1193 Number of alignments=258 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 91 :AWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFG 1qtqA 51 :FGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1194 Number of alignments=259 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 42 :SGNIFFTSID 1qtqA 93 :SGNVRYSSDY Number of specific fragments extracted= 1 number of extra gaps= 0 total=1195 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 21 :MAELRQELTNLGLEK 1qtqA 303 :AASIREFCKRIGVTK T0299 48 :TSIDSKAQLVEKLETFFAVHYPFIQSFS 1qtqA 319 :DNTIEMASLESCIREDLNENAPRAMAVI T0299 92 :WWSRDLARKDFLFYTEGLD 1qtqA 353 :IENYQGEGEMVTMPNHPNK T0299 112 :DQ 1qtqA 372 :PE T0299 124 :KDEVLYFGKLGIFWGK 1qtqA 374 :MGSRQVPFSGEIWIDR Number of specific fragments extracted= 5 number of extra gaps= 0 total=1200 Number of alignments=260 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 21 :MAELRQELTNLGLE 1qtqA 78 :VESIKNDVEWLGFH T0299 41 :NSGNIFFTSID 1qtqA 92 :WSGNVRYSSDY T0299 53 :KAQLVEKLETFFAVHY 1qtqA 103 :FDQLHAYAIELINKGL T0299 75 :SL 1qtqA 120 :YV T0299 77 :LSLEDFEAEL 1qtqA 124 :LTPEQIREYR T0299 93 :WSRDLARKD 1qtqA 134 :GTLTQPGKN T0299 106 :TEGLDVDQVIATVESLELKD 1qtqA 145 :YRDRSVEENLALFEKMRAGG T0299 131 :GKLGIFWG 1qtqA 168 :GKACLRAK T0299 141 :S 1qtqA 176 :I Number of specific fragments extracted= 9 number of extra gaps= 0 total=1209 Number of alignments=261 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 91 :AWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFG 1qtqA 51 :FGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1210 Number of alignments=262 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 27 :ELTNLGLE 1qtqA 84 :DVEWLGFH T0299 41 :NSGNIFFTSID 1qtqA 92 :WSGNVRYSSDY Number of specific fragments extracted= 2 number of extra gaps= 0 total=1212 Number of alignments=263 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set Warning: unaligning (T0299)T148 because of BadResidue code BAD_PEPTIDE in next template residue (1qtqA)N397 Warning: unaligning (T0299)A149 because of BadResidue code BAD_PEPTIDE at template residue (1qtqA)N397 T0299 21 :MAELRQELTNLGLEK 1qtqA 303 :AASIREFCKRIGVTK T0299 48 :TSI 1qtqA 319 :DNT T0299 52 :SKAQLVEKLETFFAVHYPF 1qtqA 323 :EMASLESCIREDLNENAPR T0299 73 :SFSLLS 1qtqA 342 :AMAVID T0299 92 :WWSRDLARKDFLFYTEGLDVDQ 1qtqA 352 :VIENYQGEGEMVTMPNHPNKPE T0299 123 :LKDEVLYFGKL 1qtqA 374 :MGSRQVPFSGE T0299 135 :IFW 1qtqA 385 :IWI T0299 140 :FSEESYSK 1qtqA 388 :DRADFREE T0299 152 :KYLLKVPFYRHITIRN 1qtqA 398 :KQYKRLVLGKEVRLRN Number of specific fragments extracted= 9 number of extra gaps= 1 total=1221 Number of alignments=264 # 1qtqA read from 1qtqA/merged-local-a2m # found chain 1qtqA in template set T0299 22 :AELRQELTNLGLE 1qtqA 79 :ESIKNDVEWLGFH T0299 41 :NSGNIFFTSID 1qtqA 92 :WSGNVRYSSDY T0299 53 :KAQLVEKLETFFAVHY 1qtqA 103 :FDQLHAYAIELINKGL T0299 71 :IQS 1qtqA 119 :AYV T0299 77 :LSLEDFEAEL 1qtqA 124 :LTPEQIREYR T0299 93 :WSRDLARKD 1qtqA 134 :GTLTQPGKN T0299 107 :EGLDVDQVIATVESLELKD 1qtqA 146 :RDRSVEENLALFEKMRAGG T0299 131 :GKLGIFW 1qtqA 167 :EGKACLR T0299 139 :KFSEE 1qtqA 174 :AKIDM Number of specific fragments extracted= 9 number of extra gaps= 0 total=1230 Number of alignments=265 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1k68A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1k68A/merged-local-a2m # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set T0299 33 :LEKVESYINSGNIFFTSIDSKAQLVEKLE 1k68A 85 :IKSDPTLKRIPVVVLSTSINEDDIFHSYD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1231 Number of alignments=266 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1231 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set T0299 45 :IFFTSIDSKAQLVEKLE 1k68A 97 :VVLSTSINEDDIFHSYD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1232 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1232 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 61 :ETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 37 :HEVVTVRDGMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1k68A 72 :NLPKKDGREVLAEIKSDPTLKRIPVVVL T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYH 1k68A 103 :INEDDIFHSYDLHVNCYITKSANLSQLF Number of specific fragments extracted= 3 number of extra gaps= 0 total=1235 Number of alignments=267 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 62 :TFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 38 :EVVTVRDGMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1k68A 72 :NLPKKDGREVLAEIKSDPTLKRIPVVVL T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYHK 1k68A 103 :INEDDIFHSYDLHVNCYITKSANLSQLFQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1238 Number of alignments=268 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1k68A 18 :DNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYAN T0299 95 :RDLARKDFLFYTEGLDVDQVIATVES 1k68A 89 :PTLKRIPVVVLSTSINEDDIFHSYDL T0299 158 :PFYRHI 1k68A 115 :HVNCYI Number of specific fragments extracted= 3 number of extra gaps= 0 total=1241 Number of alignments=269 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set T0299 2 :TRYALLVR 1k68A 10 :HKKIFLVE T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1k68A 18 :DNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYAN T0299 95 :RDLARKDFLFYTEGLD 1k68A 89 :PTLKRIPVVVLSTSIN T0299 112 :DQVIATVESLEL 1k68A 105 :EDDIFHSYDLHV T0299 138 :GKFSEESYSKTAYHKYLL 1k68A 117 :NCYITKSANLSQLFQIVK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1246 Number of alignments=270 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 61 :ETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 37 :HEVVTVRDGMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1k68A 72 :NLPKKDGREVLAEIKSDPTLKRIPVVVL T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYH 1k68A 103 :INEDDIFHSYDLHVNCYITKSANLSQLF Number of specific fragments extracted= 3 number of extra gaps= 0 total=1249 Number of alignments=271 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 62 :TFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 38 :EVVTVRDGMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQVIATVESLEL 1k68A 72 :NLPKKDGREVLAEIKSDPTLKRIPVVVL T0299 124 :KDEVLYFGKLGIFWGKFSEESYSKTAYHK 1k68A 103 :INEDDIFHSYDLHVNCYITKSANLSQLFQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1252 Number of alignments=272 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)E107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1k68A 18 :DNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYAN T0299 97 :LARKDFLF 1k68A 61 :ASRPDLIL T0299 108 :GLDV 1k68A 72 :NLPK T0299 112 :DQVIATVESLELKDEV 1k68A 79 :REVLAEIKSDPTLKRI T0299 133 :LGIFWGKF 1k68A 95 :PVVVLSTS T0299 145 :YSKTAYHK 1k68A 103 :INEDDIFH T0299 154 :LLKVPFYRHIT 1k68A 111 :SYDLHVNCYIT Number of specific fragments extracted= 7 number of extra gaps= 0 total=1259 Number of alignments=273 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set T0299 2 :TRYALLVR 1k68A 10 :HKKIFLVE T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWS 1k68A 18 :DNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYAN T0299 95 :RDLARKDFLFYTEGLDVDQ 1k68A 89 :PTLKRIPVVVLSTSINEDD T0299 115 :IATVESLEL 1k68A 108 :IFHSYDLHV T0299 138 :GKFSEESYSKTAYHKYLL 1k68A 117 :NCYITKSANLSQLFQIVK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1264 Number of alignments=274 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 61 :ETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 37 :HEVVTVRDGMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQ 1k68A 72 :NLPKKDGREVLAEIKSDP T0299 114 :VIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHIT 1k68A 95 :PVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQIVKGIEEFWLSTAT Number of specific fragments extracted= 3 number of extra gaps= 0 total=1267 Number of alignments=275 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)W93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 69 :PFIQSFSLLSLEDFEAELENLPAW 1k68A 45 :GMEAMAYLRQEGEYANASRPDLIL T0299 96 :DLARKDFLFYTEGLDVDQ 1k68A 72 :NLPKKDGREVLAEIKSDP T0299 114 :VIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVP 1k68A 95 :PVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQIVKGIEEF Number of specific fragments extracted= 3 number of extra gaps= 0 total=1270 Number of alignments=276 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)E107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 54 :AQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1k68A 20 :KADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQE T0299 92 :WWSRDLARKDFLF 1k68A 56 :GEYANASRPDLIL T0299 108 :GLDVDQVIATVESLELKD 1k68A 72 :NLPKKDGREVLAEIKSDP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1273 Number of alignments=277 # 1k68A read from 1k68A/merged-local-a2m # found chain 1k68A in template set Warning: unaligning (T0299)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1k68A)L71 Warning: unaligning (T0299)E107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1k68A)L71 T0299 46 :FFT 1k68A 14 :FLV T0299 50 :IDS 1k68A 17 :EDN T0299 54 :AQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1k68A 20 :KADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEY T0299 95 :RDLARKDFLF 1k68A 59 :ANASRPDLIL T0299 108 :GLDVDQVIATVESLELKD 1k68A 72 :NLPKKDGREVLAEIKSDP Number of specific fragments extracted= 5 number of extra gaps= 0 total=1278 Number of alignments=278 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jysA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1jysA/merged-local-a2m # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1jysA 122 :DDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1279 Number of alignments=279 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 19 :VVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLE 1jysA 124 :KLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1280 Number of alignments=280 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1jysA 122 :DDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1281 Number of alignments=281 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 19 :VVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLE 1jysA 124 :KLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1282 Number of alignments=282 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 17 :NKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1jysA 122 :DDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1283 Number of alignments=283 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLET 1jysA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=1284 Number of alignments=284 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1285 Number of alignments=285 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=1286 Number of alignments=286 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set Warning: unaligning (T0299)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jysA)S206 T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1jysA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 70 :FIQSFSLL 1jysA 165 :FPQAIAVE T0299 85 :E 1jysA 181 :V T0299 92 :WWSRDLARKDFLFYTE 1jysA 182 :CHNFNVPFVVVRAISD T0299 111 :VDQVIATV 1jysA 207 :FDEFLAVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1291 Number of alignments=287 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set Warning: unaligning (T0299)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jysA)S206 T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1jysA 126 :IAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 68 :YP 1jysA 165 :FP T0299 71 :IQSFSLLSLEDFEAELEN 1jysA 167 :QAIAVEMEATAIAHVCHN T0299 95 :RDLARKDFLFYTE 1jysA 185 :FNVPFVVVRAISD T0299 111 :VDQVIATVES 1jysA 207 :FDEFLAVAAK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1296 Number of alignments=288 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1297 Number of alignments=289 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=1298 Number of alignments=290 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set Warning: unaligning (T0299)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jysA)S206 T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVE 1jysA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH T0299 67 :H 1jysA 164 :N T0299 70 :FIQSFSLL 1jysA 165 :FPQAIAVE T0299 92 :WWSRDLARKDFLFYTE 1jysA 182 :CHNFNVPFVVVRAISD T0299 111 :VDQVIATV 1jysA 207 :FDEFLAVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1303 Number of alignments=291 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set Warning: unaligning (T0299)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jysA)S206 T0299 21 :MAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1jysA 126 :IAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 68 :YPF 1jysA 165 :FPQ T0299 72 :QSFSLLSLEDFEAEL 1jysA 168 :AIAVEMEATAIAHVC T0299 93 :WSRDLARKDFLFYTE 1jysA 183 :HNFNVPFVVVRAISD T0299 111 :VDQVIATVES 1jysA 207 :FDEFLAVAAK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1308 Number of alignments=292 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLS 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1309 Number of alignments=293 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLL 1jysA 130 :EACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVC Number of specific fragments extracted= 1 number of extra gaps= 0 total=1310 Number of alignments=294 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1jysA 127 :AAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHN T0299 70 :FIQSFSLL 1jysA 165 :FPQAIAVE T0299 78 :SLEDFEAELE 1jysA 174 :EATAIAHVCH T0299 96 :DLARKDFLFYTEG 1jysA 184 :NFNVPFVVVRAIS Number of specific fragments extracted= 4 number of extra gaps= 0 total=1314 Number of alignments=295 # 1jysA read from 1jysA/merged-local-a2m # found chain 1jysA in template set T0299 21 :MAELRQELTNLGLEKVESYINSGN 1jysA 126 :IAAAEACIAELNLNAVRGLIVSGD T0299 50 :ID 1jysA 150 :AF T0299 52 :SKAQ 1jysA 154 :GSVG T0299 57 :VEKLETF 1jysA 158 :LAKIRHN T0299 68 :YP 1jysA 165 :FP T0299 71 :IQSFSLLSLEDFEAELENL 1jysA 167 :QAIAVEMEATAIAHVCHNF Number of specific fragments extracted= 6 number of extra gaps= 0 total=1320 Number of alignments=296 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1wdjA/merged-local-a2m # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 146 :SKTAYHKYLLKVPFYRHITIRNAKTFDKIGQML 1wdjA 120 :ASQDPEELRAKMGIYLRNGVLLGVLVDPYARAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1321 Number of alignments=297 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 125 :DEVLYFGKLGIFWGKFSEESY 1wdjA 86 :DAAFVERGAWEALSEAEREGF T0299 146 :SKTAYHKYLLKVPFYRHITIRNAKTFDKIG 1wdjA 120 :ASQDPEELRAKMGIYLRNGVLLGVLVDPYA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1323 Number of alignments=298 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 148 :TAYHKYLLKVPFYRHITIRNAKTFDKIGQML 1wdjA 122 :QDPEELRAKMGIYLRNGVLLGVLVDPYARAV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1324 Number of alignments=299 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 125 :DEVLYFGKLGIFWGKFSEESY 1wdjA 86 :DAAFVERGAWEALSEAEREGF T0299 146 :S 1wdjA 119 :S T0299 147 :KTAYHKYLLKVPFYRHITIRNAKTFDKI 1wdjA 121 :SQDPEELRAKMGIYLRNGVLLGVLVDPY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1327 Number of alignments=300 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 34 :EKVESYINSGNIFFTSIDSKAQLVE 1wdjA 129 :AKMGIYLRNGVLLGVLVDPYARAVE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1328 Number of alignments=301 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1328 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 101 :DFLFYTEGLDVDQ 1wdjA 3 :LVLDLARPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1330 Number of alignments=302 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 106 :TEGLDVDQ 1wdjA 8 :ARPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1332 Number of alignments=303 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 107 :EGLDVDQ 1wdjA 9 :RPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRS T0299 168 :AKTFDKIGQML 1wdjA 50 :LQLAYQLARWN Number of specific fragments extracted= 3 number of extra gaps= 0 total=1335 Number of alignments=304 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 16 :KNKVVMAELRQELTNLG 1wdjA 8 :ARPVSEEELRRLSELNP T0299 43 :GNIFFTSIDSK 1wdjA 34 :GRLWVSPTGGE T0299 54 :AQLVEKLETFFAVH 1wdjA 50 :LQLAYQLARWNEER T0299 68 :YP 1wdjA 77 :FP T0299 71 :IQSFSLLSLEDFE 1wdjA 84 :SPDAAFVERGAWE T0299 84 :AELENLPAW 1wdjA 101 :AEREGFPPL T0299 97 :LARKDFLFYTEGLDVDQVIATVESLEL 1wdjA 110 :APKAVFEVRSASQDPEELRAKMGIYLR T0299 127 :VLYFGKLGIFW 1wdjA 144 :LVDPYARAVEV T0299 140 :FSEESY 1wdjA 155 :FRPGKP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1344 Number of alignments=305 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 101 :DFLFYTEGLDVDQ 1wdjA 3 :LVLDLARPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1346 Number of alignments=306 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 106 :TEGLDVDQ 1wdjA 8 :ARPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKT 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1348 Number of alignments=307 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 107 :EGLDVDQ 1wdjA 9 :RPVSEEE T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHK 1wdjA 16 :LRRLSELNPGYQWERSPEGRLWVSPTGGESGRRSLQLA T0299 172 :DK 1wdjA 54 :YQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1351 Number of alignments=308 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 16 :KNKVVMAELRQELTNLG 1wdjA 8 :ARPVSEEELRRLSELNP T0299 43 :GNIFFT 1wdjA 34 :GRLWVS T0299 49 :SIDSK 1wdjA 41 :TGGES T0299 54 :AQLVEKLETFFAVH 1wdjA 50 :LQLAYQLARWNEER T0299 68 :YP 1wdjA 77 :FP T0299 71 :IQSFSLLSLED 1wdjA 84 :SPDAAFVERGA T0299 86 :LENLPAWWS 1wdjA 95 :WEALSEAER T0299 95 :RDLARKDFLFYTEGLDVDQVIATVESL 1wdjA 108 :PLAPKAVFEVRSASQDPEELRAKMGIY T0299 122 :ELK 1wdjA 136 :RNG T0299 127 :VLYFGKLGIFW 1wdjA 144 :LVDPYARAVEV T0299 140 :FSEESY 1wdjA 155 :FRPGKP Number of specific fragments extracted= 11 number of extra gaps= 0 total=1362 Number of alignments=309 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 106 :TEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1wdjA 7 :LARPVSEEELRRLSELNPGYQWERSPEGRLWVSPTGGESGRRSL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1363 Number of alignments=310 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 107 :EGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTA 1wdjA 8 :ARPVSEEELRRLSELNPGYQWERSPEGRLWVSPTGGESGRRSL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1364 Number of alignments=311 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 108 :GLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYS 1wdjA 9 :RPVSEEELRRLSELNPGYQWERSPEGRLWVSPTGGESGR T0299 166 :RNAKTFDKIGQM 1wdjA 48 :RSLQLAYQLARW Number of specific fragments extracted= 2 number of extra gaps= 0 total=1366 Number of alignments=312 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0299 16 :KNKVVMAELRQELTNLG 1wdjA 8 :ARPVSEEELRRLSELNP T0299 43 :GNIFFTSID 1wdjA 34 :GRLWVSPTG T0299 54 :AQLVEKLETFFAVH 1wdjA 50 :LQLAYQLARWNEER T0299 68 :YP 1wdjA 77 :FP T0299 71 :IQSFSLLSLE 1wdjA 84 :SPDAAFVERG T0299 85 :ELENLPAWWSRDLARKD 1wdjA 94 :AWEALSEAEREGFPPLA T0299 102 :FLFYTE 1wdjA 113 :AVFEVR T0299 108 :GLDVDQVIATVESLELKD 1wdjA 121 :SQDPEELRAKMGIYLRNG T0299 126 :EVLYFGKLGIFWGKFSEESYS 1wdjA 143 :VLVDPYARAVEVFRPGKPPLR Number of specific fragments extracted= 9 number of extra gaps= 0 total=1375 Number of alignments=313 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ccwA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ccwA/merged-local-a2m # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)G43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 20 :VMAELRQELTNLGLEKVESYINS 1ccwA 70 :DCKGLRQKCDEAGLEGILLYVGG T0299 46 :FFTSIDSKAQLVEKLETFFAVHYPF 1ccwA 95 :VVGKQHWPDVEKRFKDMGYDRVYAP Number of specific fragments extracted= 2 number of extra gaps= 1 total=1377 Number of alignments=314 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 T0299 15 :G 1ccwA 2 :E T0299 18 :KVVMAELRQELTNLGLEKVESYINS 1ccwA 5 :TIVLGVIGSDCHAVGNKILDHAFTN Number of specific fragments extracted= 2 number of extra gaps= 1 total=1379 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 T0299 15 :G 1ccwA 2 :E T0299 18 :KVVMAELRQELTNLGLEKVESYINSGNI 1ccwA 5 :TIVLGVIGSDCHAVGNKILDHAFTNAGF Number of specific fragments extracted= 2 number of extra gaps= 1 total=1381 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 T0299 15 :G 1ccwA 2 :E T0299 18 :KVVMAELRQELTNLGLEKVESYINSGNI 1ccwA 5 :TIVLGVIGSDCHAVGNKILDHAFTNAGF Number of specific fragments extracted= 2 number of extra gaps= 1 total=1383 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 T0299 18 :KVVMAELRQELTNLGLEKVESYINSGN 1ccwA 5 :TIVLGVIGSDCHAVGNKILDHAFTNAG Number of specific fragments extracted= 1 number of extra gaps= 1 total=1384 Number of alignments=315 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 T0299 15 :G 1ccwA 2 :E T0299 18 :KVVMAELRQELTNLGLEKVESYINS 1ccwA 5 :TIVLGVIGSDCHAVGNKILDHAFTN Number of specific fragments extracted= 2 number of extra gaps= 1 total=1386 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set T0299 16 :KNKVVMAELRQELTNLGLEKVESYI 1ccwA 66 :QGEIDCKGLRQKCDEAGLEGILLYV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1387 Number of alignments=316 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 15 :GKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 65 :GQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFT 1ccwA 95 :VVG Number of specific fragments extracted= 3 number of extra gaps= 1 total=1390 Number of alignments=317 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 15 :GKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 65 :GQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFTSID 1ccwA 95 :VVGKQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1393 Number of alignments=318 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 5 :ALLVRG 1ccwA 57 :AILVSS T0299 13 :VGGKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 63 :LYGQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFT 1ccwA 95 :VVG T0299 50 :IDSKAQLVEKLET 1ccwA 98 :KQHWPDVEKRFKD T0299 68 :YPFI 1ccwA 111 :MGYD T0299 103 :LFYTEGLDVDQVIATVESLEL 1ccwA 115 :RVYAPGTPPEVGIADLKKDLN Number of specific fragments extracted= 7 number of extra gaps= 1 total=1400 Number of alignments=319 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)T2 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)Q72 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 Warning: unaligning (T0299)E107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGL 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGF T0299 35 :KVESY 1ccwA 33 :NVVNI T0299 40 :IN 1ccwA 39 :VL T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 73 :SFSLLS 1ccwA 57 :AILVSS T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFYT 1ccwA 82 :GLEGILLYVGG T0299 108 :GLDVDQVIATVESLEL 1ccwA 98 :KQHWPDVEKRFKDMGY T0299 138 :GKFSEESYSKTAYHKYLLK 1ccwA 114 :DRVYAPGTPPEVGIADLKK Number of specific fragments extracted= 11 number of extra gaps= 3 total=1411 Number of alignments=320 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 15 :GKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 65 :GQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFT 1ccwA 95 :VVG Number of specific fragments extracted= 3 number of extra gaps= 1 total=1414 Number of alignments=321 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 15 :GKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 65 :GQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFTSID 1ccwA 95 :VVGKQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1417 Number of alignments=322 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 5 :ALLVRG 1ccwA 57 :AILVSS T0299 13 :VGGKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 63 :LYGQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFT 1ccwA 95 :VVG T0299 50 :IDSKAQLVEKLET 1ccwA 98 :KQHWPDVEKRFKD T0299 68 :YPFI 1ccwA 111 :MGYD T0299 103 :LFYTEGLDVDQVIATVESL 1ccwA 115 :RVYAPGTPPEVGIADLKKD Number of specific fragments extracted= 7 number of extra gaps= 1 total=1424 Number of alignments=323 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)T2 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)K4 Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)I71 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGLE 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGFN T0299 36 :VESY 1ccwA 34 :VVNI T0299 44 :N 1ccwA 39 :V T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 72 :QSFSLLS 1ccwA 57 :AILVSSL T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFY 1ccwA 82 :GLEGILLYVG T0299 106 :TEGLDVDQVIATVESLEL 1ccwA 96 :VGKQHWPDVEKRFKDMGY T0299 138 :GKFSEESYSKTAYHKYLLKV 1ccwA 114 :DRVYAPGTPPEVGIADLKKD Number of specific fragments extracted= 11 number of extra gaps= 2 total=1435 Number of alignments=324 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 15 :GKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 65 :GQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFT 1ccwA 95 :VVG Number of specific fragments extracted= 3 number of extra gaps= 1 total=1438 Number of alignments=325 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)N44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)I45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 14 :GGKNKVVMAELRQELTNLGLEKVESYIN 1ccwA 64 :YGQGEIDCKGLRQKCDEAGLEGILLYVG T0299 43 :G 1ccwA 92 :G T0299 46 :FFTSID 1ccwA 95 :VVGKQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1441 Number of alignments=326 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)Q72 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 Warning: unaligning (T0299)G108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 Warning: unaligning (T0299)L109 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ccwA)I94 T0299 7 :LVRGINVGGKNKVVMAELRQELTNLGLEKVESYINS 1ccwA 6 :IVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLS T0299 50 :I 1ccwA 42 :P T0299 57 :VEKLETFFAVHY 1ccwA 43 :QELFIKAAIETK T0299 73 :SFSLLS 1ccwA 57 :AILVSS T0299 79 :LEDFEAELENLPAWWSRDLARKDFLFYTE 1ccwA 64 :YGQGEIDCKGLRQKCDEAGLEGILLYVGG T0299 110 :DVD 1ccwA 95 :VVG T0299 113 :QVIATVESL 1ccwA 99 :QHWPDVEKR T0299 122 :ELKDEV 1ccwA 110 :DMGYDR Number of specific fragments extracted= 8 number of extra gaps= 2 total=1449 Number of alignments=327 # 1ccwA read from 1ccwA/merged-local-a2m # found chain 1ccwA in training set Warning: unaligning (T0299)R3 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)K4 Warning: unaligning (T0299)F70 because of BadResidue code BAD_PEPTIDE in next template residue (1ccwA)D56 Warning: unaligning (T0299)Q72 because of BadResidue code BAD_PEPTIDE at template residue (1ccwA)D56 Warning: unaligning (T0299)E107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ccwA)I94 T0299 4 :YALL 1ccwA 5 :TIVL T0299 10 :GINVGGKNKVVMAELRQELTNLGL 1ccwA 9 :GVIGSDCHAVGNKILDHAFTNAGF T0299 35 :KVESY 1ccwA 33 :NVVNI T0299 52 :SKAQLVEKLETF 1ccwA 42 :PQELFIKAAIET T0299 69 :P 1ccwA 54 :K T0299 73 :SFSLLS 1ccwA 57 :AILVSS T0299 82 :FEAELENL 1ccwA 74 :LRQKCDEA T0299 96 :DLARKDFLFYT 1ccwA 82 :GLEGILLYVGG T0299 108 :GLDVDQVIATVESLELKD 1ccwA 98 :KQHWPDVEKRFKDMGYDR T0299 140 :FSEESYSKTA 1ccwA 116 :VYAPGTPPEV T0299 170 :TFDKIGQMLKK 1ccwA 126 :GIADLKKDLNI Number of specific fragments extracted= 11 number of extra gaps= 3 total=1460 Number of alignments=328 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u5tB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u5tB expands to /projects/compbio/data/pdb/1u5t.pdb.gz 1u5tB:# T0299 read from 1u5tB/merged-local-a2m # 1u5tB read from 1u5tB/merged-local-a2m # adding 1u5tB to template set # found chain 1u5tB in template set T0299 74 :FSLLSLEDFEAELENLPAWWSRDLARKDF 1u5tB 452 :TGLISPMEMREACERFEHLGLNELKLVKV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1461 Number of alignments=329 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)E122 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)L123 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 23 :ELRQELTNLGLEKVESYINSGNIF 1u5tB 410 :EIAREIYEFTLSEFKDLNSDTNYM T0299 57 :VEKLETFFAVHYPFIQ 1u5tB 434 :IITLVDLYAMYNKSMR T0299 73 :SFSLLSLEDFEAELENLPAWWSRDLARKDF 1u5tB 451 :GTGLISPMEMREACERFEHLGLNELKLVKV T0299 103 :LFYTEGLD 1u5tB 486 :CVTSEKFD T0299 111 :VDQVIATVESL 1u5tB 495 :VKEKLVDLIGD T0299 124 :KDEVLYFG 1u5tB 508 :GSDLLRLT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1467 Number of alignments=330 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)E122 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)L123 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 74 :FSLLSLEDFEAELENLPAWWSRDLARKDF 1u5tB 452 :TGLISPMEMREACERFEHLGLNELKLVKV T0299 103 :LFYTEGLDVDQVIATVESL 1u5tB 487 :VTSEKFDVVKEKLVDLIGD T0299 124 :KDEVLYFG 1u5tB 508 :GSDLLRLT Number of specific fragments extracted= 3 number of extra gaps= 1 total=1470 Number of alignments=331 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)E122 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)L123 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 61 :ETFFAVHYPFIQ 1u5tB 438 :VDLYAMYNKSMR T0299 73 :SFSLLSLEDFEAELENLPAWWSRDLARKDF 1u5tB 451 :GTGLISPMEMREACERFEHLGLNELKLVKV T0299 103 :LFYTEGLDV 1u5tB 486 :CVTSEKFDV T0299 112 :DQVIATVESL 1u5tB 496 :KEKLVDLIGD T0299 124 :KDEVLYF 1u5tB 508 :GSDLLRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=1475 Number of alignments=332 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 118 :VESLELKDEVLYFGKLGI 1u5tB 455 :ISPMEMREACERFEHLGL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1476 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 76 :LLSLEDFEAE 1u5tB 486 :CVTSEKFDVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1477 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1u5tB 450 :IGTGLISPMEMREACERFEHLGLNELK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1478 Number of alignments=333 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)P90 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 16 :KNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1u5tB 455 :ISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEK T0299 82 :FEAELEN 1u5tB 499 :LVDLIGD Number of specific fragments extracted= 2 number of extra gaps= 1 total=1480 Number of alignments=334 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)P158 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 49 :SIDSKAQLVEKLETFFAVHY 1u5tB 404 :KELFLDEIAREIYEFTLSEF T0299 69 :PFIQSFSLLSLEDFEAELENLPAW 1u5tB 427 :NSDTNYMIITLVDLYAMYNKSMRI T0299 94 :SRDL 1u5tB 451 :GTGL T0299 106 :TEGLDVDQVIATVESLEL 1u5tB 455 :ISPMEMREACERFEHLGL T0299 124 :KDEVLYFGKLGIFWG 1u5tB 474 :ELKLVKVNKRILCVT T0299 140 :FSEESYSKTAYHKYLLK 1u5tB 489 :SEKFDVVKEKLVDLIGD T0299 159 :FYR 1u5tB 508 :GSD T0299 171 :FDKIGQMLK 1u5tB 511 :LLRLTQILS Number of specific fragments extracted= 8 number of extra gaps= 1 total=1488 Number of alignments=335 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)H67 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)Y68 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 15 :GKNKVVMAELRQELTNL 1u5tB 451 :GTGLISPMEMREACERF T0299 32 :GLEKVESY 1u5tB 471 :GLNELKLV T0299 45 :IFFTSIDSKAQLVEKLETFFAV 1u5tB 484 :ILCVTSEKFDVVKEKLVDLIGD T0299 69 :PF 1u5tB 508 :GS T0299 78 :SLEDFEAELE 1u5tB 510 :DLLRLTQILS T0299 156 :KVPFYRHIT 1u5tB 520 :SNNSKSNWT T0299 168 :AKTFDKIGQML 1u5tB 529 :LGILMEVLQNC Number of specific fragments extracted= 7 number of extra gaps= 1 total=1495 Number of alignments=336 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1u5tB 450 :IGTGLISPMEMREACERFEHLGLNELK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1496 Number of alignments=337 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)P90 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 16 :KNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEK 1u5tB 455 :ISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEK T0299 82 :FEAELEN 1u5tB 499 :LVDLIGD Number of specific fragments extracted= 2 number of extra gaps= 1 total=1498 Number of alignments=338 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)P158 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 49 :SIDSKAQLVEKLETFFAVHY 1u5tB 404 :KELFLDEIAREIYEFTLSEF T0299 69 :PFIQSFSLLSLEDFEAELENLPA 1u5tB 427 :NSDTNYMIITLVDLYAMYNKSMR T0299 93 :WSRDL 1u5tB 450 :IGTGL T0299 106 :TEGLDVDQVIATVESLEL 1u5tB 455 :ISPMEMREACERFEHLGL T0299 124 :KDEVLYFGKLGIFWG 1u5tB 474 :ELKLVKVNKRILCVT T0299 140 :FSEESYSKTAYHKYLLK 1u5tB 489 :SEKFDVVKEKLVDLIGD T0299 159 :FYR 1u5tB 508 :GSD T0299 171 :FDKIGQMLK 1u5tB 511 :LLRLTQILS Number of specific fragments extracted= 8 number of extra gaps= 1 total=1506 Number of alignments=339 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 49 :SIDSKAQLVEKLETFFAVHY 1u5tB 404 :KELFLDEIAREIYEFTLSEF T0299 69 :PFIQSFSLLSLEDFEAELENLPA 1u5tB 427 :NSDTNYMIITLVDLYAMYNKSMR T0299 95 :RD 1u5tB 450 :IG T0299 106 :TEGLDVDQVIA 1u5tB 452 :TGLISPMEMRE T0299 117 :TVESLELKDEVLYFGK 1u5tB 466 :RFEHLGLNELKLVKVN T0299 133 :LGIFWGKFSE 1u5tB 484 :ILCVTSEKFD T0299 144 :SYSKTAYHKYLLKVPFYRHIT 1u5tB 508 :GSDLLRLTQILSSNNSKSNWT T0299 168 :AKTFDKIGQML 1u5tB 529 :LGILMEVLQNC Number of specific fragments extracted= 8 number of extra gaps= 0 total=1514 Number of alignments=340 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set T0299 11 :INVGGKNKVVMAELRQELTNLGLEKVE 1u5tB 450 :IGTGLISPMEMREACERFEHLGLNELK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1515 Number of alignments=341 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)H67 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)Y68 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 19 :VVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1u5tB 458 :MEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGD T0299 69 :PF 1u5tB 508 :GS Number of specific fragments extracted= 2 number of extra gaps= 1 total=1517 Number of alignments=342 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)H67 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)Y68 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 15 :GKNKVVMAELRQELTNL 1u5tB 451 :GTGLISPMEMREACERF T0299 32 :GLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1u5tB 471 :GLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGD T0299 69 :PF 1u5tB 508 :GS T0299 78 :SLEDFEAELENL 1u5tB 510 :DLLRLTQILSSN Number of specific fragments extracted= 4 number of extra gaps= 1 total=1521 Number of alignments=343 # 1u5tB read from 1u5tB/merged-local-a2m # found chain 1u5tB in template set Warning: unaligning (T0299)H67 because of BadResidue code BAD_PEPTIDE in next template residue (1u5tB)P507 Warning: unaligning (T0299)Y68 because of BadResidue code BAD_PEPTIDE at template residue (1u5tB)P507 T0299 15 :GKNKVVMAELRQELTNL 1u5tB 451 :GTGLISPMEMREACERF T0299 32 :GLEKVESYINSG 1u5tB 471 :GLNELKLVKVNK T0299 45 :IFFTSIDSKAQLVEKLETFFAV 1u5tB 484 :ILCVTSEKFDVVKEKLVDLIGD T0299 69 :PF 1u5tB 508 :GS T0299 78 :SLEDFEAELENLPAW 1u5tB 510 :DLLRLTQILSSNNSK T0299 108 :GLDVDQVIATVESL 1u5tB 525 :SNWTLGILMEVLQN T0299 122 :ELKDEVLYFGKLGIFWGKFSEES 1u5tB 541 :DEGDLLIDKQLSGIYYYKNSYWP Number of specific fragments extracted= 7 number of extra gaps= 1 total=1528 Number of alignments=344 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ispA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1ispA/merged-local-a2m # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 10 :GINVGGKNKVVMAEL 1ispA 75 :AHSMGGANTLYYIKN T0299 25 :RQE 1ispA 92 :GGN T0299 35 :KVESYINSGNIF 1ispA 95 :KVANVVTLGGAN T0299 65 :AVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEV 1ispA 107 :RLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1532 Number of alignments=345 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 13 :VGGKNKVVMAEL 1ispA 78 :MGGANTLYYIKN T0299 25 :RQE 1ispA 92 :GGN T0299 35 :KVESYINSGNIF 1ispA 95 :KVANVVTLGGAN T0299 89 :LPAWWSRDLARKDFLFYTEGLDVDQVI 1ispA 131 :SADMIVMNYLSRLDGARNVQIHGVGHI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1536 Number of alignments=346 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGIN 1ispA 99 :VVTLGGAN T0299 149 :AYHKYLLKVPFYRHITIR 1ispA 107 :RLTTGKALPGTDPNQKIL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1538 Number of alignments=347 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1538 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 6 :LLVRGINVGGKNKV 1ispA 7 :VMVHGIGGASFNFA T0299 173 :KIGQMLKK 1ispA 21 :GIKSYLVS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1540 Number of alignments=348 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1540 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 33 :LEKVESYINS 1ispA 19 :FAGIKSYLVS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1542 Number of alignments=349 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1542 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSIDSK 1ispA 39 :VDFWDKTGT T0299 54 :AQLVEKLETFFAVHYPFIQSFSLL 1ispA 53 :PVLSRFVQKVLDETGAKKVDIVAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=1546 Number of alignments=350 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGI 1ispA 6 :VVMVHGI T0299 14 :GGKN 1ispA 13 :GGAS T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1ispA 39 :VDFWDKT T0299 52 :SK 1ispA 47 :TN T0299 54 :AQLVEKLETFFAVHYPFIQSFSLLSL 1ispA 53 :PVLSRFVQKVLDETGAKKVDIVAHSM T0299 82 :FEAELENLPAWWS 1ispA 83 :TLYYIKNLDGGNK T0299 101 :DFLFY 1ispA 98 :NVVTL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1554 Number of alignments=351 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 33 :LEKVESYINS 1ispA 19 :FAGIKSYLVS Number of specific fragments extracted= 2 number of extra gaps= 0 total=1556 Number of alignments=352 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1556 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSIDSK 1ispA 39 :VDFWDKTGT T0299 54 :AQLVEKLETFFAVHYPFIQSFSLL 1ispA 53 :PVLSRFVQKVLDETGAKKVDIVAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=1560 Number of alignments=353 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1ispA 39 :VDFWDKT T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLLSL 1ispA 52 :GPVLSRFVQKVLDETGAKKVDIVAHSM T0299 85 :ELENLPAWWS 1ispA 86 :YIKNLDGGNK T0299 95 :RDLARKDFLFYTEG 1ispA 118 :DPNQKILYTSIYSS T0299 109 :LDVDQ 1ispA 136 :VMNYL T0299 121 :LELKDEVL 1ispA 141 :SRLDGARN T0299 140 :FSEESYSKTAYHK 1ispA 149 :VQIHGVGHIGLLY T0299 167 :NAKTFDKIGQMLK 1ispA 162 :SSQVNSLIKEGLN Number of specific fragments extracted= 10 number of extra gaps= 0 total=1570 Number of alignments=354 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Warning: unaligning (T0299)N17 because of BadResidue code BAD_PEPTIDE in next template residue (1ispA)T180 T0299 10 :GINVGGK 1ispA 172 :GLNGGGQ Number of specific fragments extracted= 1 number of extra gaps= 1 total=1571 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1571 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYI 1ispA 19 :FAGIKSYLVSQGWSRDKLYA T0299 45 :IFFTSID 1ispA 39 :VDFWDKT T0299 52 :SKAQ 1ispA 47 :TNYN T0299 56 :LVEKLETFFAVHYPFIQSFSLL 1ispA 55 :LSRFVQKVLDETGAKKVDIVAH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1576 Number of alignments=355 # 1ispA read from 1ispA/merged-local-a2m # found chain 1ispA in training set T0299 5 :ALLVRGINVGGKN 1ispA 6 :VVMVHGIGGASFN T0299 21 :MAELRQELTNLGLEKVESYIN 1ispA 19 :FAGIKSYLVSQGWSRDKLYAV T0299 46 :FFTSID 1ispA 40 :DFWDKT T0299 52 :SKAQ 1ispA 47 :TNYN T0299 56 :LVEKLETFFAVHYPFIQSFSLLSL 1ispA 55 :LSRFVQKVLDETGAKKVDIVAHSM T0299 82 :FEAELENL 1ispA 83 :TLYYIKNL T0299 96 :DLARKDFLFYTEG 1ispA 91 :DGGNKVANVVTLG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1583 Number of alignments=356 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zghA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1zghA/merged-local-a2m # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 23 :ELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKL 1zghA 128 :EIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1584 Number of alignments=357 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 23 :ELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLE 1zghA 128 :EIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1585 Number of alignments=358 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 23 :ELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKL 1zghA 128 :EIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1586 Number of alignments=359 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 22 :AELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLE 1zghA 127 :EEIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1587 Number of alignments=360 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)E119 because of BadResidue code BAD_PEPTIDE in next template residue (1zghA)S57 Warning: unaligning (T0299)S120 because of BadResidue code BAD_PEPTIDE at template residue (1zghA)S57 T0299 82 :FEAELENLPAWWSRDLARKDF 1zghA 18 :KFKKENESKYNTTIITNKDEL T0299 103 :LFYTEGLDVDQVIATV 1zghA 40 :FEKVKLINPEYILFPH T0299 121 :LELKDEVL 1zghA 58 :WIIPKEIF Number of specific fragments extracted= 3 number of extra gaps= 1 total=1590 Number of alignments=361 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 85 :ELENLPAWWSRDLARK 1zghA 21 :KENESKYNTTIITNKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1591 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 35 :KVESYINSGNIFFTSIDSKAQLVEKL 1zghA 104 :KVDGGIDTGDIFFKRDLDLYGTAEEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1592 Number of alignments=362 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)F140 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)S141 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 33 :LEKVESYINSGNIFFTSID 1zghA 102 :AIKVDGGIDTGDIFFKRDL T0299 52 :SKAQLVEKLETFFAVH 1zghA 125 :TAEEIFMRASKIIFND T0299 81 :DFEAELENLPAWWSRDLA 1zghA 141 :MIPELLTKRPVPQKQEGE T0299 101 :DFLFYTEGLDVDQV 1zghA 159 :ATVFQRRKPEQSEI T0299 116 :ATVESLELKDEVLYFGKLGIFWGK 1zghA 173 :SPDFDLEKIYDYIRMLDGEGYPRA T0299 142 :EESYSKTA 1zghA 199 :KYGKYRLE Number of specific fragments extracted= 6 number of extra gaps= 1 total=1598 Number of alignments=363 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 9 :RGINVGGK 1zghA 101 :SAIKVDGG T0299 40 :INSGNIFFT 1zghA 109 :IDTGDIFFK T0299 49 :SIDSKAQLVEKLETFFAVH 1zghA 122 :LYGTAEEIFMRASKIIFND T0299 81 :DFEAELENLPAWWSRDLARKDF 1zghA 141 :MIPELLTKRPVPQKQEGEATVF T0299 105 :YTEGLDVDQVIATVES 1zghA 172 :ISPDFDLEKIYDYIRM Number of specific fragments extracted= 5 number of extra gaps= 0 total=1603 Number of alignments=364 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 8 :VRGINVGGKN 1zghA 100 :ISAIKVDGGI T0299 41 :NSGNIFFT 1zghA 110 :DTGDIFFK T0299 49 :S 1zghA 121 :D T0299 50 :IDSKAQLVEKLETFFAVHY 1zghA 123 :YGTAEEIFMRASKIIFNDM T0299 82 :FEAELENLPAWWSRDLARKDF 1zghA 142 :IPELLTKRPVPQKQEGEATVF T0299 105 :YTEGLDVDQVIATVESLELKD 1zghA 172 :ISPDFDLEKIYDYIRMLDGEG T0299 126 :EV 1zghA 195 :RA T0299 130 :FGK 1zghA 199 :KYG T0299 133 :LGIFWGKF 1zghA 203 :YRLEFSRA Number of specific fragments extracted= 9 number of extra gaps= 1 total=1612 Number of alignments=365 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 35 :KVESYINSGNIFFTSIDSKAQLVEKL 1zghA 104 :KVDGGIDTGDIFFKRDLDLYGTAEEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1613 Number of alignments=366 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)F140 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)S141 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 33 :LEKVESYINSGNIFFTSID 1zghA 102 :AIKVDGGIDTGDIFFKRDL T0299 52 :SKAQLVEKLETFFAVH 1zghA 125 :TAEEIFMRASKIIFND T0299 81 :DFEAELENLPAWWSRDLAR 1zghA 141 :MIPELLTKRPVPQKQEGEA T0299 102 :FLFYTEGLDVDQ 1zghA 160 :TVFQRRKPEQSE T0299 115 :IATVESLELKDEVLYFGKLGIFWGK 1zghA 172 :ISPDFDLEKIYDYIRMLDGEGYPRA T0299 142 :EESYSKTAY 1zghA 199 :KYGKYRLEF Number of specific fragments extracted= 6 number of extra gaps= 1 total=1619 Number of alignments=367 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 134 :GIFWGKFSEESYSKTAYHKYLLKVPFYRHITI 1zghA 71 :VVFHMTDLPFGRGGSPLQNLIERGIKKTKISA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1620 Number of alignments=368 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 8 :VRGINVGGKN 1zghA 100 :ISAIKVDGGI T0299 41 :NSGNIFF 1zghA 110 :DTGDIFF T0299 49 :SIDSKAQLVEKLETFFAVHY 1zghA 122 :LYGTAEEIFMRASKIIFNDM T0299 82 :FEAELENLPAWWSRDLARKDF 1zghA 142 :IPELLTKRPVPQKQEGEATVF T0299 105 :YTEGLDVDQVIATVESLEL 1zghA 172 :ISPDFDLEKIYDYIRMLDG T0299 124 :KDEVLYFGKL 1zghA 201 :GKYRLEFSRA T0299 139 :KFSEE 1zghA 211 :SMKNG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1627 Number of alignments=369 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set T0299 35 :KVESYINSGNIFFTSIDSKAQLVEKL 1zghA 104 :KVDGGIDTGDIFFKRDLDLYGTAEEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1628 Number of alignments=370 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)F140 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)S141 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 34 :EKVESYINSGNIFFTSID 1zghA 103 :IKVDGGIDTGDIFFKRDL T0299 52 :SKAQLVEKLETFFAV 1zghA 125 :TAEEIFMRASKIIFN T0299 80 :EDFEAELENLPAWWSRDL 1zghA 140 :DMIPELLTKRPVPQKQEG T0299 101 :DFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGK 1zghA 158 :EATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRA T0299 142 :EESYSKTA 1zghA 199 :KYGKYRLE Number of specific fragments extracted= 5 number of extra gaps= 1 total=1633 Number of alignments=371 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zghA)I198 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zghA)I198 T0299 9 :RGINVGGK 1zghA 101 :SAIKVDGG T0299 40 :INSGNIFFTSID 1zghA 109 :IDTGDIFFKRDL T0299 52 :SKAQLVEKLETFFAV 1zghA 125 :TAEEIFMRASKIIFN T0299 80 :EDFEAELENLPAWWSRDLARKDF 1zghA 140 :DMIPELLTKRPVPQKQEGEATVF T0299 107 :EGLDVDQVIATVESL 1zghA 170 :SEISPDFDLEKIYDY T0299 122 :ELKDEV 1zghA 191 :EGYPRA T0299 130 :FGKLGIFWGKFSEESYSKTAYHKYLLK 1zghA 199 :KYGKYRLEFSRASMKNGKIIADVEIIE Number of specific fragments extracted= 7 number of extra gaps= 1 total=1640 Number of alignments=372 # 1zghA read from 1zghA/merged-local-a2m # found chain 1zghA in template set Warning: unaligning (T0299)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1zghA)S57 Warning: unaligning (T0299)P90 because of BadResidue code BAD_PEPTIDE at template residue (1zghA)S57 T0299 44 :NIFFTSI 1zghA 2 :NIIIATT T0299 53 :KAQLVEKLETFFAVHYPFIQSFSLL 1zghA 9 :KSWNIKNAQKFKKENESKYNTTIIT T0299 78 :SLEDFEAE 1zghA 39 :TFEKVKLI T0299 91 :AWWSRD 1zghA 58 :WIIPKE T0299 97 :LARKDFLFYTEGLDV 1zghA 66 :ENFTCVVFHMTDLPF T0299 114 :V 1zghA 86 :P T0299 117 :TVESLELKDEVL 1zghA 87 :LQNLIERGIKKT T0299 133 :LGIFWGKFSEESYSKTA 1zghA 99 :KISAIKVDGGIDTGDIF T0299 153 :YLLKVPFYRHI 1zghA 116 :FKRDLDLYGTA T0299 168 :AKTFDKIGQML 1zghA 127 :EEIFMRASKII Number of specific fragments extracted= 10 number of extra gaps= 1 total=1650 Number of alignments=373 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zavA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zavA expands to /projects/compbio/data/pdb/1zav.pdb.gz 1zavA:Skipped atom 692, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 694, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 696, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 698, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 700, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 702, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 704, because occupancy 0.500 <= existing 0.500 in 1zavA Skipped atom 706, because occupancy 0.500 <= existing 0.500 in 1zavA # T0299 read from 1zavA/merged-local-a2m # 1zavA read from 1zavA/merged-local-a2m # adding 1zavA to template set # found chain 1zavA in template set T0299 24 :LRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKL 1zavA 62 :LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1651 Number of alignments=374 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYP 1zavA 63 :NLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1652 Number of alignments=375 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 24 :LRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPF 1zavA 62 :LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1653 Number of alignments=376 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 25 :RQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPF 1zavA 63 :NLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKA T0299 71 :I 1zavA 111 :S Number of specific fragments extracted= 2 number of extra gaps= 0 total=1655 Number of alignments=377 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 28 :LTNLGLEKVESYINSGNIFFTSIDSKAQLVEKL 1zavA 66 :LKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1656 Number of alignments=378 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 17 :NKVVMAELRQELTN 1zavA 33 :TVADLTELRSRLRE T0299 31 :LGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAV 1zavA 69 :AEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1658 Number of alignments=379 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 110 :DVDQVIATVESLELKDEVLYFGKLGI 1zavA 36 :DLTELRSRLREKYGDGARFRVVKNTL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1659 Number of alignments=380 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 59 :KLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1zavA 39 :ELRSRLREKYGDGARFRVVKNTLLNLALKNAEY T0299 92 :WWSRDLARKDFLFYTEGLDVDQVIATV 1zavA 74 :YEEFLKGPTAVLYVTEGDPVEAVKIIY Number of specific fragments extracted= 2 number of extra gaps= 0 total=1661 Number of alignments=381 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 22 :AELRQELTN 1zavA 12 :KEMSEIFKK T0299 42 :SGNIFF 1zavA 21 :TSLILF T0299 48 :TSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1zavA 28 :DFLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEY T0299 92 :WWSRDLARKDFLFYTEGLDVDQ 1zavA 74 :YEEFLKGPTAVLYVTEGDPVEA T0299 114 :VIATVESLELKDEVLY 1zavA 99 :IYNFYKDKKADLSRLK T0299 134 :GIFW 1zavA 115 :GGFL T0299 142 :EESYSKTAYHKYLLK 1zavA 119 :EGKKFTAEEVENIAK Number of specific fragments extracted= 7 number of extra gaps= 0 total=1668 Number of alignments=382 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 21 :MAELRQELTN 1zavA 11 :VKEMSEIFKK T0299 42 :SGNIFFTSID 1zavA 21 :TSLILFADFL T0299 52 :SKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1zavA 32 :FTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYE T0299 93 :WSRDLA 1zavA 74 :YEEFLK T0299 99 :RKDFLFYTEG 1zavA 81 :PTAVLYVTEG T0299 110 :DVDQ 1zavA 91 :DPVE T0299 114 :VIATVESLELKDEVL 1zavA 99 :IYNFYKDKKADLSRL T0299 133 :LGIFW 1zavA 114 :KGGFL T0299 142 :EESYSKTAYHKYLLKVP 1zavA 119 :EGKKFTAEEVENIAKLP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1677 Number of alignments=383 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 110 :DVDQVIATVESLELKDEVLYFGKLGI 1zavA 36 :DLTELRSRLREKYGDGARFRVVKNTL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1678 Number of alignments=384 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 59 :KLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1zavA 39 :ELRSRLREKYGDGARFRVVKNTLLNLALKNAEY T0299 92 :WWSRDLARKDFLFYTEGLDVDQV 1zavA 74 :YEEFLKGPTAVLYVTEGDPVEAV Number of specific fragments extracted= 2 number of extra gaps= 0 total=1680 Number of alignments=385 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 22 :AELRQELTN 1zavA 12 :KEMSEIFKK T0299 42 :SGNIFFT 1zavA 21 :TSLILFA T0299 49 :SIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1zavA 29 :FLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEY T0299 92 :WWSRDLARKDFLFYTEGLDVDQ 1zavA 74 :YEEFLKGPTAVLYVTEGDPVEA T0299 114 :VIATVESLELKDEVLY 1zavA 99 :IYNFYKDKKADLSRLK T0299 134 :GIFW 1zavA 115 :GGFL T0299 142 :EESYSKTAYHKYLLK 1zavA 119 :EGKKFTAEEVENIAK Number of specific fragments extracted= 7 number of extra gaps= 0 total=1687 Number of alignments=386 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 21 :MAELRQELTN 1zavA 11 :VKEMSEIFKK T0299 42 :SGNIFF 1zavA 21 :TSLILF T0299 48 :TSID 1zavA 28 :DFLG T0299 52 :SKA 1zavA 33 :TVA T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1zavA 36 :DLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEY T0299 92 :WWSR 1zavA 73 :GYEE T0299 96 :DLARKDFLFYTEG 1zavA 78 :LKGPTAVLYVTEG T0299 112 :DQVIATVESLELKDEVL 1zavA 97 :KIIYNFYKDKKADLSRL T0299 133 :LGIFW 1zavA 114 :KGGFL T0299 142 :EESYSKTAYHKYLLKVP 1zavA 119 :EGKKFTAEEVENIAKLP Number of specific fragments extracted= 10 number of extra gaps= 0 total=1697 Number of alignments=387 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 114 :VIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRH 1zavA 63 :NLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLS Number of specific fragments extracted= 1 number of extra gaps= 0 total=1698 Number of alignments=388 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 61 :ETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1zavA 41 :RSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEE T0299 97 :LARKDFLFYTEGLDVDQVI 1zavA 79 :KGPTAVLYVTEGDPVEAVK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1700 Number of alignments=389 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 22 :AELRQELTN 1zavA 12 :KEMSEIFKK T0299 42 :SGNIFFTSID 1zavA 21 :TSLILFADFL T0299 52 :SKAQL 1zavA 33 :TVADL T0299 58 :EKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1zavA 38 :TELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEE T0299 97 :LARKDFLFYTEGLDVDQVIATVESL 1zavA 78 :LKGPTAVLYVTEGDPVEAVKIIYNF T0299 122 :ELKDEVLYFGKLG 1zavA 105 :DKKADLSRLKGGF Number of specific fragments extracted= 6 number of extra gaps= 0 total=1706 Number of alignments=390 # 1zavA read from 1zavA/merged-local-a2m # found chain 1zavA in template set T0299 21 :MAELRQELTN 1zavA 11 :VKEMSEIFKK T0299 42 :SGNIFFTSID 1zavA 21 :TSLILFADFL T0299 52 :SKAQ 1zavA 33 :TVAD T0299 57 :VEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRD 1zavA 37 :LTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEE T0299 97 :LARKDFLFYTEGLDVDQVIATVESL 1zavA 78 :LKGPTAVLYVTEGDPVEAVKIIYNF T0299 122 :ELKD 1zavA 107 :KADL T0299 128 :LYFGKLGI 1zavA 111 :SRLKGGFL T0299 143 :ESYSKT 1zavA 119 :EGKKFT T0299 171 :FDKIGQMLK 1zavA 125 :AEEVENIAK Number of specific fragments extracted= 9 number of extra gaps= 0 total=1715 Number of alignments=391 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qapA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1qapA/merged-local-a2m # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 114 :VIATVESLELKDEVLYFGKLGIFWGKFSEESYSK 1qapA 211 :VEVEVENLDELDDALKAGADIIMLDNFNTDQMRE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1716 Number of alignments=392 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 115 :IATVESLELKDEVLYFGKLGIFWGKFS 1qapA 212 :EVEVENLDELDDALKAGADIIMLDNFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1717 Number of alignments=393 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 29 :TNLGLEKV 1qapA 167 :LCGGGANH Number of specific fragments extracted= 1 number of extra gaps= 0 total=1718 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1719 Number of alignments=394 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 41 :NSG 1qapA 191 :ASG T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAW 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGADI T0299 104 :FYTEGLDVDQVIATVES 1qapA 232 :IMLDNFNTDQMREAVKR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1722 Number of alignments=395 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGAD T0299 103 :LFYTEGLDVDQVIATVESLELKD 1qapA 231 :IIMLDNFNTDQMREAVKRVNGQA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1724 Number of alignments=396 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1qapA 195 :VRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGAD T0299 103 :LFYTEGLDVDQVIATVESLELKD 1qapA 231 :IIMLDNFNTDQMREAVKRVNGQA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1726 Number of alignments=397 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1727 Number of alignments=398 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 41 :NSG 1qapA 191 :ASG T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGAD T0299 103 :LFYTEGLDVDQVIATVES 1qapA 231 :IIMLDNFNTDQMREAVKR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1730 Number of alignments=399 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPA 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGAD T0299 103 :LFYTEGLDVDQVIATVESLELKD 1qapA 231 :IIMLDNFNTDQMREAVKRVNGQA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1732 Number of alignments=400 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELE 1qapA 195 :VRQAVEKAFWLHPDVPVEVEVENLDELDDALK T0299 94 :SRD 1qapA 228 :GAD T0299 103 :LFYTEGLDVDQVIATVESLELK 1qapA 231 :IIMLDNFNTDQMREAVKRVNGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1735 Number of alignments=401 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1736 Number of alignments=402 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 54 :AQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLF 1qapA 193 :GSVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAGADIIMLDNFNTDQMR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1737 Number of alignments=403 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 55 :QLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENL 1qapA 194 :SVRQAVEKAFWLHPDVPVEVEVENLDELDDALKAG T0299 101 :DFLFYTEGLDVDQVIATVESLELKDE 1qapA 229 :ADIIMLDNFNTDQMREAVKRVNGQAR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1739 Number of alignments=404 # 1qapA read from 1qapA/merged-local-a2m # found chain 1qapA in template set T0299 56 :LVEKLETFFAVHYPFIQSFSLLSLEDFEAELEN 1qapA 195 :VRQAVEKAFWLHPDVPVEVEVENLDELDDALKA T0299 100 :KDFLFYTEGLDVDQVIATVESLELKDE 1qapA 228 :GADIIMLDNFNTDQMREAVKRVNGQAR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1741 Number of alignments=405 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1eqpA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1eqpA expands to /projects/compbio/data/pdb/1eqp.pdb.gz 1eqpA:Skipped atom 466, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 788, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 790, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 792, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1005, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1007, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1009, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1201, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1314, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1316, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1318, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 1693, because occupancy 0.500 <= existing 0.500 in 1eqpA Skipped atom 2107, because occupancy 0.500 <= existing 0.500 in 1eqpA # T0299 read from 1eqpA/merged-local-a2m # 1eqpA read from 1eqpA/merged-local-a2m # adding 1eqpA to template set # found chain 1eqpA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqpA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqpA)S364 T0299 76 :LLSLEDFEAELENLPAW 1eqpA 307 :VNRGARYEGAYDNAPYI T0299 98 :ARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqpA 324 :GSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqpA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=1744 Number of alignments=406 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqpA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqpA)S364 T0299 78 :SLEDFEAELENLPAWWSRD 1eqpA 309 :RGARYEGAYDNAPYIGSCQ T0299 102 :FLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqpA 328 :PLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqpA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=1747 Number of alignments=407 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 38 :SYINSGNIFFTSIDSKAQLVEKLETFFA 1eqpA 185 :IGIELLNEPLGPVLNMDKLKQFFLDGYN T0299 66 :VHYPFIQSFSLLSL 1eqpA 215 :RQTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYT 1eqpA 233 :GYWNNFLTVAEGQWNVVVDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1750 Number of alignments=408 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 3 :RYALLVRGINVGGKNK 1eqpA 129 :RVWIDLHGAPGSQNGF T0299 21 :MAELRQELTNL 1eqpA 161 :TQVTLNVLNTI T0299 32 :GLEKVESYINSGNIFFTS 1eqpA 179 :EYSDVVIGIELLNEPLGP T0299 52 :SKAQLVEKLETFFAV 1eqpA 199 :NMDKLKQFFLDGYNS T0299 67 :HYPFIQSFSLLSL 1eqpA 216 :QTGSVTPVIIHDA T0299 88 :NLPA 1eqpA 229 :FQVF T0299 95 :RDLARKDFLFYTE 1eqpA 241 :VAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqpA 264 :SRNINDHISVACNW Number of specific fragments extracted= 8 number of extra gaps= 0 total=1758 Number of alignments=409 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqpA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqpA)S364 T0299 76 :LLSLEDFEAELENLPA 1eqpA 307 :VNRGARYEGAYDNAPY T0299 97 :LARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqpA 323 :IGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqpA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 3 number of extra gaps= 1 total=1761 Number of alignments=410 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqpA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqpA)S364 T0299 78 :SLEDFEAELENLPAWWSRD 1eqpA 309 :RGARYEGAYDNAPYIGSCQ T0299 98 :A 1eqpA 328 :P T0299 103 :LFYTEGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqpA 329 :LLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 140 :FSEESYSKTAYHKYLLKVPFYRHITIRNA 1eqpA 365 :WKTENAPEWSFQTLTYNGLFPQPVTDRQF Number of specific fragments extracted= 4 number of extra gaps= 1 total=1765 Number of alignments=411 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 33 :LEKVESYINSGNIFFTSIDSKAQLVEKLETFFA 1eqpA 180 :YSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYN T0299 66 :VHYPFIQSFSLLSL 1eqpA 215 :RQTGSVTPVIIHDA T0299 91 :A 1eqpA 232 :F T0299 92 :WWS 1eqpA 234 :YWN T0299 95 :RDLARKDFLFYT 1eqpA 241 :VAEGQWNVVVDH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1770 Number of alignments=412 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 4 :YALLVRGI 1eqpA 90 :FVRIPIGY T0299 12 :NVGGKNKVV 1eqpA 101 :QLLDNDPYV T0299 21 :MAELRQELTNLG 1eqpA 116 :LEKALGWARKNN T0299 36 :VESYINSGNI 1eqpA 128 :IRVWIDLHGA T0299 47 :FTSIDSKAQLVEKLETFFAVHYPFI 1eqpA 155 :FQNGDNTQVTLNVLNTIFKKYGGNE T0299 72 :QSFSL 1eqpA 184 :VIGIE T0299 77 :LSLEDFEAELEN 1eqpA 198 :LNMDKLKQFFLD T0299 91 :A 1eqpA 229 :F T0299 92 :WWS 1eqpA 231 :VFG T0299 95 :RDLARKDFLFYTE 1eqpA 241 :VAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqpA 264 :SRNINDHISVACNW Number of specific fragments extracted= 11 number of extra gaps= 0 total=1781 Number of alignments=413 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 8 :VRGINVGG 1eqpA 15 :IRGVNLGG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1782 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set Warning: unaligning (T0299)W137 because of BadResidue code BAD_PEPTIDE in next template residue (1eqpA)S364 Warning: unaligning (T0299)G138 because of BadResidue code BAD_PEPTIDE at template residue (1eqpA)S364 T0299 78 :SLEDFEAELENLPAWWSRDLARKD 1eqpA 309 :RGARYEGAYDNAPYIGSCQPLLDI T0299 107 :EGLDVDQVIATVESLELKDEVLYFGKLGIF 1eqpA 333 :SQWSDEHKTDTRRYIEAQLDAFEYTGGWVF T0299 139 :KFSEESYS 1eqpA 365 :WKTENAPE T0299 148 :TAYHKYLLKVPFYRHITIR 1eqpA 373 :WSFQTLTYNGLFPQPVTDR Number of specific fragments extracted= 4 number of extra gaps= 1 total=1786 Number of alignments=414 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 50 :IDSKAQLVEKLETFFA 1eqpA 197 :VLNMDKLKQFFLDGYN T0299 66 :VHYPFIQSFSLLSL 1eqpA 215 :RQTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYTEG 1eqpA 233 :GYWNNFLTVAEGQWNVVVDHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1789 Number of alignments=415 # 1eqpA read from 1eqpA/merged-local-a2m # found chain 1eqpA in template set T0299 3 :RYALLVRGINVGGKNK 1eqpA 129 :RVWIDLHGAPGSQNGF T0299 21 :MAELRQELTNL 1eqpA 161 :TQVTLNVLNTI T0299 32 :GLEKVESYINSGN 1eqpA 179 :EYSDVVIGIELLN T0299 48 :TSID 1eqpA 194 :LGPV T0299 52 :SKAQLVEKLETFFAV 1eqpA 199 :NMDKLKQFFLDGYNS T0299 67 :HYPFIQSFSLLSL 1eqpA 216 :QTGSVTPVIIHDA T0299 87 :ENLPAWWSRDLARKDFLFYTE 1eqpA 233 :GYWNNFLTVAEGQWNVVVDHH T0299 108 :GLDVDQVIATVESL 1eqpA 264 :SRNINDHISVACNW Number of specific fragments extracted= 8 number of extra gaps= 0 total=1797 Number of alignments=416 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xzoA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0299 read from 1xzoA/merged-local-a2m # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)V20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)W92 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)W93 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)S94 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)R95 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)A98 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)R99 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 43 :GNIFFTSID 1xzoA 70 :VRIISFSVD T0299 52 :SKAQLVEKLETFFA 1xzoA 83 :KPKQLKKFAANYPL T0299 66 :VHYPFIQSFSLLSL 1xzoA 99 :DNWDFLTGYSQSEI T0299 80 :EDFEAELENLPA 1xzoA 118 :KSFKAIVKKPEG T0299 96 :DL 1xzoA 134 :IH T0299 100 :KDFLFY 1xzoA 138 :SFYLVG T0299 106 :T 1xzoA 156 :E T0299 108 :GLDVDQVIATVESL 1xzoA 157 :NTPYDDIISDVKSA Number of specific fragments extracted= 9 number of extra gaps= 3 total=1806 Number of alignments=417 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)V20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)W92 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)W93 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)S94 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)R95 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)A98 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)R99 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 43 :GNIFFTSID 1xzoA 70 :VRIISFSVD T0299 52 :SKAQLVEKLETFFA 1xzoA 83 :KPKQLKKFAANYPL T0299 66 :VHYPFIQSFSLLSL 1xzoA 99 :DNWDFLTGYSQSEI T0299 80 :EDFEAELENLPA 1xzoA 118 :KSFKAIVKKPEG T0299 96 :DL 1xzoA 134 :IH T0299 100 :KDFLFY 1xzoA 138 :SFYLVG T0299 106 :T 1xzoA 156 :E T0299 108 :GLDVDQVIATVESL 1xzoA 157 :NTPYDDIISDVKSA Number of specific fragments extracted= 9 number of extra gaps= 3 total=1815 Number of alignments=418 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)V20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)W92 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)W93 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)S94 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)R95 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)A98 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)R99 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 22 :AELRQELTNLGLEKVESYINSG 1xzoA 57 :TDLQKKLKAENIDVRIISFSVD T0299 48 :TSIDSKAQLVEKLE 1xzoA 79 :PENDKPKQLKKFAA T0299 63 :FFAVHYPF 1xzoA 93 :NYPLSFDN T0299 71 :IQSFSLLSL 1xzoA 104 :LTGYSQSEI T0299 80 :EDFEAELENLPA 1xzoA 118 :KSFKAIVKKPEG T0299 96 :DL 1xzoA 134 :IH T0299 100 :KDFLFYTEGLDVDQVIA 1xzoA 138 :SFYLVGPDGKVLKDYNG T0299 117 :TVESLELKDEV 1xzoA 157 :NTPYDDIISDV Number of specific fragments extracted= 8 number of extra gaps= 3 total=1823 Number of alignments=419 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)V20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)W92 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)W93 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)S94 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)R95 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)A98 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)R99 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 22 :AELRQELTNLGL 1xzoA 57 :TDLQKKLKAENI T0299 43 :GNIFFTSIDSKAQLVEKLETFFA 1xzoA 70 :VRIISFSVDPENDKPKQLKKFAA T0299 66 :VHYPF 1xzoA 96 :LSFDN T0299 71 :IQSFSLLSL 1xzoA 104 :LTGYSQSEI T0299 80 :EDFEAELENLPA 1xzoA 118 :KSFKAIVKKPEG T0299 96 :DL 1xzoA 134 :IH T0299 100 :KDFLFY 1xzoA 138 :SFYLVG T0299 106 :T 1xzoA 153 :N T0299 107 :EGLDVDQVIATVE 1xzoA 156 :ENTPYDDIISDVK Number of specific fragments extracted= 9 number of extra gaps= 3 total=1832 Number of alignments=420 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 T0299 22 :AELRQELTNLGL 1xzoA 57 :TDLQKKLKAENI T0299 42 :SGNIFFTSID 1xzoA 69 :DVRIISFSVD T0299 52 :SKAQLVEKLE 1xzoA 83 :KPKQLKKFAA T0299 63 :FFAVHYPFIQSFSLLSLEDFEAEL 1xzoA 93 :NYPLSFDNWDFLTGYSQSEIEEFA T0299 87 :ENLPAWWS 1xzoA 118 :KSFKAIVK T0299 95 :RDLARKDFLFYTEGLDVDQVIATVES 1xzoA 144 :PDGKVLKDYNGVENTPYDDIISDVKS Number of specific fragments extracted= 6 number of extra gaps= 1 total=1838 Number of alignments=421 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)V20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 T0299 22 :AELRQELTNLGL 1xzoA 57 :TDLQKKLKAENI T0299 42 :SGNIFFTSID 1xzoA 69 :DVRIISFSVD T0299 52 :SKAQLVEKLE 1xzoA 83 :KPKQLKKFAA T0299 63 :FFAVHYPFIQSFSLLSLEDFEAEL 1xzoA 93 :NYPLSFDNWDFLTGYSQSEIEEFA T0299 87 :ENLPAWWS 1xzoA 118 :KSFKAIVK T0299 95 :RDLARKDFLFYTEGLDVDQVIATVES 1xzoA 144 :PDGKVLKDYNGVENTPYDDIISDVKS Number of specific fragments extracted= 6 number of extra gaps= 1 total=1844 Number of alignments=422 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 122 :ELKD 1xzoA 126 :KPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 4 number of extra gaps= 2 total=1848 Number of alignments=423 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 68 :YPFIQSFSLLSLEDFEAELENLPAWWS 1xzoA 73 :ISFSVDPENDKPKQLKKFAANYPLSFD T0299 95 :RDLARKDFLFYTEGLDVDQVIATV 1xzoA 101 :WDFLTGYSQSEIEEFALKSFKAIV T0299 121 :LELKD 1xzoA 125 :KKPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 6 number of extra gaps= 2 total=1854 Number of alignments=424 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)L56 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)V57 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 55 :Q 1xzoA 54 :A T0299 58 :EKLETFFAVH 1xzoA 57 :TDLQKKLKAE T0299 69 :PFIQSFSLLS 1xzoA 67 :NIDVRIISFS T0299 79 :LEDFEAELENLPAWWSR 1xzoA 84 :PKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVES 1xzoA 101 :WDFLTGYSQSEIEEFALK T0299 121 :LELKD 1xzoA 125 :KKPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 9 number of extra gaps= 3 total=1863 Number of alignments=425 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 T0299 6 :LLVRGINVG 1xzoA 36 :WLADFIFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYINSGN 1xzoA 70 :VRIISFSVD T0299 50 :ID 1xzoA 79 :PE T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVES 1xzoA 101 :WDFLTGYSQSEIEEFALK T0299 124 :KD 1xzoA 128 :EG T0299 127 :VLYFGK 1xzoA 139 :FYLVGP T0299 133 :LGIFWGKFSEESYSKTAYHKYL 1xzoA 146 :GKVLKDYNGVENTPYDDIISDV Number of specific fragments extracted= 10 number of extra gaps= 3 total=1873 Number of alignments=426 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 79 :LEDFEAELENLPAWWS 1xzoA 84 :PKQLKKFAANYPLSFD T0299 95 :RDLARKDFLFYTEGLDVDQVIATVE 1xzoA 101 :WDFLTGYSQSEIEEFALKSFKAIVK T0299 122 :ELKD 1xzoA 126 :KPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 6 number of extra gaps= 2 total=1879 Number of alignments=427 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 68 :YPFIQSFSLLSLEDFEAELENLPAWWS 1xzoA 73 :ISFSVDPENDKPKQLKKFAANYPLSFD T0299 95 :RDLARKDFLFYTEGLDVDQVIATV 1xzoA 101 :WDFLTGYSQSEIEEFALKSFKAIV T0299 121 :LELKD 1xzoA 125 :KKPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 6 number of extra gaps= 2 total=1885 Number of alignments=428 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)I50 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)D51 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)L56 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xzoA)M56 Warning: unaligning (T0299)V57 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 44 :NIFFTS 1xzoA 39 :DFIFTN T0299 52 :SKAQ 1xzoA 51 :PMTA T0299 58 :EKLETFFAVH 1xzoA 57 :TDLQKKLKAE T0299 69 :PFIQSFSLLS 1xzoA 67 :NIDVRIISFS T0299 79 :LEDFEAELENLPAWWSR 1xzoA 84 :PKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVES 1xzoA 101 :WDFLTGYSQSEIEEFALK T0299 121 :LELKD 1xzoA 125 :KKPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFW 1xzoA 138 :SFYL T0299 140 :FSEES 1xzoA 142 :VGPDG Number of specific fragments extracted= 10 number of extra gaps= 4 total=1895 Number of alignments=429 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)D125 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)E126 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 3 :RYALLV 1xzoA 35 :VWLADF T0299 11 :INVG 1xzoA 41 :IFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYINSGN 1xzoA 70 :VRIISFSVD T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 124 :K 1xzoA 135 :H T0299 127 :VLYF 1xzoA 138 :SFYL T0299 131 :GKLGIFWGKFSEESYSKTAYHKYLL 1xzoA 144 :PDGKVLKDYNGVENTPYDDIISDVK Number of specific fragments extracted= 10 number of extra gaps= 3 total=1905 Number of alignments=430 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)D125 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)G131 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 79 :LEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELK 1xzoA 84 :PKQLKKFAANYPLSFDNWDFLTGYSQSEIEEFALKSFKAIVKKPEG T0299 129 :YF 1xzoA 134 :IH T0299 133 :LGIFWGKFSEESYS 1xzoA 138 :SFYLVGPDGKVLKD Number of specific fragments extracted= 3 number of extra gaps= 2 total=1908 Number of alignments=431 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 69 :PFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIAT 1xzoA 74 :SFSVDPENDKPKQLKKFAANYPLSFDNWDFLTGYSQSEIEEFALKSFKA T0299 119 :ESLELKD 1xzoA 123 :IVKKPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFWGKFSEESYSKTA 1xzoA 138 :SFYLVGPDGKVLKDYN Number of specific fragments extracted= 4 number of extra gaps= 2 total=1912 Number of alignments=432 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 58 :EKLETFFAV 1xzoA 57 :TDLQKKLKA T0299 68 :YPFIQSFSLLS 1xzoA 66 :ENIDVRIISFS T0299 79 :LEDFEAELENLPAWWSR 1xzoA 84 :PKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 122 :ELKD 1xzoA 126 :KPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFWGKFSEES 1xzoA 138 :SFYLVGPDGKV Number of specific fragments extracted= 7 number of extra gaps= 2 total=1919 Number of alignments=433 # 1xzoA read from 1xzoA/merged-local-a2m # found chain 1xzoA in training set Warning: unaligning (T0299)G15 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)E46 Warning: unaligning (T0299)K16 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)E46 Warning: unaligning (T0299)M21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xzoA)M56 Warning: unaligning (T0299)E126 because of BadResidue code BAD_PEPTIDE in next template residue (1xzoA)D131 Warning: unaligning (T0299)V127 because of BadResidue code BAD_PEPTIDE at template residue (1xzoA)D131 Warning: unaligning (T0299)L128 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)Q132 Warning: unaligning (T0299)Y129 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)V133 Warning: unaligning (T0299)K132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xzoA)S137 Warning: unaligning (T0299)L133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xzoA)S137 T0299 6 :LLVRGINVG 1xzoA 36 :WLADFIFTN T0299 17 :NKVV 1xzoA 47 :TICP T0299 22 :AELRQELTNLGLE 1xzoA 57 :TDLQKKLKAENID T0299 36 :VESYI 1xzoA 70 :VRIIS T0299 47 :FTSID 1xzoA 75 :FSVDP T0299 78 :SLEDFEAELENLPAWWSR 1xzoA 83 :KPKQLKKFAANYPLSFDN T0299 103 :LFYTEGLDVDQVIATVESL 1xzoA 101 :WDFLTGYSQSEIEEFALKS T0299 122 :ELKD 1xzoA 126 :KPEG T0299 130 :FG 1xzoA 134 :IH T0299 134 :GIFWGKFSEES 1xzoA 138 :SFYLVGPDGKV Number of specific fragments extracted= 10 number of extra gaps= 4 total=1929 Number of alignments=434 # command:NUMB_ALIGNS: 434 evalue: 0 0.2704, weight 1.9953 evalue: 1 0.7454, weight 1.1955 evalue: 2 3.2363, weight 0.4259 evalue: 3 3.3496, weight 0.4141 evalue: 4 3.9737, weight 0.3594 evalue: 5 5.3854, weight 0.2769 evalue: 6 6.1613, weight 0.2460 evalue: 7 8.7166, weight 0.1799 evalue: 8 9.2221, weight 0.1709 evalue: 9 9.2324, weight 0.1707 evalue: 10 0.5600, weight 1.4033 evalue: 11 1.2887, weight 0.8473 evalue: 12 1.3971, weight 0.8020 evalue: 13 3.3529, weight 0.4137 evalue: 14 3.7067, weight 0.3809 evalue: 15 4.6072, weight 0.3170 evalue: 16 5.6270, weight 0.2665 evalue: 17 6.0085, weight 0.2515 evalue: 18 6.2107, weight 0.2443 evalue: 19 6.5032, weight 0.2345 evalue: 20 1.4157, weight 0.7947 evalue: 21 8.0976, weight 0.1924 evalue: 22 8.2115, weight 0.1900 evalue: 23 8.3395, weight 0.1873 evalue: 24 10.8620, weight 0.1469 evalue: 25 11.1430, weight 0.1434 evalue: 26 11.1900, weight 0.1428 evalue: 27 12.3610, weight 0.1302 evalue: 28 12.9030, weight 0.1250 evalue: 29 17.0990, weight 0.0958 evalue: 30 1.5677, weight 0.7401 evalue: 31 2.8133, weight 0.4767 evalue: 32 4.1246, weight 0.3483 evalue: 33 5.6463, weight 0.2657 evalue: 34 5.9782, weight 0.2526 evalue: 35 7.2303, weight 0.2132 evalue: 36 7.4056, weight 0.2087 evalue: 37 7.4060, weight 0.2086 evalue: 38 9.1869, weight 0.1715 evalue: 39 9.5731, weight 0.1651 evalue: 40 7.2303, weight 0.2132 evalue: 41 7.2303, weight 0.2132 evalue: 42 7.2303, weight 0.2132 evalue: 43 7.2303, weight 0.2132 evalue: 44 7.2303, weight 0.2132 evalue: 45 7.2303, weight 0.2132 evalue: 46 7.2303, weight 0.2132 evalue: 47 7.2303, weight 0.2132 evalue: 48 7.2303, weight 0.2132 evalue: 49 7.2303, weight 0.2132 evalue: 50 7.2303, weight 0.2132 evalue: 51 7.2303, weight 0.2132 evalue: 52 7.2303, weight 0.2132 evalue: 53 7.2303, weight 0.2132 evalue: 54 54.4000, weight 0.0311 evalue: 55 54.4000, weight 0.0311 evalue: 56 54.4000, weight 0.0311 evalue: 57 54.4000, weight 0.0311 evalue: 58 54.4000, weight 0.0311 evalue: 59 54.4000, weight 0.0311 evalue: 60 54.4000, weight 0.0311 evalue: 61 54.4000, weight 0.0311 evalue: 62 54.4000, weight 0.0311 evalue: 63 54.4000, weight 0.0311 evalue: 64 54.4000, weight 0.0311 evalue: 65 54.4000, weight 0.0311 evalue: 66 54.4000, weight 0.0311 evalue: 67 54.4000, weight 0.0311 evalue: 68 54.4000, weight 0.0311 evalue: 69 54.4000, weight 0.0311 evalue: 70 34.7000, weight 0.0483 evalue: 71 34.7000, weight 0.0483 evalue: 72 34.7000, weight 0.0483 evalue: 73 34.7000, weight 0.0483 evalue: 74 34.7000, weight 0.0483 evalue: 75 34.7000, weight 0.0483 evalue: 76 34.7000, weight 0.0483 evalue: 77 34.7000, weight 0.0483 evalue: 78 34.7000, weight 0.0483 evalue: 79 34.7000, weight 0.0483 evalue: 80 34.7000, weight 0.0483 evalue: 81 34.7000, weight 0.0483 evalue: 82 34.7000, weight 0.0483 evalue: 83 34.7000, weight 0.0483 evalue: 84 9.1869, weight 0.1715 evalue: 85 9.1869, weight 0.1715 evalue: 86 9.1869, weight 0.1715 evalue: 87 9.1869, weight 0.1715 evalue: 88 9.1869, weight 0.1715 evalue: 89 9.1869, weight 0.1715 evalue: 90 9.1869, weight 0.1715 evalue: 91 9.1869, weight 0.1715 evalue: 92 9.1869, weight 0.1715 evalue: 93 9.1869, weight 0.1715 evalue: 94 9.1869, weight 0.1715 evalue: 95 9.1869, weight 0.1715 evalue: 96 9.1869, weight 0.1715 evalue: 97 9.1869, weight 0.1715 evalue: 98 1.5677, weight 0.7401 evalue: 99 1.5677, weight 0.7401 evalue: 100 1.5677, weight 0.7401 evalue: 101 1.5677, weight 0.7401 evalue: 102 1.5677, weight 0.7401 evalue: 103 1.5677, weight 0.7401 evalue: 104 1.5677, weight 0.7401 evalue: 105 1.5677, weight 0.7401 evalue: 106 1.5677, weight 0.7401 evalue: 107 1.5677, weight 0.7401 evalue: 108 1.5677, weight 0.7401 evalue: 109 1.5677, weight 0.7401 evalue: 110 1.5677, weight 0.7401 evalue: 111 1.5677, weight 0.7401 evalue: 112 1.5677, weight 0.7401 evalue: 113 1.5677, weight 0.7401 evalue: 114 1.5677, weight 0.7401 evalue: 115 1.5677, weight 0.7401 evalue: 116 1.5677, weight 0.7401 evalue: 117 14.4560, weight 0.1123 evalue: 118 14.4560, weight 0.1123 evalue: 119 14.4560, weight 0.1123 evalue: 120 14.4560, weight 0.1123 evalue: 121 14.4560, weight 0.1123 evalue: 122 14.4560, weight 0.1123 evalue: 123 14.4560, weight 0.1123 evalue: 124 14.4560, weight 0.1123 evalue: 125 14.4560, weight 0.1123 evalue: 126 14.4560, weight 0.1123 evalue: 127 14.4560, weight 0.1123 evalue: 128 14.4560, weight 0.1123 evalue: 129 14.4560, weight 0.1123 evalue: 130 14.4560, weight 0.1123 evalue: 131 14.4560, weight 0.1123 evalue: 132 4.1246, weight 0.3483 evalue: 133 4.1246, weight 0.3483 evalue: 134 4.1246, weight 0.3483 evalue: 135 4.1246, weight 0.3483 evalue: 136 4.1246, weight 0.3483 evalue: 137 4.1246, weight 0.3483 evalue: 138 4.1246, weight 0.3483 evalue: 139 4.1246, weight 0.3483 evalue: 140 4.1246, weight 0.3483 evalue: 141 4.1246, weight 0.3483 evalue: 142 4.1246, weight 0.3483 evalue: 143 4.1246, weight 0.3483 evalue: 144 4.1246, weight 0.3483 evalue: 145 4.1246, weight 0.3483 evalue: 146 4.1246, weight 0.3483 evalue: 147 15.3820, weight 0.1059 evalue: 148 15.3820, weight 0.1059 evalue: 149 15.3820, weight 0.1059 evalue: 150 15.3820, weight 0.1059 evalue: 151 15.3820, weight 0.1059 evalue: 152 15.3820, weight 0.1059 evalue: 153 15.3820, weight 0.1059 evalue: 154 15.3820, weight 0.1059 evalue: 155 15.3820, weight 0.1059 evalue: 156 15.3820, weight 0.1059 evalue: 157 15.3820, weight 0.1059 evalue: 158 15.3820, weight 0.1059 evalue: 159 15.3820, weight 0.1059 evalue: 160 15.3820, weight 0.1059 evalue: 161 15.3820, weight 0.1059 evalue: 162 43.1000, weight 0.0391 evalue: 163 43.1000, weight 0.0391 evalue: 164 43.1000, weight 0.0391 evalue: 165 43.1000, weight 0.0391 evalue: 166 43.1000, weight 0.0391 evalue: 167 43.1000, weight 0.0391 evalue: 168 43.1000, weight 0.0391 evalue: 169 43.1000, weight 0.0391 evalue: 170 43.1000, weight 0.0391 evalue: 171 43.1000, weight 0.0391 evalue: 172 43.1000, weight 0.0391 evalue: 173 43.1000, weight 0.0391 evalue: 174 43.1000, weight 0.0391 evalue: 175 43.1000, weight 0.0391 evalue: 176 43.1000, weight 0.0391 evalue: 177 43.1000, weight 0.0391 evalue: 178 43.1000, weight 0.0391 evalue: 179 2.8133, weight 0.4767 evalue: 180 2.8133, weight 0.4767 evalue: 181 2.8133, weight 0.4767 evalue: 182 2.8133, weight 0.4767 evalue: 183 2.8133, weight 0.4767 evalue: 184 2.8133, weight 0.4767 evalue: 185 2.8133, weight 0.4767 evalue: 186 2.8133, weight 0.4767 evalue: 187 2.8133, weight 0.4767 evalue: 188 2.8133, weight 0.4767 evalue: 189 2.8133, weight 0.4767 evalue: 190 2.8133, weight 0.4767 evalue: 191 2.8133, weight 0.4767 evalue: 192 2.8133, weight 0.4767 evalue: 193 2.8133, weight 0.4767 evalue: 194 12.3690, weight 0.1301 evalue: 195 12.3690, weight 0.1301 evalue: 196 12.3690, weight 0.1301 evalue: 197 12.3690, weight 0.1301 evalue: 198 12.3690, weight 0.1301 evalue: 199 12.3690, weight 0.1301 evalue: 200 12.3690, weight 0.1301 evalue: 201 12.3690, weight 0.1301 evalue: 202 12.3690, weight 0.1301 evalue: 203 12.3690, weight 0.1301 evalue: 204 12.3690, weight 0.1301 evalue: 205 12.3690, weight 0.1301 evalue: 206 12.3690, weight 0.1301 evalue: 207 12.3690, weight 0.1301 evalue: 208 14.9820, weight 0.1086 evalue: 209 14.9820, weight 0.1086 evalue: 210 14.9820, weight 0.1086 evalue: 211 14.9820, weight 0.1086 evalue: 212 14.9820, weight 0.1086 evalue: 213 14.9820, weight 0.1086 evalue: 214 14.9820, weight 0.1086 evalue: 215 14.9820, weight 0.1086 evalue: 216 14.9820, weight 0.1086 evalue: 217 14.9820, weight 0.1086 evalue: 218 16.7690, weight 0.0976 evalue: 219 16.7690, weight 0.0976 evalue: 220 16.7690, weight 0.0976 evalue: 221 16.7690, weight 0.0976 evalue: 222 16.7690, weight 0.0976 evalue: 223 16.7690, weight 0.0976 evalue: 224 16.7690, weight 0.0976 evalue: 225 16.7690, weight 0.0976 evalue: 226 16.7690, weight 0.0976 evalue: 227 16.7690, weight 0.0976 evalue: 228 16.7690, weight 0.0976 evalue: 229 16.7690, weight 0.0976 evalue: 230 16.7690, weight 0.0976 evalue: 231 11.5970, weight 0.1382 evalue: 232 11.5970, weight 0.1382 evalue: 233 11.5970, weight 0.1382 evalue: 234 11.5970, weight 0.1382 evalue: 235 11.5970, weight 0.1382 evalue: 236 11.5970, weight 0.1382 evalue: 237 11.5970, weight 0.1382 evalue: 238 11.5970, weight 0.1382 evalue: 239 11.5970, weight 0.1382 evalue: 240 11.5970, weight 0.1382 evalue: 241 11.5970, weight 0.1382 evalue: 242 11.5970, weight 0.1382 evalue: 243 11.5970, weight 0.1382 evalue: 244 11.5970, weight 0.1382 evalue: 245 11.5970, weight 0.1382 evalue: 246 11.5970, weight 0.1382 evalue: 247 11.5970, weight 0.1382 evalue: 248 16.1020, weight 0.1014 evalue: 249 16.1020, weight 0.1014 evalue: 250 16.1020, weight 0.1014 evalue: 251 16.1020, weight 0.1014 evalue: 252 16.1020, weight 0.1014 evalue: 253 16.1020, weight 0.1014 evalue: 254 16.1020, weight 0.1014 evalue: 255 16.1020, weight 0.1014 evalue: 256 16.1020, weight 0.1014 evalue: 257 16.1020, weight 0.1014 evalue: 258 16.1020, weight 0.1014 evalue: 259 16.1020, weight 0.1014 evalue: 260 16.1020, weight 0.1014 evalue: 261 16.1020, weight 0.1014 evalue: 262 16.1020, weight 0.1014 evalue: 263 16.1020, weight 0.1014 evalue: 264 16.1020, weight 0.1014 evalue: 265 63.3000, weight 0.0268 evalue: 266 63.3000, weight 0.0268 evalue: 267 63.3000, weight 0.0268 evalue: 268 63.3000, weight 0.0268 evalue: 269 63.3000, weight 0.0268 evalue: 270 63.3000, weight 0.0268 evalue: 271 63.3000, weight 0.0268 evalue: 272 63.3000, weight 0.0268 evalue: 273 63.3000, weight 0.0268 evalue: 274 63.3000, weight 0.0268 evalue: 275 63.3000, weight 0.0268 evalue: 276 63.3000, weight 0.0268 evalue: 277 63.3000, weight 0.0268 evalue: 278 15.7460, weight 0.1036 evalue: 279 15.7460, weight 0.1036 evalue: 280 15.7460, weight 0.1036 evalue: 281 15.7460, weight 0.1036 evalue: 282 15.7460, weight 0.1036 evalue: 283 15.7460, weight 0.1036 evalue: 284 15.7460, weight 0.1036 evalue: 285 15.7460, weight 0.1036 evalue: 286 15.7460, weight 0.1036 evalue: 287 15.7460, weight 0.1036 evalue: 288 15.7460, weight 0.1036 evalue: 289 15.7460, weight 0.1036 evalue: 290 15.7460, weight 0.1036 evalue: 291 15.7460, weight 0.1036 evalue: 292 15.7460, weight 0.1036 evalue: 293 15.7460, weight 0.1036 evalue: 294 15.7460, weight 0.1036 evalue: 295 15.7460, weight 0.1036 evalue: 296 9.5731, weight 0.1651 evalue: 297 9.5731, weight 0.1651 evalue: 298 9.5731, weight 0.1651 evalue: 299 9.5731, weight 0.1651 evalue: 300 9.5731, weight 0.1651 evalue: 301 9.5731, weight 0.1651 evalue: 302 9.5731, weight 0.1651 evalue: 303 9.5731, weight 0.1651 evalue: 304 9.5731, weight 0.1651 evalue: 305 9.5731, weight 0.1651 evalue: 306 9.5731, weight 0.1651 evalue: 307 9.5731, weight 0.1651 evalue: 308 9.5731, weight 0.1651 evalue: 309 9.5731, weight 0.1651 evalue: 310 9.5731, weight 0.1651 evalue: 311 9.5731, weight 0.1651 evalue: 312 9.5731, weight 0.1651 evalue: 313 7.4060, weight 0.2086 evalue: 314 7.4060, weight 0.2086 evalue: 315 7.4060, weight 0.2086 evalue: 316 7.4060, weight 0.2086 evalue: 317 7.4060, weight 0.2086 evalue: 318 7.4060, weight 0.2086 evalue: 319 7.4060, weight 0.2086 evalue: 320 7.4060, weight 0.2086 evalue: 321 7.4060, weight 0.2086 evalue: 322 7.4060, weight 0.2086 evalue: 323 7.4060, weight 0.2086 evalue: 324 7.4060, weight 0.2086 evalue: 325 7.4060, weight 0.2086 evalue: 326 7.4060, weight 0.2086 evalue: 327 7.4060, weight 0.2086 evalue: 328 16.2220, weight 0.1007 evalue: 329 16.2220, weight 0.1007 evalue: 330 16.2220, weight 0.1007 evalue: 331 16.2220, weight 0.1007 evalue: 332 16.2220, weight 0.1007 evalue: 333 16.2220, weight 0.1007 evalue: 334 16.2220, weight 0.1007 evalue: 335 16.2220, weight 0.1007 evalue: 336 16.2220, weight 0.1007 evalue: 337 16.2220, weight 0.1007 evalue: 338 16.2220, weight 0.1007 evalue: 339 16.2220, weight 0.1007 evalue: 340 16.2220, weight 0.1007 evalue: 341 16.2220, weight 0.1007 evalue: 342 16.2220, weight 0.1007 evalue: 343 16.2220, weight 0.1007 evalue: 344 7.4056, weight 0.2087 evalue: 345 7.4056, weight 0.2087 evalue: 346 7.4056, weight 0.2087 evalue: 347 7.4056, weight 0.2087 evalue: 348 7.4056, weight 0.2087 evalue: 349 7.4056, weight 0.2087 evalue: 350 7.4056, weight 0.2087 evalue: 351 7.4056, weight 0.2087 evalue: 352 7.4056, weight 0.2087 evalue: 353 7.4056, weight 0.2087 evalue: 354 7.4056, weight 0.2087 evalue: 355 7.4056, weight 0.2087 evalue: 356 5.9782, weight 0.2526 evalue: 357 5.9782, weight 0.2526 evalue: 358 5.9782, weight 0.2526 evalue: 359 5.9782, weight 0.2526 evalue: 360 5.9782, weight 0.2526 evalue: 361 5.9782, weight 0.2526 evalue: 362 5.9782, weight 0.2526 evalue: 363 5.9782, weight 0.2526 evalue: 364 5.9782, weight 0.2526 evalue: 365 5.9782, weight 0.2526 evalue: 366 5.9782, weight 0.2526 evalue: 367 5.9782, weight 0.2526 evalue: 368 5.9782, weight 0.2526 evalue: 369 5.9782, weight 0.2526 evalue: 370 5.9782, weight 0.2526 evalue: 371 5.9782, weight 0.2526 evalue: 372 5.9782, weight 0.2526 evalue: 373 11.9510, weight 0.1343 evalue: 374 11.9510, weight 0.1343 evalue: 375 11.9510, weight 0.1343 evalue: 376 11.9510, weight 0.1343 evalue: 377 11.9510, weight 0.1343 evalue: 378 11.9510, weight 0.1343 evalue: 379 11.9510, weight 0.1343 evalue: 380 11.9510, weight 0.1343 evalue: 381 11.9510, weight 0.1343 evalue: 382 11.9510, weight 0.1343 evalue: 383 11.9510, weight 0.1343 evalue: 384 11.9510, weight 0.1343 evalue: 385 11.9510, weight 0.1343 evalue: 386 11.9510, weight 0.1343 evalue: 387 11.9510, weight 0.1343 evalue: 388 11.9510, weight 0.1343 evalue: 389 11.9510, weight 0.1343 evalue: 390 11.9510, weight 0.1343 evalue: 391 77.6000, weight 0.0219 evalue: 392 77.6000, weight 0.0219 evalue: 393 77.6000, weight 0.0219 evalue: 394 77.6000, weight 0.0219 evalue: 395 77.6000, weight 0.0219 evalue: 396 77.6000, weight 0.0219 evalue: 397 77.6000, weight 0.0219 evalue: 398 77.6000, weight 0.0219 evalue: 399 77.6000, weight 0.0219 evalue: 400 77.6000, weight 0.0219 evalue: 401 77.6000, weight 0.0219 evalue: 402 77.6000, weight 0.0219 evalue: 403 77.6000, weight 0.0219 evalue: 404 77.6000, weight 0.0219 evalue: 405 34.7000, weight 0.0483 evalue: 406 34.7000, weight 0.0483 evalue: 407 34.7000, weight 0.0483 evalue: 408 34.7000, weight 0.0483 evalue: 409 34.7000, weight 0.0483 evalue: 410 34.7000, weight 0.0483 evalue: 411 34.7000, weight 0.0483 evalue: 412 34.7000, weight 0.0483 evalue: 413 34.7000, weight 0.0483 evalue: 414 34.7000, weight 0.0483 evalue: 415 34.7000, weight 0.0483 evalue: 416 5.6463, weight 0.2657 evalue: 417 5.6463, weight 0.2657 evalue: 418 5.6463, weight 0.2657 evalue: 419 5.6463, weight 0.2657 evalue: 420 5.6463, weight 0.2657 evalue: 421 5.6463, weight 0.2657 evalue: 422 5.6463, weight 0.2657 evalue: 423 5.6463, weight 0.2657 evalue: 424 5.6463, weight 0.2657 evalue: 425 5.6463, weight 0.2657 evalue: 426 5.6463, weight 0.2657 evalue: 427 5.6463, weight 0.2657 evalue: 428 5.6463, weight 0.2657 evalue: 429 5.6463, weight 0.2657 evalue: 430 5.6463, weight 0.2657 evalue: 431 5.6463, weight 0.2657 evalue: 432 5.6463, weight 0.2657 evalue: 433 5.6463, weight 0.2657 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 17 RES2ATOM 3 28 RES2ATOM 4 40 RES2ATOM 5 45 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 68 RES2ATOM 10 83 RES2ATOM 11 91 RES2ATOM 12 99 RES2ATOM 15 114 RES2ATOM 16 123 RES2ATOM 17 131 RES2ATOM 18 140 RES2ATOM 19 147 RES2ATOM 20 154 RES2ATOM 21 162 RES2ATOM 22 167 RES2ATOM 23 176 RES2ATOM 24 184 RES2ATOM 25 195 RES2ATOM 26 204 RES2ATOM 27 213 RES2ATOM 28 221 RES2ATOM 29 228 RES2ATOM 30 236 RES2ATOM 32 248 RES2ATOM 33 256 RES2ATOM 34 265 RES2ATOM 35 274 RES2ATOM 36 281 RES2ATOM 37 290 RES2ATOM 38 296 RES2ATOM 39 308 RES2ATOM 40 316 RES2ATOM 41 324 RES2ATOM 43 334 RES2ATOM 44 342 RES2ATOM 45 350 RES2ATOM 46 361 RES2ATOM 47 372 RES2ATOM 48 379 RES2ATOM 49 385 RES2ATOM 50 393 RES2ATOM 51 401 RES2ATOM 52 407 RES2ATOM 53 416 RES2ATOM 54 421 RES2ATOM 55 430 RES2ATOM 56 438 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 463 RES2ATOM 60 471 RES2ATOM 61 480 RES2ATOM 62 487 RES2ATOM 63 498 RES2ATOM 64 509 RES2ATOM 65 514 RES2ATOM 66 521 RES2ATOM 67 531 RES2ATOM 68 543 RES2ATOM 69 550 RES2ATOM 70 561 RES2ATOM 71 569 RES2ATOM 72 578 RES2ATOM 73 584 RES2ATOM 74 595 RES2ATOM 75 601 RES2ATOM 76 609 RES2ATOM 77 617 RES2ATOM 78 623 RES2ATOM 79 631 RES2ATOM 80 640 RES2ATOM 81 648 RES2ATOM 82 659 RES2ATOM 83 668 RES2ATOM 84 673 RES2ATOM 85 682 RES2ATOM 86 690 RES2ATOM 87 699 RES2ATOM 88 707 RES2ATOM 89 715 RES2ATOM 90 722 RES2ATOM 91 727 RES2ATOM 92 741 RES2ATOM 93 755 RES2ATOM 94 761 RES2ATOM 95 772 RES2ATOM 96 780 RES2ATOM 97 788 RES2ATOM 98 793 RES2ATOM 99 804 RES2ATOM 100 813 RES2ATOM 101 821 RES2ATOM 102 832 RES2ATOM 103 840 RES2ATOM 104 851 RES2ATOM 105 863 RES2ATOM 106 870 RES2ATOM 108 883 RES2ATOM 109 891 RES2ATOM 110 899 RES2ATOM 111 906 RES2ATOM 112 914 RES2ATOM 113 923 RES2ATOM 114 930 RES2ATOM 115 938 RES2ATOM 116 943 RES2ATOM 117 950 RES2ATOM 118 957 RES2ATOM 119 966 RES2ATOM 120 972 RES2ATOM 121 980 RES2ATOM 122 989 RES2ATOM 123 997 RES2ATOM 124 1006 RES2ATOM 125 1014 RES2ATOM 126 1023 RES2ATOM 127 1030 RES2ATOM 128 1038 RES2ATOM 129 1050 RES2ATOM 131 1065 RES2ATOM 132 1074 RES2ATOM 134 1086 RES2ATOM 135 1094 RES2ATOM 136 1105 RES2ATOM 138 1123 RES2ATOM 139 1132 RES2ATOM 140 1143 RES2ATOM 141 1149 RES2ATOM 142 1158 RES2ATOM 143 1167 RES2ATOM 144 1173 RES2ATOM 145 1185 RES2ATOM 146 1191 RES2ATOM 147 1200 RES2ATOM 148 1207 RES2ATOM 149 1212 RES2ATOM 150 1224 RES2ATOM 151 1234 RES2ATOM 152 1243 RES2ATOM 153 1255 RES2ATOM 154 1263 RES2ATOM 155 1271 RES2ATOM 156 1280 RES2ATOM 157 1287 RES2ATOM 158 1294 RES2ATOM 159 1305 RES2ATOM 160 1317 RES2ATOM 161 1328 RES2ATOM 162 1338 RES2ATOM 163 1346 RES2ATOM 164 1353 RES2ATOM 165 1361 RES2ATOM 166 1372 RES2ATOM 167 1380 RES2ATOM 168 1385 RES2ATOM 169 1394 RES2ATOM 170 1401 RES2ATOM 171 1412 RES2ATOM 172 1420 RES2ATOM 173 1429 RES2ATOM 175 1441 RES2ATOM 176 1450 RES2ATOM 177 1458 RES2ATOM 178 1466 RES2ATOM 179 1475 Constraint 624 871 4.3476 5.4345 10.8690 0.8223 Constraint 649 852 5.3397 6.6747 13.3494 0.6944 Constraint 618 864 5.0907 6.3634 12.7268 0.6753 Constraint 624 864 4.4321 5.5402 11.0803 0.6687 Constraint 585 805 4.5331 5.6664 11.3328 0.6628 Constraint 472 585 5.1306 6.4133 12.8265 0.6149 Constraint 585 822 4.5239 5.6549 11.3098 0.5738 Constraint 185 291 4.6654 5.8318 11.6636 0.5700 Constraint 579 728 5.1095 6.3869 12.7738 0.5626 Constraint 596 822 5.2765 6.5956 13.1912 0.5619 Constraint 624 852 4.9094 6.1367 12.2735 0.5532 Constraint 579 756 4.1483 5.1854 10.3709 0.5507 Constraint 602 841 5.5034 6.8793 13.7586 0.5342 Constraint 585 814 5.2750 6.5937 13.1874 0.5327 Constraint 596 814 4.8245 6.0306 12.0612 0.5192 Constraint 585 833 4.6393 5.7991 11.5981 0.5129 Constraint 649 841 4.7245 5.9057 11.8113 0.5114 Constraint 649 864 5.9282 7.4103 14.8206 0.5076 Constraint 939 1015 4.6215 5.7769 11.5538 0.5073 Constraint 585 789 4.1373 5.1716 10.3432 0.5014 Constraint 610 864 4.1095 5.1369 10.2738 0.4915 Constraint 618 871 4.9883 6.2354 12.4707 0.4775 Constraint 602 822 4.4286 5.5357 11.0714 0.4760 Constraint 579 805 5.4604 6.8255 13.6511 0.4726 Constraint 439 585 4.9720 6.2150 12.4301 0.4699 Constraint 41 282 5.2970 6.6212 13.2425 0.4543 Constraint 309 833 4.5814 5.7268 11.4536 0.4496 Constraint 472 570 3.7407 4.6759 9.3519 0.4477 Constraint 814 1039 4.0342 5.0427 10.0854 0.4392 Constraint 907 973 5.2629 6.5787 13.1574 0.4365 Constraint 185 275 4.2633 5.3292 10.6583 0.4363 Constraint 297 570 5.2090 6.5113 13.0226 0.4357 Constraint 472 562 6.1700 7.7125 15.4251 0.4348 Constraint 610 841 4.8202 6.0253 12.0506 0.4328 Constraint 291 579 5.7751 7.2188 14.4377 0.4309 Constraint 596 833 4.9980 6.2475 12.4950 0.4284 Constraint 464 585 5.5930 6.9913 13.9825 0.4265 Constraint 570 805 4.7584 5.9480 11.8959 0.4250 Constraint 618 852 5.6690 7.0862 14.1724 0.4185 Constraint 291 570 4.3386 5.4232 10.8464 0.4179 Constraint 833 1087 5.6315 7.0393 14.0787 0.4178 Constraint 297 579 4.5212 5.6515 11.3030 0.4130 Constraint 325 852 4.5298 5.6623 11.3245 0.4123 Constraint 54 291 5.0985 6.3731 12.7463 0.4088 Constraint 907 1015 4.1267 5.1584 10.3168 0.4081 Constraint 683 822 5.5728 6.9661 13.9321 0.4073 Constraint 805 1039 5.2772 6.5965 13.1930 0.4056 Constraint 185 266 5.0246 6.2808 12.5616 0.4025 Constraint 1095 1201 5.0456 6.3070 12.6140 0.4013 Constraint 297 585 5.6213 7.0267 14.0533 0.3998 Constraint 841 1087 3.8339 4.7924 9.5847 0.3989 Constraint 822 1087 5.4413 6.8017 13.6034 0.3956 Constraint 46 297 4.5086 5.6358 11.2716 0.3913 Constraint 915 1015 5.6899 7.1124 14.2249 0.3878 Constraint 833 951 5.8037 7.2546 14.5093 0.3847 Constraint 660 742 5.0734 6.3417 12.6835 0.3846 Constraint 297 833 5.7880 7.2350 14.4700 0.3845 Constraint 762 967 5.3269 6.6586 13.3172 0.3839 Constraint 852 1087 5.6635 7.0793 14.1587 0.3838 Constraint 309 579 5.9874 7.4842 14.9685 0.3830 Constraint 54 297 5.4740 6.8425 13.6849 0.3829 Constraint 408 674 4.9223 6.1528 12.3057 0.3825 Constraint 841 1106 5.4981 6.8726 13.7453 0.3812 Constraint 309 841 5.8277 7.2846 14.5692 0.3800 Constraint 297 464 5.6783 7.0978 14.1957 0.3797 Constraint 864 1095 5.9329 7.4161 14.8322 0.3777 Constraint 833 973 4.8525 6.0656 12.1313 0.3759 Constraint 499 579 5.6573 7.0717 14.1433 0.3758 Constraint 325 602 4.2388 5.2986 10.5971 0.3756 Constraint 282 562 5.5554 6.9442 13.8884 0.3755 Constraint 610 822 5.4284 6.7855 13.5710 0.3711 Constraint 596 805 5.6114 7.0143 14.0285 0.3703 Constraint 852 1106 5.8007 7.2509 14.5017 0.3683 Constraint 723 833 4.9672 6.2090 12.4180 0.3678 Constraint 773 967 4.7041 5.8801 11.7602 0.3677 Constraint 291 585 4.8956 6.1195 12.2390 0.3669 Constraint 282 551 5.7420 7.1776 14.3551 0.3665 Constraint 781 973 4.3684 5.4605 10.9210 0.3653 Constraint 297 841 5.0468 6.3085 12.6171 0.3645 Constraint 297 562 4.2057 5.2571 10.5141 0.3641 Constraint 214 291 4.9410 6.1763 12.3525 0.3625 Constraint 317 602 5.0222 6.2777 12.5555 0.3610 Constraint 602 683 5.2584 6.5730 13.1461 0.3608 Constraint 439 674 4.9475 6.1844 12.3689 0.3597 Constraint 335 464 4.8051 6.0064 12.0129 0.3594 Constraint 282 570 4.8645 6.0806 12.1611 0.3548 Constraint 610 833 4.1454 5.1818 10.3635 0.3537 Constraint 602 852 4.9186 6.1482 12.2964 0.3524 Constraint 864 1106 3.3560 4.1950 8.3900 0.3515 Constraint 596 852 5.6601 7.0751 14.1502 0.3510 Constraint 841 1095 6.0949 7.6186 15.2372 0.3508 Constraint 570 723 4.1036 5.1295 10.2590 0.3502 Constraint 852 1039 4.9062 6.1328 12.2655 0.3499 Constraint 841 1051 5.8410 7.3012 14.6025 0.3487 Constraint 596 841 4.9271 6.1589 12.3178 0.3482 Constraint 309 585 3.6803 4.6004 9.2007 0.3480 Constraint 446 585 5.3007 6.6259 13.2518 0.3467 Constraint 317 464 4.3027 5.3784 10.7567 0.3466 Constraint 1095 1402 5.5960 6.9950 13.9900 0.3449 Constraint 841 931 5.8275 7.2844 14.5687 0.3437 Constraint 317 596 4.0999 5.1248 10.2497 0.3436 Constraint 579 794 4.2986 5.3733 10.7465 0.3425 Constraint 852 924 4.4237 5.5296 11.0592 0.3422 Constraint 852 1051 6.1391 7.6739 15.3479 0.3410 Constraint 841 973 5.9632 7.4539 14.9079 0.3401 Constraint 618 841 3.6999 4.6248 9.2497 0.3401 Constraint 596 762 4.6236 5.7795 11.5589 0.3399 Constraint 579 833 5.2816 6.6020 13.2039 0.3388 Constraint 291 562 5.6661 7.0826 14.1653 0.3383 Constraint 335 610 4.8002 6.0003 12.0006 0.3361 Constraint 472 728 4.7204 5.9005 11.8010 0.3357 Constraint 297 510 5.7269 7.1587 14.3173 0.3347 Constraint 335 596 3.8126 4.7657 9.5315 0.3338 Constraint 884 1031 5.8852 7.3564 14.7129 0.3333 Constraint 499 585 5.5320 6.9150 13.8301 0.3332 Constraint 1124 1244 5.4005 6.7506 13.5012 0.3327 Constraint 602 781 5.2546 6.5682 13.1365 0.3324 Constraint 297 455 4.9716 6.2145 12.4291 0.3298 Constraint 683 951 5.3057 6.6321 13.2642 0.3298 Constraint 610 814 6.1182 7.6477 15.2955 0.3288 Constraint 871 1066 5.6411 7.0514 14.1029 0.3284 Constraint 852 1095 4.4078 5.5098 11.0196 0.3276 Constraint 570 794 4.9143 6.1428 12.2857 0.3244 Constraint 297 499 5.2225 6.5281 13.0562 0.3239 Constraint 41 275 5.2196 6.5246 13.0491 0.3230 Constraint 579 723 5.9928 7.4910 14.9819 0.3216 Constraint 177 291 5.6475 7.0593 14.1186 0.3212 Constraint 317 852 6.0080 7.5100 15.0201 0.3206 Constraint 805 1066 5.5632 6.9540 13.9080 0.3197 Constraint 602 742 4.6147 5.7683 11.5367 0.3193 Constraint 822 1066 4.6605 5.8257 11.6513 0.3191 Constraint 585 794 5.4890 6.8613 13.7226 0.3183 Constraint 833 924 5.6671 7.0838 14.1676 0.3176 Constraint 570 756 5.3457 6.6822 13.3644 0.3157 Constraint 177 275 4.9503 6.1879 12.3759 0.3148 Constraint 585 742 4.9558 6.1948 12.3895 0.3148 Constraint 562 756 5.8681 7.3351 14.6702 0.3148 Constraint 155 309 4.6089 5.7611 11.5223 0.3147 Constraint 585 728 5.6199 7.0249 14.0498 0.3144 Constraint 464 579 3.9478 4.9347 9.8695 0.3143 Constraint 649 924 5.7854 7.2318 14.4636 0.3141 Constraint 54 275 5.3242 6.6552 13.3104 0.3138 Constraint 596 944 5.4189 6.7737 13.5474 0.3133 Constraint 683 789 5.8914 7.3643 14.7285 0.3132 Constraint 185 488 5.2481 6.5601 13.1201 0.3123 Constraint 309 602 4.6219 5.7774 11.5547 0.3123 Constraint 602 789 4.4187 5.5234 11.0468 0.3105 Constraint 596 683 5.9875 7.4844 14.9687 0.3098 Constraint 596 708 5.3706 6.7133 13.4265 0.3096 Constraint 499 708 5.6304 7.0380 14.0761 0.3087 Constraint 610 708 5.7856 7.2320 14.4640 0.3084 Constraint 585 723 4.5255 5.6569 11.3139 0.3084 Constraint 585 683 5.2528 6.5660 13.1320 0.3079 Constraint 602 833 5.1805 6.4756 12.9512 0.3069 Constraint 596 742 5.8766 7.3458 14.6915 0.3068 Constraint 46 282 4.5941 5.7426 11.4852 0.3060 Constraint 683 805 5.2069 6.5086 13.0171 0.3058 Constraint 822 1039 5.1843 6.4804 12.9608 0.3057 Constraint 570 728 5.7037 7.1296 14.2592 0.3050 Constraint 317 833 6.0717 7.5897 15.1794 0.3041 Constraint 579 742 6.2159 7.7698 15.5396 0.3037 Constraint 499 841 6.1904 7.7380 15.4761 0.3014 Constraint 814 1031 4.6584 5.8230 11.6460 0.3008 Constraint 309 805 3.3471 4.1839 8.3679 0.3007 Constraint 309 794 6.1006 7.6258 15.2515 0.3007 Constraint 852 973 5.8854 7.3567 14.7135 0.3007 Constraint 610 924 5.2592 6.5740 13.1480 0.3003 Constraint 155 291 4.7525 5.9406 11.8812 0.2995 Constraint 317 585 5.5517 6.9397 13.8793 0.2990 Constraint 794 1039 6.0795 7.5994 15.1988 0.2990 Constraint 309 781 5.0049 6.2561 12.5122 0.2990 Constraint 297 805 5.0678 6.3347 12.6694 0.2990 Constraint 291 794 5.9568 7.4460 14.8921 0.2990 Constraint 833 1075 6.1805 7.7257 15.4513 0.2976 Constraint 472 579 5.5287 6.9109 13.8219 0.2971 Constraint 185 522 4.8704 6.0880 12.1759 0.2965 Constraint 317 579 5.3158 6.6448 13.2896 0.2961 Constraint 683 833 5.2575 6.5719 13.1437 0.2940 Constraint 610 683 4.2051 5.2564 10.5128 0.2939 Constraint 794 1015 5.3436 6.6795 13.3590 0.2939 Constraint 510 708 3.9597 4.9496 9.8992 0.2938 Constraint 871 1106 5.5870 6.9838 13.9676 0.2932 Constraint 596 756 5.8466 7.3083 14.6166 0.2931 Constraint 585 756 5.8084 7.2605 14.5210 0.2931 Constraint 335 841 5.9429 7.4286 14.8571 0.2926 Constraint 833 1066 5.8838 7.3548 14.7096 0.2925 Constraint 317 841 4.3656 5.4571 10.9141 0.2904 Constraint 833 1031 5.7755 7.2194 14.4387 0.2903 Constraint 325 841 5.5512 6.9389 13.8779 0.2901 Constraint 54 282 4.9201 6.1501 12.3002 0.2896 Constraint 814 1024 5.4262 6.7828 13.5656 0.2874 Constraint 325 944 5.6355 7.0444 14.0888 0.2874 Constraint 805 1031 5.6926 7.1158 14.2316 0.2863 Constraint 683 967 4.9498 6.1873 12.3746 0.2859 Constraint 624 900 4.5735 5.7169 11.4338 0.2850 Constraint 814 973 4.4540 5.5675 11.1350 0.2849 Constraint 618 833 6.1196 7.6495 15.2990 0.2848 Constraint 805 1024 4.5939 5.7424 11.4847 0.2825 Constraint 46 585 4.7553 5.9442 11.8883 0.2824 Constraint 814 1015 4.0422 5.0528 10.1055 0.2817 Constraint 805 1015 4.8581 6.0726 12.1453 0.2817 Constraint 579 789 4.2394 5.2992 10.5985 0.2815 Constraint 335 602 4.5622 5.7027 11.4055 0.2801 Constraint 431 674 4.4388 5.5485 11.0970 0.2796 Constraint 309 789 3.9834 4.9793 9.9585 0.2783 Constraint 54 177 5.2211 6.5263 13.0527 0.2761 Constraint 249 499 4.9191 6.1489 12.2978 0.2745 Constraint 579 822 5.1080 6.3850 12.7699 0.2744 Constraint 291 814 4.6120 5.7650 11.5301 0.2742 Constraint 510 723 5.6873 7.1092 14.2183 0.2729 Constraint 683 781 4.0761 5.0951 10.1902 0.2722 Constraint 596 728 5.9366 7.4208 14.8415 0.2717 Constraint 510 742 6.2360 7.7950 15.5899 0.2715 Constraint 291 805 3.4538 4.3172 8.6344 0.2714 Constraint 579 814 4.9058 6.1322 12.2644 0.2711 Constraint 610 884 5.1649 6.4562 12.9124 0.2710 Constraint 814 1066 3.5215 4.4019 8.8038 0.2696 Constraint 297 822 3.9581 4.9476 9.8952 0.2688 Constraint 649 833 5.2996 6.6244 13.2489 0.2685 Constraint 275 562 4.2181 5.2726 10.5452 0.2685 Constraint 257 532 5.7200 7.1500 14.3000 0.2685 Constraint 249 532 3.9253 4.9066 9.8131 0.2685 Constraint 931 1213 5.3850 6.7312 13.4625 0.2669 Constraint 291 822 5.6334 7.0417 14.0835 0.2651 Constraint 683 931 5.6158 7.0197 14.0394 0.2637 Constraint 822 1075 4.7455 5.9318 11.8636 0.2635 Constraint 510 756 3.9898 4.9873 9.9746 0.2633 Constraint 282 814 4.6269 5.7836 11.5672 0.2622 Constraint 317 864 5.5688 6.9610 13.9220 0.2621 Constraint 510 716 4.9508 6.1884 12.3769 0.2620 Constraint 610 951 4.8521 6.0652 12.1303 0.2610 Constraint 499 723 5.4003 6.7504 13.5008 0.2609 Constraint 596 789 3.2741 4.0926 8.1852 0.2606 Constraint 579 781 5.0313 6.2891 12.5782 0.2604 Constraint 649 900 4.1221 5.1527 10.3053 0.2593 Constraint 841 1039 5.3113 6.6391 13.2782 0.2585 Constraint 464 674 5.2742 6.5927 13.1855 0.2584 Constraint 544 756 6.0046 7.5057 15.0114 0.2576 Constraint 325 833 4.3539 5.4424 10.8848 0.2576 Constraint 325 781 4.3375 5.4218 10.8437 0.2576 Constraint 309 822 5.8312 7.2890 14.5779 0.2576 Constraint 275 822 3.5023 4.3779 8.7557 0.2576 Constraint 275 814 4.8657 6.0822 12.1643 0.2576 Constraint 275 532 5.6987 7.1233 14.2466 0.2576 Constraint 249 562 5.4962 6.8702 13.7405 0.2576 Constraint 249 522 5.8039 7.2548 14.5096 0.2576 Constraint 579 841 5.0052 6.2565 12.5130 0.2548 Constraint 325 973 5.2355 6.5443 13.0887 0.2527 Constraint 439 841 5.1707 6.4634 12.9268 0.2503 Constraint 155 282 5.2966 6.6208 13.2415 0.2492 Constraint 499 805 5.6718 7.0897 14.1794 0.2476 Constraint 317 455 4.9106 6.1382 12.2764 0.2464 Constraint 864 1066 5.4995 6.8744 13.7489 0.2455 Constraint 62 309 5.7832 7.2290 14.4579 0.2448 Constraint 618 822 5.5657 6.9572 13.9143 0.2442 Constraint 62 177 5.4819 6.8524 13.7048 0.2430 Constraint 624 841 5.4979 6.8724 13.7447 0.2421 Constraint 185 499 5.7329 7.1661 14.3322 0.2420 Constraint 1124 1256 3.9464 4.9331 9.8661 0.2420 Constraint 472 742 6.0596 7.5745 15.1489 0.2407 Constraint 728 833 4.7035 5.8793 11.7587 0.2404 Constraint 54 602 5.6821 7.1027 14.2054 0.2403 Constraint 1095 1264 5.8675 7.3343 14.6687 0.2402 Constraint 54 309 3.9901 4.9876 9.9752 0.2398 Constraint 570 814 4.3570 5.4463 10.8925 0.2396 Constraint 1150 1225 4.0422 5.0528 10.1055 0.2392 Constraint 362 431 4.9564 6.1955 12.3909 0.2391 Constraint 781 944 5.5884 6.9855 13.9710 0.2386 Constraint 610 931 6.1346 7.6683 15.3366 0.2379 Constraint 431 1051 6.0120 7.5150 15.0301 0.2371 Constraint 781 967 3.9670 4.9588 9.9176 0.2369 Constraint 41 585 5.3543 6.6928 13.3857 0.2357 Constraint 852 1124 5.7908 7.2386 14.4771 0.2356 Constraint 596 951 5.1265 6.4081 12.8162 0.2350 Constraint 585 841 4.9339 6.1673 12.3346 0.2342 Constraint 562 716 3.8731 4.8414 9.6827 0.2338 Constraint 562 708 6.0779 7.5974 15.1948 0.2338 Constraint 931 1256 6.2221 7.7777 15.5553 0.2337 Constraint 46 177 5.2921 6.6151 13.2303 0.2332 Constraint 660 924 4.2188 5.2735 10.5470 0.2330 Constraint 499 1039 5.7001 7.1252 14.2504 0.2326 Constraint 762 944 5.1499 6.4373 12.8747 0.2322 Constraint 46 309 5.7312 7.1641 14.3281 0.2305 Constraint 464 596 4.3433 5.4292 10.8584 0.2300 Constraint 723 841 5.0192 6.2740 12.5480 0.2295 Constraint 41 297 5.3735 6.7169 13.4338 0.2290 Constraint 41 291 4.3872 5.4840 10.9680 0.2290 Constraint 439 602 6.1397 7.6747 15.3494 0.2285 Constraint 596 973 4.4233 5.5291 11.0582 0.2282 Constraint 439 708 4.3368 5.4210 10.8419 0.2279 Constraint 54 155 4.3412 5.4266 10.8531 0.2269 Constraint 41 214 5.2721 6.5902 13.1804 0.2269 Constraint 177 1106 5.4688 6.8360 13.6719 0.2258 Constraint 54 585 5.1871 6.4839 12.9678 0.2249 Constraint 794 1024 4.8876 6.1095 12.2190 0.2249 Constraint 958 1256 3.9549 4.9436 9.8873 0.2233 Constraint 54 185 5.4088 6.7610 13.5221 0.2227 Constraint 931 1225 5.8265 7.2831 14.5663 0.2219 Constraint 610 852 5.1467 6.4334 12.8668 0.2217 Constraint 464 728 5.8061 7.2576 14.5153 0.2213 Constraint 841 951 4.6327 5.7908 11.5816 0.2212 Constraint 632 900 5.4449 6.8062 13.6123 0.2210 Constraint 660 944 4.8964 6.1205 12.2409 0.2203 Constraint 297 431 5.1803 6.4754 12.9508 0.2202 Constraint 46 275 4.1414 5.1768 10.3535 0.2195 Constraint 562 723 4.8061 6.0077 12.0154 0.2192 Constraint 373 610 5.0992 6.3740 12.7480 0.2191 Constraint 464 570 5.0186 6.2732 12.5464 0.2188 Constraint 1159 1295 5.6360 7.0450 14.0900 0.2182 Constraint 618 1373 5.7373 7.1717 14.3434 0.2182 Constraint 618 1362 5.5849 6.9811 13.9622 0.2182 Constraint 596 1015 5.8464 7.3080 14.6160 0.2181 Constraint 62 291 4.9711 6.2139 12.4278 0.2172 Constraint 562 728 5.6265 7.0331 14.0662 0.2170 Constraint 833 1024 5.0557 6.3196 12.6393 0.2163 Constraint 1150 1256 5.5296 6.9119 13.8239 0.2162 Constraint 1144 1264 5.4108 6.7635 13.5270 0.2162 Constraint 1144 1256 3.7151 4.6438 9.2877 0.2162 Constraint 1133 1256 5.3792 6.7240 13.4480 0.2162 Constraint 649 822 4.8885 6.1106 12.2212 0.2159 Constraint 691 789 5.3669 6.7086 13.4172 0.2152 Constraint 124 309 5.5216 6.9019 13.8039 0.2149 Constraint 309 596 5.7659 7.2074 14.4148 0.2146 Constraint 69 309 5.4937 6.8672 13.7343 0.2137 Constraint 41 249 4.8954 6.1193 12.2386 0.2129 Constraint 41 579 4.3284 5.4105 10.8211 0.2121 Constraint 351 610 5.4015 6.7519 13.5038 0.2118 Constraint 951 1225 5.1355 6.4194 12.8387 0.2115 Constraint 814 981 4.7684 5.9606 11.9211 0.2113 Constraint 1150 1373 5.6632 7.0790 14.1580 0.2109 Constraint 335 455 4.9100 6.1376 12.2751 0.2107 Constraint 1031 1295 4.0185 5.0231 10.0462 0.2096 Constraint 1031 1281 4.5373 5.6716 11.3432 0.2096 Constraint 981 1264 3.7016 4.6270 9.2539 0.2092 Constraint 931 1031 5.5052 6.8816 13.7631 0.2074 Constraint 431 649 5.6757 7.0946 14.1892 0.2074 Constraint 789 973 5.2101 6.5126 13.0252 0.2074 Constraint 683 794 4.3748 5.4685 10.9370 0.2067 Constraint 951 1430 5.0028 6.2535 12.5071 0.2065 Constraint 924 1430 4.2008 5.2510 10.5019 0.2065 Constraint 900 1421 6.1768 7.7210 15.4421 0.2065 Constraint 951 1024 4.5343 5.6679 11.3357 0.2063 Constraint 46 596 5.8619 7.3274 14.6548 0.2059 Constraint 472 708 4.6715 5.8393 11.6787 0.2053 Constraint 1015 1106 5.1309 6.4136 12.8273 0.2048 Constraint 1264 1354 5.8863 7.3578 14.7156 0.2046 Constraint 1144 1395 5.8823 7.3529 14.7057 0.2046 Constraint 41 1459 5.7335 7.1669 14.3338 0.2045 Constraint 351 596 5.7400 7.1750 14.3500 0.2044 Constraint 439 649 5.2199 6.5248 13.0497 0.2038 Constraint 84 317 5.6173 7.0216 14.0431 0.2034 Constraint 62 317 4.7818 5.9773 11.9545 0.2031 Constraint 1133 1373 5.3388 6.6735 13.3469 0.2027 Constraint 596 723 5.6540 7.0675 14.1351 0.2026 Constraint 570 833 5.1556 6.4445 12.8889 0.2025 Constraint 822 1024 5.1122 6.3902 12.7805 0.2018 Constraint 958 1459 3.9806 4.9757 9.9514 0.2014 Constraint 931 1459 4.2807 5.3509 10.7018 0.2014 Constraint 931 1451 4.1456 5.1820 10.3640 0.2014 Constraint 931 1430 5.0416 6.3019 12.6039 0.2014 Constraint 1144 1362 4.7757 5.9696 11.9392 0.2012 Constraint 814 951 4.4964 5.6206 11.2411 0.2008 Constraint 981 1281 4.1374 5.1717 10.3435 0.2003 Constraint 455 864 5.2116 6.5145 13.0289 0.1999 Constraint 585 852 5.6213 7.0266 14.0532 0.1995 Constraint 408 649 4.4296 5.5370 11.0741 0.1994 Constraint 46 464 4.4094 5.5117 11.0234 0.1991 Constraint 46 455 4.5792 5.7240 11.4480 0.1991 Constraint 46 431 5.3190 6.6488 13.2976 0.1991 Constraint 822 1015 4.4619 5.5774 11.1547 0.1989 Constraint 1031 1306 4.0284 5.0354 10.0709 0.1986 Constraint 1031 1288 6.1563 7.6954 15.3908 0.1986 Constraint 1024 1306 4.6308 5.7885 11.5770 0.1986 Constraint 990 1264 4.4979 5.6224 11.2448 0.1986 Constraint 981 1225 5.3095 6.6369 13.2737 0.1986 Constraint 958 1264 4.2069 5.2586 10.5172 0.1986 Constraint 958 1225 5.0619 6.3274 12.6548 0.1986 Constraint 488 1421 6.1393 7.6741 15.3483 0.1986 Constraint 488 1386 5.2882 6.6102 13.2204 0.1986 Constraint 488 1339 4.7277 5.9096 11.8192 0.1986 Constraint 488 1318 6.2653 7.8316 15.6632 0.1986 Constraint 624 924 4.2007 5.2508 10.5016 0.1968 Constraint 62 602 4.1926 5.2407 10.4814 0.1958 Constraint 1174 1264 5.1540 6.4425 12.8850 0.1955 Constraint 1144 1373 3.6866 4.6082 9.2165 0.1955 Constraint 1124 1354 4.6340 5.7925 11.5850 0.1955 Constraint 990 1467 6.2636 7.8295 15.6589 0.1955 Constraint 981 1467 3.5203 4.4004 8.8007 0.1955 Constraint 981 1459 4.6255 5.7819 11.5639 0.1955 Constraint 973 1459 6.0291 7.5363 15.0727 0.1955 Constraint 958 1467 4.7692 5.9615 11.9230 0.1955 Constraint 951 1459 2.9793 3.7241 7.4483 0.1955 Constraint 924 1459 6.0956 7.6195 15.2390 0.1955 Constraint 900 1451 6.2060 7.7575 15.5150 0.1955 Constraint 900 1430 5.1675 6.4593 12.9187 0.1955 Constraint 455 841 6.2485 7.8106 15.6212 0.1955 Constraint 852 1066 5.4838 6.8548 13.7095 0.1951 Constraint 46 579 5.0486 6.3108 12.6216 0.1948 Constraint 317 431 4.6391 5.7989 11.5977 0.1945 Constraint 931 1015 4.5862 5.7328 11.4655 0.1935 Constraint 41 596 4.6994 5.8742 11.7484 0.1928 Constraint 222 291 5.5498 6.9372 13.8745 0.1925 Constraint 297 814 6.0685 7.5856 15.1711 0.1920 Constraint 610 871 4.8154 6.0193 12.0385 0.1920 Constraint 833 931 5.6764 7.0955 14.1911 0.1886 Constraint 46 214 6.0512 7.5640 15.1279 0.1879 Constraint 1095 1256 5.9313 7.4141 14.8282 0.1869 Constraint 362 596 4.9899 6.2373 12.4747 0.1866 Constraint 46 488 5.2263 6.5329 13.0658 0.1864 Constraint 351 602 4.3786 5.4732 10.9465 0.1860 Constraint 155 674 5.9911 7.4889 14.9779 0.1859 Constraint 660 833 6.2109 7.7637 15.5274 0.1858 Constraint 691 773 5.8500 7.3125 14.6250 0.1853 Constraint 41 257 6.0433 7.5541 15.1082 0.1852 Constraint 124 618 4.7066 5.8832 11.7664 0.1849 Constraint 632 924 5.8005 7.2506 14.5012 0.1847 Constraint 1256 1354 4.2808 5.3511 10.7021 0.1846 Constraint 41 266 5.1349 6.4186 12.8373 0.1846 Constraint 1024 1095 5.0805 6.3506 12.7013 0.1838 Constraint 1095 1213 5.9672 7.4591 14.9181 0.1835 Constraint 84 618 5.3993 6.7491 13.4983 0.1834 Constraint 69 362 5.6517 7.0647 14.1293 0.1820 Constraint 833 1051 4.1893 5.2366 10.4732 0.1811 Constraint 833 1039 5.3878 6.7348 13.4696 0.1811 Constraint 723 822 5.4439 6.8048 13.6096 0.1797 Constraint 602 864 5.3429 6.6786 13.3571 0.1795 Constraint 132 864 5.6760 7.0950 14.1899 0.1786 Constraint 41 570 4.8298 6.0373 12.0746 0.1784 Constraint 1124 1213 5.2928 6.6160 13.2321 0.1779 Constraint 54 1430 5.9844 7.4804 14.9609 0.1774 Constraint 41 1430 4.8813 6.1016 12.2031 0.1774 Constraint 789 1015 4.8961 6.1201 12.2402 0.1773 Constraint 723 864 5.7101 7.1376 14.2753 0.1766 Constraint 841 990 4.0499 5.0623 10.1247 0.1763 Constraint 297 488 4.2632 5.3291 10.6581 0.1754 Constraint 1159 1386 5.3980 6.7475 13.4951 0.1749 Constraint 1159 1381 5.5766 6.9707 13.9414 0.1749 Constraint 1159 1373 4.3992 5.4990 10.9980 0.1749 Constraint 1144 1354 3.7973 4.7466 9.4932 0.1749 Constraint 1133 1402 5.9993 7.4991 14.9981 0.1749 Constraint 1133 1381 4.2148 5.2685 10.5370 0.1749 Constraint 1133 1362 6.0344 7.5430 15.0859 0.1749 Constraint 884 1339 5.8905 7.3631 14.7261 0.1749 Constraint 596 864 5.2402 6.5503 13.1005 0.1746 Constraint 1201 1295 5.5756 6.9695 13.9390 0.1745 Constraint 852 951 5.6374 7.0467 14.0935 0.1742 Constraint 649 871 5.2215 6.5268 13.0536 0.1731 Constraint 205 1192 3.7182 4.6478 9.2956 0.1727 Constraint 660 973 5.0384 6.2980 12.5960 0.1724 Constraint 683 852 4.9437 6.1797 12.3593 0.1719 Constraint 29 266 5.4212 6.7765 13.5531 0.1719 Constraint 155 610 5.7064 7.1329 14.2659 0.1713 Constraint 1133 1213 5.9552 7.4440 14.8880 0.1711 Constraint 649 794 5.8725 7.3406 14.6813 0.1710 Constraint 1095 1225 5.1769 6.4712 12.9424 0.1708 Constraint 141 624 5.6462 7.0577 14.1154 0.1705 Constraint 822 1051 6.1276 7.6595 15.3190 0.1701 Constraint 1144 1225 5.8448 7.3060 14.6119 0.1695 Constraint 54 596 4.0429 5.0536 10.1071 0.1690 Constraint 1201 1288 5.7018 7.1273 14.2546 0.1684 Constraint 1066 1354 5.3832 6.7290 13.4581 0.1684 Constraint 1066 1347 2.4049 3.0061 6.0122 0.1684 Constraint 1066 1339 5.4916 6.8645 13.7291 0.1684 Constraint 1066 1329 5.2778 6.5973 13.1946 0.1684 Constraint 1051 1339 5.8271 7.2839 14.5677 0.1684 Constraint 1051 1329 3.8144 4.7680 9.5360 0.1684 Constraint 1051 1318 5.8613 7.3267 14.6533 0.1684 Constraint 1051 1295 3.3471 4.1839 8.3678 0.1684 Constraint 1051 1201 4.9581 6.1977 12.3953 0.1684 Constraint 1039 1339 5.5333 6.9166 13.8332 0.1684 Constraint 1039 1329 6.1027 7.6284 15.2568 0.1684 Constraint 1039 1318 3.8699 4.8373 9.6746 0.1684 Constraint 1039 1306 5.2639 6.5799 13.1597 0.1684 Constraint 1039 1295 4.7034 5.8792 11.7584 0.1684 Constraint 168 641 4.8096 6.0120 12.0240 0.1684 Constraint 148 674 4.0158 5.0197 10.0394 0.1684 Constraint 148 669 4.9312 6.1640 12.3279 0.1684 Constraint 148 649 5.7608 7.2010 14.4019 0.1684 Constraint 148 641 3.8642 4.8302 9.6604 0.1684 Constraint 141 649 6.2199 7.7749 15.5498 0.1684 Constraint 141 641 3.8836 4.8545 9.7090 0.1684 Constraint 69 1354 4.2692 5.3365 10.6730 0.1684 Constraint 69 1347 3.3566 4.1958 8.3915 0.1684 Constraint 69 1066 3.0839 3.8549 7.7098 0.1684 Constraint 54 1395 5.1088 6.3860 12.7720 0.1684 Constraint 54 1354 5.8357 7.2946 14.5891 0.1684 Constraint 18 1459 5.2262 6.5328 13.0656 0.1684 Constraint 62 275 5.7881 7.2351 14.4702 0.1683 Constraint 362 674 5.9083 7.3854 14.7709 0.1682 Constraint 833 1225 5.7780 7.2225 14.4451 0.1682 Constraint 69 291 5.9253 7.4066 14.8133 0.1679 Constraint 1159 1306 5.1808 6.4760 12.9521 0.1676 Constraint 488 570 4.7535 5.9419 11.8838 0.1673 Constraint 46 570 4.5955 5.7444 11.4888 0.1654 Constraint 155 275 3.8566 4.8208 9.6416 0.1653 Constraint 728 924 5.6734 7.0917 14.1834 0.1651 Constraint 649 931 5.4095 6.7619 13.5238 0.1650 Constraint 185 282 5.3888 6.7360 13.4720 0.1648 Constraint 649 973 5.3498 6.6872 13.3745 0.1644 Constraint 464 544 6.2358 7.7947 15.5895 0.1642 Constraint 124 841 3.6582 4.5728 9.1455 0.1639 Constraint 46 291 5.2269 6.5337 13.0673 0.1637 Constraint 249 1256 5.5735 6.9668 13.9337 0.1636 Constraint 237 1225 4.5218 5.6523 11.3046 0.1636 Constraint 177 1213 5.7610 7.2013 14.4026 0.1636 Constraint 373 618 4.8944 6.1180 12.2360 0.1636 Constraint 833 1201 5.2610 6.5762 13.1524 0.1635 Constraint 822 990 4.2649 5.3312 10.6623 0.1635 Constraint 833 1295 5.6321 7.0402 14.0803 0.1633 Constraint 602 814 5.2439 6.5549 13.1098 0.1630 Constraint 464 683 5.7978 7.2473 14.4945 0.1628 Constraint 742 833 4.7521 5.9401 11.8802 0.1628 Constraint 373 602 5.4336 6.7919 13.5839 0.1627 Constraint 833 1015 4.6242 5.7802 11.5604 0.1626 Constraint 46 266 4.7770 5.9713 11.9426 0.1625 Constraint 29 282 4.3484 5.4355 10.8710 0.1624 Constraint 124 1066 5.3469 6.6836 13.3671 0.1622 Constraint 124 852 3.8719 4.8399 9.6797 0.1622 Constraint 951 1133 3.6290 4.5363 9.0725 0.1616 Constraint 69 343 5.1416 6.4271 12.8541 0.1607 Constraint 660 852 5.8197 7.2747 14.5493 0.1607 Constraint 674 967 4.6473 5.8092 11.6183 0.1606 Constraint 674 931 5.0240 6.2800 12.5599 0.1606 Constraint 92 335 3.7513 4.6891 9.3783 0.1603 Constraint 1095 1430 6.0333 7.5417 15.0833 0.1602 Constraint 822 1031 5.6034 7.0042 14.0084 0.1599 Constraint 54 317 5.4182 6.7728 13.5456 0.1598 Constraint 833 944 5.1220 6.4025 12.8050 0.1590 Constraint 417 674 6.0338 7.5422 15.0845 0.1588 Constraint 864 951 5.5446 6.9308 13.8616 0.1586 Constraint 373 649 5.4708 6.8385 13.6771 0.1583 Constraint 951 1031 4.7820 5.9775 11.9550 0.1581 Constraint 62 596 5.3513 6.6891 13.3783 0.1581 Constraint 84 148 6.0535 7.5669 15.1338 0.1580 Constraint 163 275 6.0849 7.6061 15.2123 0.1563 Constraint 177 1192 4.6106 5.7633 11.5266 0.1557 Constraint 168 1192 5.3626 6.7032 13.4064 0.1557 Constraint 282 1430 5.0282 6.2853 12.5705 0.1552 Constraint 282 1421 5.7090 7.1362 14.2724 0.1552 Constraint 282 1395 6.0770 7.5963 15.1926 0.1552 Constraint 69 317 5.4139 6.7674 13.5348 0.1551 Constraint 691 781 5.4175 6.7718 13.5437 0.1544 Constraint 691 951 5.7365 7.1707 14.3414 0.1540 Constraint 822 981 4.9275 6.1594 12.3187 0.1539 Constraint 1024 1106 4.9588 6.1985 12.3971 0.1539 Constraint 408 700 5.7175 7.1469 14.2938 0.1535 Constraint 1144 1213 5.2213 6.5266 13.0531 0.1534 Constraint 958 1133 4.9974 6.2468 12.4935 0.1532 Constraint 54 610 5.7302 7.1627 14.3254 0.1530 Constraint 841 1133 4.5409 5.6761 11.3522 0.1526 Constraint 833 1133 5.9052 7.3815 14.7631 0.1526 Constraint 69 852 6.3071 7.8839 15.7678 0.1511 Constraint 177 596 5.3489 6.6861 13.3723 0.1507 Constraint 674 814 5.9849 7.4811 14.9622 0.1501 Constraint 472 773 6.0757 7.5946 15.1893 0.1496 Constraint 69 155 5.4466 6.8082 13.6164 0.1493 Constraint 1201 1459 5.9732 7.4665 14.9331 0.1493 Constraint 1066 1395 6.0358 7.5448 15.0895 0.1493 Constraint 728 931 5.1829 6.4786 12.9571 0.1493 Constraint 309 551 4.3210 5.4013 10.8026 0.1491 Constraint 931 1133 4.0344 5.0430 10.0860 0.1488 Constraint 1015 1095 5.1014 6.3768 12.7536 0.1486 Constraint 132 852 3.6114 4.5143 9.0285 0.1484 Constraint 69 618 6.0651 7.5814 15.1628 0.1472 Constraint 132 871 4.0279 5.0348 10.0697 0.1471 Constraint 132 649 5.5496 6.9370 13.8741 0.1471 Constraint 132 641 5.4504 6.8130 13.6260 0.1471 Constraint 132 624 4.0751 5.0938 10.1876 0.1471 Constraint 132 618 6.3422 7.9278 15.8556 0.1471 Constraint 723 900 5.5985 6.9981 13.9962 0.1470 Constraint 185 309 5.6469 7.0586 14.1172 0.1467 Constraint 214 1225 5.0809 6.3512 12.7024 0.1467 Constraint 205 1225 5.1140 6.3925 12.7851 0.1467 Constraint 431 579 4.5701 5.7126 11.4252 0.1466 Constraint 674 852 5.8189 7.2737 14.5473 0.1466 Constraint 1213 1295 5.2781 6.5976 13.1952 0.1461 Constraint 618 884 5.3475 6.6844 13.3688 0.1461 Constraint 756 833 5.7655 7.2069 14.4138 0.1457 Constraint 728 864 5.7223 7.1529 14.3058 0.1456 Constraint 408 669 4.6669 5.8337 11.6674 0.1455 Constraint 69 610 4.8809 6.1012 12.2023 0.1454 Constraint 522 649 6.2602 7.8252 15.6504 0.1444 Constraint 84 335 4.6168 5.7710 11.5420 0.1434 Constraint 864 1087 5.4405 6.8006 13.6013 0.1430 Constraint 852 944 5.3241 6.6551 13.3102 0.1429 Constraint 362 610 3.8250 4.7812 9.5624 0.1426 Constraint 852 1133 5.4404 6.8005 13.6010 0.1413 Constraint 115 309 5.3640 6.7050 13.4101 0.1411 Constraint 124 624 6.2204 7.7755 15.5510 0.1410 Constraint 62 585 4.9145 6.1431 12.2863 0.1409 Constraint 683 814 4.9915 6.2393 12.4786 0.1405 Constraint 317 522 5.2957 6.6196 13.2392 0.1398 Constraint 833 1256 5.8826 7.3532 14.7064 0.1396 Constraint 394 624 5.8379 7.2973 14.5947 0.1394 Constraint 728 841 6.1515 7.6894 15.3789 0.1392 Constraint 931 1024 4.3068 5.3836 10.7671 0.1391 Constraint 373 641 4.5253 5.6566 11.3133 0.1386 Constraint 62 610 5.4761 6.8452 13.6904 0.1383 Constraint 439 700 5.5883 6.9854 13.9709 0.1383 Constraint 464 708 5.6157 7.0196 14.0393 0.1381 Constraint 499 649 4.9744 6.2179 12.4359 0.1379 Constraint 610 915 5.0690 6.3363 12.6726 0.1378 Constraint 762 841 4.9290 6.1612 12.3225 0.1378 Constraint 148 291 5.6022 7.0028 14.0055 0.1377 Constraint 141 291 5.9528 7.4410 14.8819 0.1377 Constraint 683 990 4.6291 5.7864 11.5728 0.1376 Constraint 852 931 4.2863 5.3578 10.7157 0.1372 Constraint 833 915 5.0893 6.3616 12.7232 0.1371 Constraint 951 1087 5.2877 6.6097 13.2193 0.1371 Constraint 325 762 5.5033 6.8791 13.7582 0.1369 Constraint 177 602 5.0732 6.3415 12.6829 0.1368 Constraint 833 981 5.2113 6.5141 13.0283 0.1363 Constraint 1024 1133 5.2888 6.6110 13.2220 0.1361 Constraint 522 669 5.0436 6.3045 12.6091 0.1357 Constraint 852 1150 5.9212 7.4015 14.8029 0.1356 Constraint 742 841 5.7935 7.2418 14.4837 0.1352 Constraint 660 951 5.3360 6.6699 13.3399 0.1347 Constraint 951 1467 6.3228 7.9036 15.8071 0.1335 Constraint 282 805 6.3486 7.9357 15.8714 0.1335 Constraint 833 990 5.4450 6.8063 13.6126 0.1333 Constraint 132 841 5.6199 7.0249 14.0497 0.1333 Constraint 362 618 5.9409 7.4261 14.8523 0.1332 Constraint 683 841 4.9642 6.2053 12.4106 0.1327 Constraint 155 602 4.3183 5.3979 10.7958 0.1325 Constraint 431 596 5.2628 6.5785 13.1570 0.1325 Constraint 351 585 5.1572 6.4465 12.8930 0.1325 Constraint 351 674 5.0106 6.2633 12.5266 0.1324 Constraint 570 822 5.5533 6.9416 13.8833 0.1322 Constraint 124 1347 6.2364 7.7955 15.5910 0.1319 Constraint 124 674 6.1327 7.6659 15.3318 0.1319 Constraint 124 649 4.2272 5.2840 10.5679 0.1319 Constraint 728 900 3.0578 3.8222 7.6445 0.1319 Constraint 833 1124 3.8779 4.8474 9.6948 0.1308 Constraint 408 641 4.7307 5.9133 11.8266 0.1297 Constraint 62 297 4.8645 6.0806 12.1612 0.1291 Constraint 773 951 5.5778 6.9722 13.9445 0.1285 Constraint 773 931 5.9916 7.4895 14.9790 0.1285 Constraint 762 931 5.0229 6.2787 12.5574 0.1285 Constraint 924 1024 5.2170 6.5213 13.0426 0.1277 Constraint 624 944 4.2014 5.2518 10.5036 0.1277 Constraint 841 924 5.0685 6.3357 12.6714 0.1276 Constraint 602 674 5.3395 6.6743 13.3486 0.1274 Constraint 924 1031 5.4063 6.7578 13.5157 0.1265 Constraint 464 841 5.4507 6.8134 13.6268 0.1265 Constraint 115 317 5.1923 6.4904 12.9808 0.1261 Constraint 674 794 3.4503 4.3129 8.6259 0.1252 Constraint 841 1031 5.0820 6.3525 12.7050 0.1248 Constraint 708 805 4.9216 6.1520 12.3041 0.1247 Constraint 100 610 5.4893 6.8616 13.7232 0.1246 Constraint 924 1133 5.7272 7.1590 14.3179 0.1245 Constraint 794 1031 6.1600 7.7000 15.4001 0.1241 Constraint 325 789 5.8739 7.3424 14.6849 0.1241 Constraint 249 822 6.3710 7.9637 15.9274 0.1241 Constraint 394 464 5.2226 6.5283 13.0566 0.1237 Constraint 551 728 5.6470 7.0588 14.1176 0.1232 Constraint 551 716 3.7113 4.6391 9.2782 0.1232 Constraint 41 1256 5.8986 7.3733 14.7466 0.1232 Constraint 291 674 6.1829 7.7286 15.4571 0.1230 Constraint 683 973 4.7436 5.9295 11.8591 0.1229 Constraint 362 602 5.4537 6.8171 13.6343 0.1227 Constraint 343 422 5.0861 6.3577 12.7153 0.1225 Constraint 84 309 4.0071 5.0088 10.0177 0.1225 Constraint 291 510 5.7644 7.2055 14.4110 0.1224 Constraint 439 669 5.5030 6.8788 13.7575 0.1224 Constraint 177 488 4.7807 5.9758 11.9516 0.1222 Constraint 632 1373 6.3149 7.8936 15.7872 0.1219 Constraint 700 794 5.0526 6.3158 12.6315 0.1218 Constraint 124 610 5.6736 7.0920 14.1839 0.1214 Constraint 674 841 4.7310 5.9138 11.8275 0.1214 Constraint 472 756 5.8368 7.2960 14.5919 0.1211 Constraint 660 900 3.5294 4.4117 8.8235 0.1209 Constraint 380 641 4.4993 5.6241 11.2483 0.1206 Constraint 309 852 4.1720 5.2151 10.4301 0.1206 Constraint 660 756 5.1795 6.4744 12.9488 0.1205 Constraint 84 325 5.0800 6.3500 12.7001 0.1203 Constraint 282 579 4.6635 5.8294 11.6589 0.1201 Constraint 362 641 4.8826 6.1033 12.2065 0.1201 Constraint 649 762 5.5944 6.9930 13.9859 0.1199 Constraint 1124 1208 5.6222 7.0277 14.0555 0.1188 Constraint 335 431 5.3289 6.6611 13.3222 0.1185 Constraint 649 805 5.5221 6.9027 13.8053 0.1184 Constraint 852 1213 5.4806 6.8507 13.7014 0.1183 Constraint 649 781 4.5863 5.7329 11.4658 0.1180 Constraint 1031 1106 5.8404 7.3005 14.6011 0.1180 Constraint 990 1133 4.4442 5.5552 11.1105 0.1178 Constraint 54 214 5.5202 6.9003 13.8006 0.1176 Constraint 624 884 4.7043 5.8804 11.7608 0.1174 Constraint 674 805 5.8116 7.2645 14.5291 0.1172 Constraint 185 551 5.2050 6.5063 13.0126 0.1171 Constraint 562 864 4.6989 5.8737 11.7474 0.1171 Constraint 660 841 5.9179 7.3974 14.7948 0.1170 Constraint 62 282 6.2462 7.8078 15.6156 0.1170 Constraint 532 805 6.2667 7.8334 15.6669 0.1168 Constraint 841 1066 5.9637 7.4546 14.9092 0.1168 Constraint 852 1144 3.0847 3.8559 7.7118 0.1166 Constraint 841 1144 5.5844 6.9805 13.9610 0.1166 Constraint 833 1144 5.5846 6.9807 13.9615 0.1166 Constraint 998 1124 5.3733 6.7167 13.4334 0.1164 Constraint 309 522 5.6670 7.0838 14.1676 0.1164 Constraint 431 641 5.3871 6.7339 13.4677 0.1164 Constraint 214 585 5.4805 6.8506 13.7013 0.1164 Constraint 373 585 5.3129 6.6411 13.2823 0.1163 Constraint 325 464 5.0438 6.3048 12.6096 0.1156 Constraint 343 610 4.9940 6.2425 12.4849 0.1154 Constraint 431 708 5.7670 7.2087 14.4174 0.1153 Constraint 464 756 4.4069 5.5086 11.0172 0.1146 Constraint 624 805 5.3903 6.7378 13.4757 0.1145 Constraint 683 762 4.5243 5.6554 11.3107 0.1143 Constraint 852 1174 4.5093 5.6366 11.2733 0.1143 Constraint 291 833 3.8461 4.8077 9.6153 0.1143 Constraint 282 833 5.9447 7.4309 14.8617 0.1143 Constraint 532 781 5.0592 6.3240 12.6480 0.1141 Constraint 343 756 6.0380 7.5475 15.0949 0.1136 Constraint 335 756 4.5240 5.6550 11.3101 0.1136 Constraint 84 394 5.4145 6.7681 13.5362 0.1135 Constraint 69 351 5.6265 7.0331 14.0663 0.1135 Constraint 214 522 4.6026 5.7532 11.5064 0.1135 Constraint 155 335 4.9766 6.2207 12.4415 0.1134 Constraint 155 455 4.6551 5.8188 11.6377 0.1133 Constraint 325 864 5.0508 6.3134 12.6269 0.1133 Constraint 871 1124 6.0639 7.5799 15.1598 0.1127 Constraint 62 431 5.0000 6.2500 12.5000 0.1124 Constraint 92 610 4.9589 6.1987 12.3973 0.1124 Constraint 317 532 4.9782 6.2227 12.4455 0.1124 Constraint 297 532 5.4602 6.8253 13.6506 0.1124 Constraint 297 422 3.9217 4.9021 9.8043 0.1120 Constraint 282 455 4.2238 5.2797 10.5595 0.1120 Constraint 1024 1124 4.0714 5.0893 10.1786 0.1114 Constraint 464 805 5.1057 6.3821 12.7642 0.1114 Constraint 660 967 4.9655 6.2069 12.4138 0.1113 Constraint 464 781 4.7750 5.9687 11.9374 0.1105 Constraint 439 781 5.4668 6.8334 13.6669 0.1105 Constraint 386 624 4.4772 5.5965 11.1931 0.1105 Constraint 373 683 5.8903 7.3628 14.7257 0.1105 Constraint 92 602 5.2643 6.5803 13.1606 0.1103 Constraint 499 833 5.6836 7.1045 14.2090 0.1101 Constraint 570 841 5.7169 7.1461 14.2921 0.1099 Constraint 472 781 5.6803 7.1003 14.2007 0.1098 Constraint 900 981 5.1695 6.4619 12.9238 0.1098 Constraint 380 602 4.8155 6.0194 12.0387 0.1096 Constraint 380 618 4.6245 5.7806 11.5612 0.1095 Constraint 602 794 4.6025 5.7531 11.5063 0.1090 Constraint 362 585 5.1341 6.4176 12.8352 0.1090 Constraint 472 674 4.8620 6.0775 12.1550 0.1088 Constraint 343 464 4.9718 6.2147 12.4294 0.1088 Constraint 990 1124 5.1846 6.4808 12.9615 0.1088 Constraint 618 900 4.8177 6.0221 12.0443 0.1087 Constraint 214 488 4.7908 5.9885 11.9769 0.1083 Constraint 551 723 4.9152 6.1440 12.2880 0.1082 Constraint 660 864 5.7967 7.2458 14.4916 0.1080 Constraint 1031 1318 6.1051 7.6314 15.2629 0.1079 Constraint 297 522 4.6486 5.8107 11.6215 0.1079 Constraint 814 1124 5.7168 7.1460 14.2920 0.1078 Constraint 841 1124 5.8562 7.3202 14.6404 0.1075 Constraint 335 472 4.5882 5.7352 11.4704 0.1074 Constraint 92 386 4.7669 5.9587 11.9174 0.1074 Constraint 610 892 5.3824 6.7280 13.4561 0.1073 Constraint 822 973 4.9548 6.1935 12.3869 0.1073 Constraint 335 570 5.4978 6.8722 13.7445 0.1072 Constraint 1031 1124 4.3180 5.3976 10.7951 0.1071 Constraint 814 944 4.8213 6.0267 12.0534 0.1068 Constraint 1007 1106 4.7254 5.9068 11.8136 0.1067 Constraint 297 373 4.5746 5.7182 11.4365 0.1067 Constraint 562 794 5.3041 6.6301 13.2603 0.1066 Constraint 852 1024 4.8024 6.0030 12.0059 0.1065 Constraint 100 402 5.6627 7.0784 14.1568 0.1064 Constraint 325 551 3.8462 4.8078 9.6156 0.1062 Constraint 386 871 4.9844 6.2306 12.4611 0.1062 Constraint 1007 1133 5.4095 6.7619 13.5238 0.1061 Constraint 602 805 5.1814 6.4767 12.9535 0.1057 Constraint 570 852 4.4352 5.5440 11.0880 0.1055 Constraint 84 610 4.8234 6.0292 12.0585 0.1054 Constraint 325 562 5.1356 6.4195 12.8390 0.1054 Constraint 343 431 4.8830 6.1038 12.2075 0.1052 Constraint 177 585 5.4920 6.8650 13.7300 0.1052 Constraint 177 1225 5.9255 7.4069 14.8137 0.1052 Constraint 92 402 5.9960 7.4950 14.9900 0.1047 Constraint 1051 1124 6.0315 7.5394 15.0788 0.1046 Constraint 481 708 4.8877 6.1096 12.2192 0.1045 Constraint 900 1150 4.5191 5.6489 11.2978 0.1044 Constraint 596 924 4.9151 6.1439 12.2878 0.1044 Constraint 362 814 5.6831 7.1039 14.2078 0.1043 Constraint 408 632 5.4462 6.8078 13.6156 0.1039 Constraint 84 852 5.7450 7.1812 14.3625 0.1039 Constraint 84 674 6.1139 7.6424 15.2848 0.1039 Constraint 649 981 5.0545 6.3182 12.6364 0.1036 Constraint 610 944 5.2312 6.5390 13.0780 0.1035 Constraint 325 610 4.7256 5.9070 11.8140 0.1035 Constraint 205 1106 5.3085 6.6356 13.2713 0.1034 Constraint 708 794 4.8915 6.1144 12.2289 0.1034 Constraint 1174 1256 4.3301 5.4126 10.8252 0.1031 Constraint 660 931 5.4321 6.7901 13.5801 0.1031 Constraint 439 852 5.2642 6.5803 13.1606 0.1031 Constraint 29 275 5.5355 6.9194 13.8387 0.1030 Constraint 973 1075 4.7201 5.9002 11.8004 0.1030 Constraint 700 789 4.3267 5.4084 10.8168 0.1030 Constraint 362 716 5.0647 6.3309 12.6618 0.1029 Constraint 351 728 3.8021 4.7526 9.5051 0.1029 Constraint 351 716 4.2485 5.3106 10.6213 0.1029 Constraint 343 728 4.6400 5.8000 11.5999 0.1029 Constraint 335 728 2.8715 3.5894 7.1789 0.1029 Constraint 822 1124 6.2098 7.7623 15.5246 0.1029 Constraint 532 674 5.3095 6.6369 13.2738 0.1028 Constraint 551 871 5.0287 6.2858 12.5716 0.1028 Constraint 343 570 4.8694 6.0867 12.1735 0.1027 Constraint 317 551 5.1954 6.4942 12.9885 0.1025 Constraint 362 439 5.5694 6.9617 13.9234 0.1022 Constraint 841 1024 5.4682 6.8353 13.6706 0.1022 Constraint 998 1133 4.8983 6.1229 12.2459 0.1018 Constraint 472 700 5.4585 6.8232 13.6464 0.1017 Constraint 386 641 5.5389 6.9237 13.8473 0.1017 Constraint 124 291 4.5204 5.6505 11.3010 0.1017 Constraint 1201 1430 6.0730 7.5912 15.1824 0.1015 Constraint 864 1144 5.5530 6.9412 13.8824 0.1014 Constraint 579 864 5.4292 6.7865 13.5730 0.1012 Constraint 317 951 5.6096 7.0119 14.0239 0.1012 Constraint 335 551 4.5482 5.6853 11.3705 0.1011 Constraint 931 1039 5.3420 6.6775 13.3549 0.1010 Constraint 309 499 5.0282 6.2852 12.5705 0.1009 Constraint 380 596 5.6620 7.0774 14.1549 0.1005 Constraint 822 1095 4.8370 6.0463 12.0925 0.0998 Constraint 282 522 5.1139 6.3924 12.7849 0.0997 Constraint 155 596 5.8039 7.2548 14.5096 0.0997 Constraint 84 386 5.8555 7.3194 14.6389 0.0997 Constraint 132 335 5.1612 6.4514 12.9029 0.0997 Constraint 362 579 4.8413 6.0516 12.1032 0.0996 Constraint 297 551 5.4896 6.8620 13.7241 0.0995 Constraint 579 852 4.9778 6.2222 12.4444 0.0991 Constraint 222 551 5.5830 6.9787 13.9575 0.0990 Constraint 309 814 5.4390 6.7988 13.5976 0.0990 Constraint 649 814 5.4492 6.8115 13.6230 0.0989 Constraint 1272 1459 5.6349 7.0437 14.0874 0.0987 Constraint 1264 1459 4.9388 6.1735 12.3470 0.0987 Constraint 1168 1256 4.2545 5.3181 10.6362 0.0987 Constraint 1159 1256 5.0417 6.3021 12.6043 0.0987 Constraint 691 967 4.9653 6.2067 12.4133 0.0987 Constraint 691 931 6.0061 7.5076 15.0152 0.0987 Constraint 455 551 4.9586 6.1982 12.3964 0.0986 Constraint 544 624 4.7746 5.9683 11.9365 0.0986 Constraint 562 871 4.6187 5.7734 11.5467 0.0982 Constraint 62 343 4.4252 5.5314 11.0629 0.0981 Constraint 1106 1213 6.1584 7.6980 15.3960 0.0980 Constraint 472 723 4.8450 6.0562 12.1124 0.0979 Constraint 100 674 3.1577 3.9471 7.8942 0.0978 Constraint 100 669 5.7673 7.2091 14.4183 0.0978 Constraint 100 641 3.9829 4.9786 9.9571 0.0978 Constraint 343 455 3.9193 4.8992 9.7983 0.0978 Constraint 464 723 5.2051 6.5063 13.0127 0.0977 Constraint 29 579 5.7727 7.2159 14.4318 0.0976 Constraint 924 1150 6.1566 7.6957 15.3914 0.0976 Constraint 343 596 4.3542 5.4427 10.8854 0.0976 Constraint 660 990 5.7032 7.1290 14.2579 0.0972 Constraint 317 488 3.8801 4.8502 9.7003 0.0972 Constraint 841 944 4.9165 6.1456 12.2912 0.0969 Constraint 275 585 5.7117 7.1397 14.2793 0.0967 Constraint 177 362 6.1600 7.7000 15.4000 0.0967 Constraint 1095 1244 5.4749 6.8436 13.6872 0.0967 Constraint 402 596 5.8170 7.2713 14.5425 0.0967 Constraint 833 1095 5.5663 6.9579 13.9159 0.0966 Constraint 373 596 4.5849 5.7312 11.4624 0.0966 Constraint 871 1075 5.4877 6.8597 13.7193 0.0965 Constraint 275 579 4.7620 5.9524 11.9049 0.0965 Constraint 185 515 4.7965 5.9956 11.9912 0.0964 Constraint 291 841 5.9006 7.3757 14.7514 0.0962 Constraint 282 841 5.8130 7.2663 14.5325 0.0962 Constraint 335 562 5.2792 6.5989 13.1979 0.0961 Constraint 973 1051 5.4048 6.7560 13.5120 0.0960 Constraint 297 596 4.4874 5.6093 11.2186 0.0960 Constraint 84 155 4.4314 5.5393 11.0785 0.0957 Constraint 674 833 5.2577 6.5721 13.1441 0.0956 Constraint 515 660 5.8825 7.3531 14.7062 0.0955 Constraint 510 649 4.6504 5.8130 11.6259 0.0955 Constraint 362 669 5.8330 7.2913 14.5826 0.0955 Constraint 343 762 4.8668 6.0835 12.1670 0.0955 Constraint 343 742 4.4895 5.6119 11.2238 0.0955 Constraint 335 762 5.6522 7.0652 14.1304 0.0955 Constraint 335 742 4.6125 5.7656 11.5312 0.0955 Constraint 351 431 5.3485 6.6856 13.3712 0.0952 Constraint 185 728 5.3676 6.7095 13.4190 0.0952 Constraint 660 981 2.2425 2.8032 5.6064 0.0951 Constraint 472 596 4.6493 5.8117 11.6234 0.0948 Constraint 309 570 4.7707 5.9634 11.9268 0.0948 Constraint 833 1244 5.9093 7.3866 14.7733 0.0945 Constraint 214 1213 6.1050 7.6312 15.2624 0.0945 Constraint 602 700 5.3230 6.6537 13.3075 0.0945 Constraint 674 756 4.3105 5.3881 10.7762 0.0944 Constraint 343 579 5.0631 6.3288 12.6576 0.0944 Constraint 439 723 5.2854 6.6067 13.2134 0.0944 Constraint 431 723 5.5122 6.8903 13.7805 0.0944 Constraint 257 488 5.8744 7.3430 14.6859 0.0943 Constraint 439 683 4.7485 5.9356 11.8713 0.0940 Constraint 343 822 5.6345 7.0431 14.0861 0.0940 Constraint 431 585 4.4268 5.5335 11.0671 0.0939 Constraint 562 852 5.1375 6.4219 12.8438 0.0937 Constraint 266 351 5.7119 7.1399 14.2798 0.0936 Constraint 124 351 4.7501 5.9376 11.8752 0.0935 Constraint 499 756 5.3723 6.7154 13.4308 0.0932 Constraint 214 1256 5.5611 6.9514 13.9028 0.0932 Constraint 222 728 6.1102 7.6377 15.2754 0.0931 Constraint 29 249 5.6831 7.1039 14.2078 0.0929 Constraint 1015 1133 4.9314 6.1643 12.3285 0.0929 Constraint 351 805 4.1997 5.2496 10.4992 0.0928 Constraint 362 805 5.0596 6.3245 12.6490 0.0926 Constraint 185 297 5.6029 7.0036 14.0072 0.0923 Constraint 163 488 5.1706 6.4633 12.9266 0.0921 Constraint 417 649 5.8948 7.3685 14.7369 0.0918 Constraint 624 794 5.2614 6.5767 13.1534 0.0915 Constraint 1031 1133 5.3764 6.7205 13.4411 0.0914 Constraint 602 871 5.9480 7.4350 14.8699 0.0914 Constraint 46 317 5.2975 6.6219 13.2438 0.0912 Constraint 544 871 5.6272 7.0339 14.0679 0.0912 Constraint 499 602 4.9618 6.2022 12.4044 0.0912 Constraint 335 544 4.2367 5.2959 10.5918 0.0911 Constraint 618 794 5.2234 6.5293 13.0586 0.0911 Constraint 84 351 5.2864 6.6080 13.2160 0.0910 Constraint 408 708 5.0933 6.3666 12.7333 0.0908 Constraint 1256 1395 5.2936 6.6169 13.2339 0.0907 Constraint 1244 1395 4.6297 5.7871 11.5741 0.0907 Constraint 585 674 4.7442 5.9302 11.8605 0.0907 Constraint 723 814 4.5309 5.6637 11.3274 0.0902 Constraint 884 1075 4.5674 5.7093 11.4186 0.0901 Constraint 386 649 5.4446 6.8058 13.6115 0.0900 Constraint 864 944 5.2697 6.5872 13.1744 0.0898 Constraint 402 618 6.0487 7.5609 15.1219 0.0889 Constraint 309 864 5.4473 6.8091 13.6183 0.0888 Constraint 297 864 5.0942 6.3677 12.7354 0.0888 Constraint 291 762 4.7436 5.9295 11.8589 0.0888 Constraint 282 762 4.1929 5.2411 10.4823 0.0888 Constraint 275 762 5.1388 6.4235 12.8470 0.0888 Constraint 196 716 6.3370 7.9212 15.8424 0.0888 Constraint 185 833 5.1151 6.3939 12.7877 0.0888 Constraint 185 762 5.8794 7.3493 14.6986 0.0888 Constraint 185 723 4.6871 5.8588 11.7176 0.0888 Constraint 163 723 3.7514 4.6892 9.3784 0.0888 Constraint 163 716 4.9392 6.1740 12.3479 0.0888 Constraint 163 708 3.8597 4.8247 9.6493 0.0888 Constraint 100 649 5.3155 6.6443 13.2887 0.0888 Constraint 660 728 5.9779 7.4724 14.9447 0.0887 Constraint 100 335 5.8032 7.2540 14.5079 0.0886 Constraint 951 1051 4.9890 6.2362 12.4724 0.0885 Constraint 291 373 5.3312 6.6640 13.3279 0.0883 Constraint 291 362 4.8839 6.1049 12.2098 0.0883 Constraint 674 762 4.0666 5.0832 10.1665 0.0880 Constraint 177 900 5.0876 6.3595 12.7189 0.0879 Constraint 551 708 5.9642 7.4552 14.9105 0.0878 Constraint 84 624 4.1001 5.1251 10.2502 0.0877 Constraint 814 1095 5.5755 6.9694 13.9388 0.0875 Constraint 351 794 4.9462 6.1827 12.3655 0.0874 Constraint 69 864 6.3247 7.9058 15.8116 0.0874 Constraint 92 325 5.3139 6.6424 13.2848 0.0872 Constraint 317 924 5.1222 6.4028 12.8055 0.0872 Constraint 380 632 5.3658 6.7072 13.4144 0.0872 Constraint 431 522 3.6140 4.5176 9.0351 0.0871 Constraint 674 781 5.1112 6.3889 12.7779 0.0871 Constraint 931 1095 5.3434 6.6792 13.3585 0.0870 Constraint 562 814 5.1013 6.3767 12.7533 0.0869 Constraint 833 1106 4.1021 5.1277 10.2553 0.0869 Constraint 1031 1144 4.4617 5.5771 11.1542 0.0867 Constraint 155 488 4.0103 5.0129 10.0257 0.0867 Constraint 669 981 5.6426 7.0532 14.1064 0.0866 Constraint 660 822 4.9949 6.2436 12.4872 0.0866 Constraint 282 488 3.9917 4.9896 9.9792 0.0866 Constraint 214 1192 5.4322 6.7902 13.5804 0.0866 Constraint 205 1201 5.7110 7.1388 14.2776 0.0866 Constraint 92 431 6.1008 7.6260 15.2521 0.0866 Constraint 92 408 5.7476 7.1844 14.3689 0.0866 Constraint 29 544 4.9955 6.2443 12.4887 0.0866 Constraint 29 488 4.2432 5.3040 10.6080 0.0866 Constraint 394 892 4.8835 6.1044 12.2088 0.0866 Constraint 335 900 5.4484 6.8105 13.6211 0.0866 Constraint 335 585 4.7584 5.9480 11.8961 0.0866 Constraint 177 1174 5.6595 7.0744 14.1489 0.0860 Constraint 871 1150 4.7814 5.9768 11.9536 0.0859 Constraint 291 532 5.5187 6.8984 13.7969 0.0857 Constraint 544 781 4.6540 5.8175 11.6350 0.0854 Constraint 380 649 5.3932 6.7416 13.4831 0.0854 Constraint 275 380 5.4318 6.7897 13.5794 0.0852 Constraint 351 579 4.9984 6.2480 12.4961 0.0848 Constraint 852 1075 5.4474 6.8092 13.6184 0.0847 Constraint 1015 1124 5.8796 7.3495 14.6990 0.0847 Constraint 522 915 5.4248 6.7810 13.5620 0.0846 Constraint 708 789 5.2920 6.6151 13.2301 0.0846 Constraint 54 343 5.7970 7.2463 14.4926 0.0843 Constraint 46 343 5.1585 6.4481 12.8962 0.0843 Constraint 562 822 4.9543 6.1929 12.3858 0.0839 Constraint 317 408 5.2905 6.6131 13.2261 0.0839 Constraint 472 716 6.0739 7.5924 15.1849 0.0839 Constraint 532 915 5.7439 7.1799 14.3597 0.0838 Constraint 386 864 4.8604 6.0754 12.1509 0.0838 Constraint 325 431 4.7834 5.9792 11.9584 0.0835 Constraint 343 551 4.9081 6.1351 12.2702 0.0833 Constraint 515 683 6.0447 7.5559 15.1119 0.0829 Constraint 649 944 5.4550 6.8187 13.6375 0.0828 Constraint 499 822 4.7294 5.9117 11.8234 0.0828 Constraint 1144 1386 5.1654 6.4568 12.9135 0.0828 Constraint 781 1024 4.8349 6.0436 12.0872 0.0828 Constraint 773 1024 4.9009 6.1261 12.2522 0.0828 Constraint 822 1106 5.6350 7.0437 14.0874 0.0826 Constraint 29 291 5.4293 6.7866 13.5732 0.0824 Constraint 931 1192 5.9464 7.4330 14.8661 0.0824 Constraint 177 610 5.7738 7.2173 14.4346 0.0821 Constraint 386 602 5.2251 6.5314 13.0629 0.0820 Constraint 124 317 4.5817 5.7271 11.4543 0.0815 Constraint 84 343 4.2526 5.3157 10.6314 0.0815 Constraint 163 499 4.4573 5.5717 11.1433 0.0813 Constraint 394 900 4.8871 6.1089 12.2178 0.0813 Constraint 814 924 5.1251 6.4064 12.8128 0.0812 Constraint 660 762 5.4425 6.8032 13.6063 0.0811 Constraint 532 884 4.6205 5.7757 11.5513 0.0810 Constraint 408 624 4.7389 5.9237 11.8474 0.0809 Constraint 325 871 4.0391 5.0489 10.0978 0.0808 Constraint 510 762 5.9732 7.4665 14.9330 0.0806 Constraint 402 641 5.2216 6.5270 13.0539 0.0803 Constraint 924 990 6.0586 7.5733 15.1465 0.0802 Constraint 841 1015 4.5290 5.6613 11.3226 0.0801 Constraint 562 805 5.2513 6.5641 13.1281 0.0801 Constraint 981 1106 6.2004 7.7505 15.5009 0.0801 Constraint 275 499 5.1438 6.4298 12.8595 0.0801 Constraint 291 596 6.1128 7.6410 15.2819 0.0801 Constraint 431 570 4.9093 6.1367 12.2733 0.0801 Constraint 1095 1186 5.1448 6.4310 12.8620 0.0801 Constraint 1106 1244 4.3232 5.4040 10.8080 0.0801 Constraint 464 864 5.3797 6.7246 13.4492 0.0801 Constraint 805 998 4.6247 5.7808 11.5617 0.0799 Constraint 373 439 5.0249 6.2811 12.5622 0.0799 Constraint 488 944 4.5966 5.7458 11.4915 0.0796 Constraint 728 822 4.0090 5.0112 10.0224 0.0796 Constraint 596 674 5.4430 6.8038 13.6076 0.0794 Constraint 115 335 4.6739 5.8423 11.6847 0.0794 Constraint 602 708 4.0508 5.0635 10.1270 0.0792 Constraint 282 499 5.6727 7.0909 14.1818 0.0789 Constraint 386 683 5.0537 6.3171 12.6342 0.0783 Constraint 115 362 6.0693 7.5867 15.1734 0.0783 Constraint 69 325 4.4271 5.5338 11.0676 0.0783 Constraint 900 1066 5.4087 6.7609 13.5218 0.0782 Constraint 100 325 5.9163 7.3954 14.7908 0.0781 Constraint 570 789 4.8191 6.0239 12.0478 0.0781 Constraint 532 871 5.4473 6.8091 13.6182 0.0780 Constraint 624 951 4.4798 5.5997 11.1995 0.0779 Constraint 624 781 4.8158 6.0197 12.0395 0.0779 Constraint 822 998 5.7046 7.1308 14.2616 0.0776 Constraint 833 1213 5.3067 6.6333 13.2667 0.0776 Constraint 814 1256 5.7002 7.1253 14.2505 0.0776 Constraint 237 1264 6.3348 7.9185 15.8370 0.0776 Constraint 214 297 5.3443 6.6804 13.3608 0.0775 Constraint 641 900 5.9433 7.4291 14.8582 0.0774 Constraint 1174 1386 5.3815 6.7269 13.4537 0.0774 Constraint 900 1106 5.4385 6.7982 13.5963 0.0774 Constraint 931 1051 4.5035 5.6294 11.2588 0.0773 Constraint 343 602 6.2397 7.7996 15.5991 0.0772 Constraint 177 343 5.8745 7.3431 14.6862 0.0772 Constraint 309 532 3.6934 4.6168 9.2336 0.0771 Constraint 297 515 5.2767 6.5959 13.1917 0.0771 Constraint 291 515 4.2091 5.2613 10.5227 0.0771 Constraint 864 1031 5.1141 6.3927 12.7853 0.0771 Constraint 570 708 5.6727 7.0909 14.1817 0.0769 Constraint 132 362 5.6781 7.0976 14.1952 0.0766 Constraint 871 1159 4.7626 5.9533 11.9066 0.0766 Constraint 958 1031 5.2969 6.6212 13.2423 0.0765 Constraint 335 674 4.9166 6.1457 12.2915 0.0763 Constraint 155 351 4.7676 5.9594 11.9189 0.0762 Constraint 325 499 6.1303 7.6629 15.3258 0.0761 Constraint 900 1039 4.6478 5.8097 11.6194 0.0760 Constraint 394 488 5.4664 6.8331 13.6661 0.0758 Constraint 29 297 4.9325 6.1656 12.3312 0.0758 Constraint 833 907 5.2008 6.5010 13.0020 0.0758 Constraint 69 297 5.6745 7.0931 14.1863 0.0757 Constraint 439 716 4.1353 5.1691 10.3383 0.0756 Constraint 1051 1347 6.3130 7.8913 15.7825 0.0756 Constraint 570 864 5.3951 6.7439 13.4877 0.0755 Constraint 649 773 5.4256 6.7820 13.5641 0.0755 Constraint 522 674 3.6620 4.5775 9.1549 0.0752 Constraint 1024 1144 4.1410 5.1763 10.3526 0.0751 Constraint 275 1256 4.4043 5.5054 11.0107 0.0751 Constraint 464 602 4.7445 5.9306 11.8611 0.0750 Constraint 1007 1124 4.8374 6.0467 12.0935 0.0742 Constraint 148 602 5.3577 6.6971 13.3942 0.0741 Constraint 291 488 5.6112 7.0140 14.0281 0.0741 Constraint 325 455 4.6626 5.8282 11.6564 0.0739 Constraint 464 562 4.6151 5.7689 11.5377 0.0739 Constraint 884 1039 4.3375 5.4219 10.8438 0.0738 Constraint 402 624 4.3138 5.3923 10.7846 0.0736 Constraint 335 408 4.4366 5.5457 11.0914 0.0736 Constraint 522 660 5.3690 6.7112 13.4225 0.0736 Constraint 325 998 5.4205 6.7756 13.5512 0.0735 Constraint 551 864 5.2486 6.5607 13.1215 0.0735 Constraint 805 990 5.1962 6.4953 12.9906 0.0735 Constraint 317 944 6.2683 7.8354 15.6707 0.0735 Constraint 716 805 5.0535 6.3169 12.6338 0.0734 Constraint 532 762 4.7934 5.9918 11.9836 0.0733 Constraint 351 532 5.5475 6.9344 13.8689 0.0732 Constraint 177 266 5.7928 7.2410 14.4819 0.0732 Constraint 532 852 4.7826 5.9783 11.9566 0.0729 Constraint 275 510 4.4527 5.5658 11.1316 0.0729 Constraint 794 973 5.0069 6.2586 12.5173 0.0728 Constraint 351 649 6.1774 7.7218 15.4435 0.0727 Constraint 408 602 5.8622 7.3277 14.6554 0.0727 Constraint 325 570 5.1651 6.4564 12.9127 0.0726 Constraint 871 1192 5.6840 7.1051 14.2101 0.0725 Constraint 266 386 5.6587 7.0734 14.1468 0.0725 Constraint 132 351 4.6254 5.7818 11.5636 0.0724 Constraint 958 1051 4.7769 5.9712 11.9424 0.0724 Constraint 362 833 6.0196 7.5245 15.0489 0.0724 Constraint 380 624 5.7599 7.1999 14.3997 0.0724 Constraint 343 833 5.8800 7.3500 14.6999 0.0722 Constraint 343 562 4.8484 6.0604 12.1209 0.0721 Constraint 380 585 5.1081 6.3852 12.7703 0.0720 Constraint 931 1106 4.2698 5.3372 10.6744 0.0719 Constraint 41 309 5.2217 6.5272 13.0543 0.0718 Constraint 408 864 4.9537 6.1922 12.3844 0.0717 Constraint 380 610 5.3670 6.7087 13.4175 0.0716 Constraint 185 532 5.1361 6.4202 12.8404 0.0716 Constraint 386 618 5.3077 6.6347 13.2694 0.0714 Constraint 362 570 4.9698 6.2122 12.4245 0.0714 Constraint 1235 1459 5.7669 7.2087 14.4174 0.0713 Constraint 1225 1459 5.1341 6.4176 12.8353 0.0713 Constraint 291 499 3.1334 3.9167 7.8334 0.0712 Constraint 325 596 5.6742 7.0927 14.1854 0.0712 Constraint 380 488 4.6817 5.8521 11.7042 0.0712 Constraint 464 814 5.6535 7.0668 14.1337 0.0711 Constraint 402 544 6.0788 7.5985 15.1970 0.0711 Constraint 282 515 5.0528 6.3160 12.6320 0.0711 Constraint 282 510 5.2979 6.6223 13.2447 0.0711 Constraint 163 351 4.6283 5.7854 11.5707 0.0711 Constraint 864 973 4.6124 5.7656 11.5311 0.0710 Constraint 124 325 4.5717 5.7146 11.4293 0.0709 Constraint 789 1066 4.1805 5.2256 10.4512 0.0709 Constraint 351 1087 5.0369 6.2962 12.5923 0.0709 Constraint 185 343 4.9475 6.1844 12.3688 0.0709 Constraint 62 155 4.5123 5.6404 11.2808 0.0708 Constraint 742 915 5.7775 7.2219 14.4438 0.0706 Constraint 439 522 6.1954 7.7443 15.4886 0.0706 Constraint 814 1106 4.9700 6.2125 12.4250 0.0703 Constraint 309 562 5.4879 6.8599 13.7198 0.0702 Constraint 394 602 5.1568 6.4460 12.8920 0.0701 Constraint 579 708 4.2732 5.3415 10.6830 0.0700 Constraint 148 864 5.5350 6.9188 13.8376 0.0699 Constraint 570 1256 5.1108 6.3884 12.7769 0.0699 Constraint 386 900 5.7989 7.2487 14.4974 0.0698 Constraint 325 394 4.7906 5.9882 11.9765 0.0696 Constraint 864 1133 5.5555 6.9443 13.8887 0.0694 Constraint 343 814 3.9339 4.9173 9.8347 0.0693 Constraint 100 618 5.5131 6.8913 13.7827 0.0692 Constraint 1039 1124 6.1311 7.6638 15.3277 0.0691 Constraint 325 924 5.6895 7.1119 14.2237 0.0691 Constraint 325 649 5.6113 7.0141 14.0283 0.0691 Constraint 249 1225 5.5088 6.8860 13.7720 0.0691 Constraint 148 1150 5.5650 6.9562 13.9125 0.0691 Constraint 54 1039 5.4588 6.8234 13.6469 0.0691 Constraint 54 1031 4.8882 6.1102 12.2204 0.0691 Constraint 54 1024 5.5294 6.9118 13.8236 0.0691 Constraint 46 1039 4.7383 5.9228 11.8457 0.0691 Constraint 402 481 4.3239 5.4048 10.8097 0.0689 Constraint 1213 1306 5.2764 6.5954 13.1909 0.0689 Constraint 864 1075 4.6140 5.7675 11.5351 0.0689 Constraint 624 789 5.7837 7.2296 14.4592 0.0688 Constraint 649 742 4.3586 5.4483 10.8965 0.0687 Constraint 291 551 4.1567 5.1958 10.3917 0.0687 Constraint 417 708 5.4266 6.7833 13.5665 0.0687 Constraint 892 1106 5.2152 6.5189 13.0379 0.0687 Constraint 380 481 5.6838 7.1047 14.2094 0.0686 Constraint 472 833 5.2842 6.6053 13.2106 0.0685 Constraint 871 1174 4.2318 5.2897 10.5794 0.0684 Constraint 46 602 4.3130 5.3912 10.7825 0.0682 Constraint 871 951 5.2225 6.5281 13.0562 0.0681 Constraint 472 822 5.4230 6.7787 13.5575 0.0681 Constraint 317 544 4.2391 5.2989 10.5977 0.0681 Constraint 841 1201 5.2110 6.5138 13.0276 0.0680 Constraint 610 1192 5.3936 6.7421 13.4841 0.0680 Constraint 351 1031 5.8238 7.2797 14.5594 0.0679 Constraint 177 464 4.7822 5.9777 11.9554 0.0679 Constraint 931 1087 4.3176 5.3970 10.7940 0.0678 Constraint 386 841 5.2424 6.5530 13.1059 0.0677 Constraint 297 380 5.4132 6.7666 13.5331 0.0676 Constraint 282 380 5.3933 6.7416 13.4831 0.0676 Constraint 275 386 5.4644 6.8305 13.6610 0.0676 Constraint 92 596 4.2031 5.2539 10.5078 0.0675 Constraint 335 439 6.2208 7.7760 15.5521 0.0674 Constraint 325 488 4.3108 5.3885 10.7770 0.0672 Constraint 402 632 5.7188 7.1485 14.2971 0.0672 Constraint 362 822 4.3950 5.4937 10.9874 0.0671 Constraint 871 1168 5.2762 6.5953 13.1905 0.0671 Constraint 335 1095 5.3386 6.6733 13.3465 0.0670 Constraint 249 455 4.9641 6.2052 12.4103 0.0669 Constraint 618 924 5.9543 7.4429 14.8858 0.0667 Constraint 373 674 5.6540 7.0675 14.1350 0.0667 Constraint 282 585 5.6229 7.0286 14.0571 0.0666 Constraint 610 794 5.0784 6.3480 12.6961 0.0666 Constraint 596 990 6.1698 7.7123 15.4246 0.0665 Constraint 464 669 4.0362 5.0452 10.0905 0.0665 Constraint 464 951 5.4115 6.7643 13.5287 0.0664 Constraint 1256 1402 4.8129 6.0161 12.0322 0.0664 Constraint 317 570 4.6779 5.8473 11.6946 0.0664 Constraint 309 515 5.7353 7.1691 14.3383 0.0663 Constraint 884 1192 5.0427 6.3034 12.6068 0.0663 Constraint 373 624 4.7691 5.9614 11.9228 0.0661 Constraint 115 325 2.6575 3.3218 6.6436 0.0660 Constraint 864 1150 5.4956 6.8695 13.7390 0.0660 Constraint 29 570 5.7305 7.1632 14.3263 0.0659 Constraint 562 789 5.4996 6.8745 13.7489 0.0659 Constraint 1174 1395 5.5287 6.9109 13.8219 0.0658 Constraint 266 335 3.9927 4.9909 9.9817 0.0658 Constraint 781 951 5.0602 6.3253 12.6506 0.0656 Constraint 596 967 4.5490 5.6863 11.3725 0.0655 Constraint 214 602 6.1172 7.6465 15.2930 0.0655 Constraint 510 794 4.8942 6.1178 12.2356 0.0655 Constraint 214 282 5.2208 6.5260 13.0519 0.0654 Constraint 275 351 4.6602 5.8252 11.6504 0.0654 Constraint 124 864 5.8460 7.3075 14.6150 0.0653 Constraint 62 325 5.9129 7.3911 14.7822 0.0653 Constraint 841 981 4.7342 5.9177 11.8354 0.0653 Constraint 610 805 5.5272 6.9090 13.8179 0.0653 Constraint 481 562 6.2695 7.8369 15.6738 0.0652 Constraint 455 570 5.6731 7.0914 14.1829 0.0652 Constraint 455 562 6.2157 7.7697 15.5394 0.0652 Constraint 362 649 4.9592 6.1990 12.3979 0.0652 Constraint 291 602 5.4406 6.8007 13.6014 0.0652 Constraint 335 852 4.0525 5.0657 10.1313 0.0652 Constraint 148 871 5.7497 7.1871 14.3743 0.0652 Constraint 249 931 5.6485 7.0606 14.1212 0.0651 Constraint 237 931 5.1256 6.4070 12.8141 0.0651 Constraint 973 1087 5.1534 6.4417 12.8834 0.0651 Constraint 351 1106 5.0074 6.2592 12.5184 0.0650 Constraint 351 1095 4.5692 5.7115 11.4230 0.0650 Constraint 343 1095 4.1267 5.1584 10.3167 0.0650 Constraint 335 579 5.5754 6.9693 13.9386 0.0647 Constraint 335 833 6.0787 7.5983 15.1967 0.0647 Constraint 551 884 6.0975 7.6219 15.2438 0.0647 Constraint 297 602 5.5871 6.9839 13.9678 0.0646 Constraint 177 864 5.6803 7.1004 14.2008 0.0645 Constraint 981 1133 5.2361 6.5451 13.0902 0.0644 Constraint 641 864 5.8485 7.3107 14.6213 0.0642 Constraint 641 841 5.1250 6.4062 12.8125 0.0642 Constraint 499 1051 5.5535 6.9419 13.8838 0.0642 Constraint 499 1031 4.8055 6.0068 12.0137 0.0642 Constraint 488 1031 5.0453 6.3066 12.6133 0.0642 Constraint 373 481 4.0620 5.0774 10.1549 0.0642 Constraint 464 1039 5.3746 6.7183 13.4366 0.0642 Constraint 168 1106 5.9942 7.4927 14.9854 0.0642 Constraint 343 532 4.8062 6.0077 12.0155 0.0641 Constraint 335 532 5.3550 6.6937 13.3875 0.0641 Constraint 439 579 5.8859 7.3574 14.7148 0.0641 Constraint 62 618 5.9364 7.4205 14.8410 0.0640 Constraint 362 532 5.9463 7.4328 14.8656 0.0638 Constraint 362 562 5.2546 6.5683 13.1365 0.0636 Constraint 351 562 5.3435 6.6793 13.3587 0.0636 Constraint 351 570 5.3961 6.7451 13.4903 0.0636 Constraint 864 1159 5.1738 6.4672 12.9345 0.0636 Constraint 864 981 5.7620 7.2025 14.4049 0.0636 Constraint 185 351 4.2202 5.2753 10.5506 0.0634 Constraint 431 515 4.9757 6.2196 12.4392 0.0634 Constraint 907 1106 3.3743 4.2179 8.4358 0.0633 Constraint 570 973 5.8398 7.2997 14.5994 0.0633 Constraint 794 990 5.3975 6.7469 13.4938 0.0632 Constraint 884 1087 4.0828 5.1036 10.2071 0.0631 Constraint 386 610 5.4427 6.8034 13.6067 0.0631 Constraint 822 924 5.9258 7.4073 14.8146 0.0630 Constraint 596 794 4.5001 5.6251 11.2501 0.0627 Constraint 408 579 6.1222 7.6528 15.3056 0.0627 Constraint 317 610 5.5357 6.9197 13.8393 0.0627 Constraint 84 602 3.7256 4.6570 9.3140 0.0627 Constraint 92 728 3.7885 4.7356 9.4712 0.0626 Constraint 92 351 5.6329 7.0411 14.0821 0.0626 Constraint 84 728 5.5524 6.9405 13.8810 0.0626 Constraint 386 852 3.8714 4.8393 9.6786 0.0623 Constraint 380 841 3.2217 4.0271 8.0542 0.0623 Constraint 343 472 5.7069 7.1336 14.2671 0.0623 Constraint 464 551 4.7396 5.9245 11.8490 0.0623 Constraint 544 789 5.2584 6.5730 13.1461 0.0623 Constraint 660 794 4.8476 6.0595 12.1191 0.0622 Constraint 789 967 5.0118 6.2647 12.5295 0.0622 Constraint 1144 1413 5.0768 6.3459 12.6919 0.0621 Constraint 1124 1402 4.7559 5.9449 11.8897 0.0621 Constraint 544 674 4.2183 5.2728 10.5456 0.0621 Constraint 544 649 6.1065 7.6331 15.2663 0.0621 Constraint 515 669 5.8903 7.3628 14.7257 0.0621 Constraint 510 669 6.3931 7.9913 15.9826 0.0621 Constraint 481 742 6.2767 7.8459 15.6917 0.0621 Constraint 481 728 4.1469 5.1837 10.3674 0.0621 Constraint 481 579 6.2242 7.7803 15.5605 0.0621 Constraint 455 728 6.3852 7.9814 15.9629 0.0621 Constraint 431 544 4.1034 5.1293 10.2586 0.0621 Constraint 408 544 2.8036 3.5045 7.0090 0.0621 Constraint 408 522 5.7483 7.1853 14.3707 0.0621 Constraint 394 596 4.4878 5.6098 11.2196 0.0621 Constraint 394 562 4.4122 5.5152 11.0304 0.0621 Constraint 394 544 6.3632 7.9540 15.9080 0.0621 Constraint 335 422 4.7756 5.9695 11.9390 0.0621 Constraint 325 822 4.3348 5.4185 10.8369 0.0621 Constraint 317 472 3.9260 4.9075 9.8150 0.0621 Constraint 317 422 5.0003 6.2503 12.5007 0.0621 Constraint 309 544 6.1307 7.6634 15.3269 0.0621 Constraint 297 472 5.4865 6.8581 13.7162 0.0621 Constraint 291 522 6.3241 7.9051 15.8103 0.0621 Constraint 249 510 5.4860 6.8575 13.7151 0.0621 Constraint 249 481 5.8107 7.2633 14.5266 0.0621 Constraint 214 499 5.6161 7.0201 14.0402 0.0621 Constraint 362 464 5.2677 6.5846 13.1692 0.0620 Constraint 155 249 4.6668 5.8335 11.6669 0.0620 Constraint 54 864 6.1170 7.6463 15.2926 0.0619 Constraint 54 841 5.8318 7.2898 14.5795 0.0619 Constraint 325 515 5.4783 6.8478 13.6957 0.0619 Constraint 408 596 5.4936 6.8670 13.7340 0.0618 Constraint 624 814 4.9415 6.1769 12.3538 0.0614 Constraint 1124 1281 6.0347 7.5433 15.0867 0.0614 Constraint 814 1281 4.4708 5.5885 11.1769 0.0614 Constraint 570 1281 6.0137 7.5171 15.0342 0.0614 Constraint 691 990 4.9655 6.2069 12.4138 0.0614 Constraint 499 794 5.4273 6.7841 13.5682 0.0612 Constraint 297 951 5.1145 6.3932 12.7863 0.0611 Constraint 275 488 5.3858 6.7323 13.4646 0.0611 Constraint 380 464 4.7683 5.9604 11.9207 0.0609 Constraint 884 973 5.0544 6.3180 12.6360 0.0609 Constraint 351 439 4.1471 5.1838 10.3676 0.0608 Constraint 794 1075 4.6822 5.8528 11.7056 0.0608 Constraint 373 833 4.7251 5.9064 11.8128 0.0608 Constraint 362 472 5.3947 6.7434 13.4867 0.0608 Constraint 351 822 5.8434 7.3042 14.6085 0.0608 Constraint 596 871 5.1017 6.3772 12.7543 0.0607 Constraint 309 472 5.7088 7.1360 14.2720 0.0607 Constraint 641 773 3.8962 4.8702 9.7404 0.0606 Constraint 579 649 6.2433 7.8042 15.6084 0.0606 Constraint 343 951 5.7217 7.1522 14.3043 0.0605 Constraint 431 973 5.6904 7.1130 14.2259 0.0605 Constraint 864 1192 5.7109 7.1386 14.2773 0.0605 Constraint 814 967 4.3896 5.4870 10.9741 0.0605 Constraint 762 939 5.3301 6.6626 13.3251 0.0605 Constraint 596 939 5.4790 6.8488 13.6976 0.0605 Constraint 335 864 5.5000 6.8750 13.7500 0.0604 Constraint 814 1087 4.0720 5.0900 10.1801 0.0602 Constraint 973 1066 5.5447 6.9309 13.8618 0.0602 Constraint 822 951 4.7607 5.9509 11.9017 0.0601 Constraint 222 708 4.0429 5.0536 10.1073 0.0600 Constraint 1106 1186 4.4327 5.5409 11.0817 0.0600 Constraint 141 317 5.9089 7.3861 14.7723 0.0600 Constraint 742 944 4.9507 6.1884 12.3767 0.0599 Constraint 742 939 4.2006 5.2507 10.5014 0.0599 Constraint 585 924 5.6676 7.0845 14.1690 0.0598 Constraint 981 1124 5.3334 6.6668 13.3336 0.0598 Constraint 214 481 4.9876 6.2345 12.4690 0.0598 Constraint 29 585 3.8057 4.7571 9.5143 0.0597 Constraint 864 931 5.5977 6.9972 13.9944 0.0596 Constraint 649 756 5.7566 7.1958 14.3915 0.0596 Constraint 317 814 4.8771 6.0964 12.1928 0.0595 Constraint 728 852 5.7923 7.2403 14.4806 0.0595 Constraint 282 464 6.3588 7.9485 15.8970 0.0595 Constraint 309 464 5.1573 6.4466 12.8932 0.0593 Constraint 499 814 5.4674 6.8342 13.6685 0.0592 Constraint 814 990 5.4109 6.7636 13.5272 0.0592 Constraint 602 691 4.5590 5.6988 11.3976 0.0591 Constraint 585 864 4.9473 6.1841 12.3681 0.0589 Constraint 439 570 5.1578 6.4473 12.8946 0.0586 Constraint 900 1031 5.0902 6.3627 12.7254 0.0584 Constraint 924 1106 5.9877 7.4846 14.9692 0.0583 Constraint 884 1133 5.5842 6.9802 13.9604 0.0583 Constraint 402 990 5.2600 6.5750 13.1501 0.0582 Constraint 439 990 5.1972 6.4965 12.9930 0.0582 Constraint 691 794 4.8435 6.0544 12.1088 0.0578 Constraint 249 958 5.1664 6.4580 12.9161 0.0577 Constraint 249 951 4.7127 5.8909 11.7818 0.0577 Constraint 214 951 5.3467 6.6834 13.3667 0.0577 Constraint 214 931 5.0451 6.3063 12.6126 0.0577 Constraint 205 931 4.8219 6.0273 12.0547 0.0577 Constraint 205 900 4.5098 5.6372 11.2745 0.0577 Constraint 177 931 6.2877 7.8597 15.7194 0.0577 Constraint 177 924 5.1241 6.4052 12.8103 0.0577 Constraint 177 884 5.7309 7.1636 14.3272 0.0577 Constraint 168 900 5.6098 7.0123 14.0246 0.0577 Constraint 163 510 4.4511 5.5639 11.1278 0.0577 Constraint 46 1051 5.3020 6.6275 13.2551 0.0576 Constraint 380 455 4.9299 6.1624 12.3248 0.0575 Constraint 317 515 4.0780 5.0975 10.1950 0.0572 Constraint 610 781 4.6232 5.7790 11.5580 0.0572 Constraint 148 618 5.3491 6.6863 13.3727 0.0571 Constraint 900 1024 5.5924 6.9905 13.9810 0.0571 Constraint 852 1159 5.5549 6.9436 13.8872 0.0571 Constraint 1075 1201 5.5551 6.9438 13.8877 0.0570 Constraint 544 773 5.5846 6.9807 13.9614 0.0570 Constraint 343 1087 4.9472 6.1840 12.3681 0.0568 Constraint 1133 1421 4.7816 5.9770 11.9540 0.0568 Constraint 924 1051 4.9154 6.1442 12.2885 0.0567 Constraint 464 833 5.8963 7.3704 14.7407 0.0567 Constraint 1031 1213 5.1168 6.3960 12.7919 0.0566 Constraint 439 756 3.6326 4.5407 9.0814 0.0565 Constraint 499 762 5.8185 7.2731 14.5462 0.0563 Constraint 488 973 5.2351 6.5439 13.0877 0.0563 Constraint 464 973 4.9468 6.1835 12.3670 0.0563 Constraint 455 973 4.5362 5.6702 11.3405 0.0563 Constraint 351 1039 5.6166 7.0207 14.0415 0.0563 Constraint 951 1106 4.1209 5.1512 10.3023 0.0562 Constraint 54 249 4.1807 5.2258 10.4516 0.0561 Constraint 624 833 5.7729 7.2161 14.4322 0.0560 Constraint 510 773 5.2614 6.5768 13.1535 0.0560 Constraint 632 944 4.8034 6.0042 12.0085 0.0560 Constraint 185 602 4.3747 5.4684 10.9369 0.0560 Constraint 163 373 6.0953 7.6192 15.2383 0.0560 Constraint 155 618 5.8204 7.2755 14.5510 0.0560 Constraint 155 373 3.8532 4.8166 9.6331 0.0560 Constraint 499 781 5.2112 6.5140 13.0280 0.0558 Constraint 297 481 4.2524 5.3154 10.6309 0.0557 Constraint 291 481 5.7036 7.1295 14.2591 0.0557 Constraint 196 708 5.8626 7.3283 14.6566 0.0557 Constraint 649 884 5.4365 6.7956 13.5912 0.0557 Constraint 155 481 4.6934 5.8667 11.7334 0.0555 Constraint 309 488 5.4975 6.8718 13.7437 0.0554 Constraint 1133 1208 4.7480 5.9350 11.8700 0.0554 Constraint 931 1007 4.5327 5.6659 11.3319 0.0554 Constraint 373 822 5.3216 6.6520 13.3040 0.0554 Constraint 373 805 4.3988 5.4985 10.9969 0.0554 Constraint 325 1095 5.6996 7.1245 14.2489 0.0554 Constraint 222 522 6.0043 7.5053 15.0107 0.0553 Constraint 62 852 5.7232 7.1540 14.3079 0.0552 Constraint 570 892 5.4234 6.7793 13.5585 0.0552 Constraint 981 1075 5.9222 7.4028 14.8056 0.0552 Constraint 756 990 5.0497 6.3121 12.6242 0.0551 Constraint 871 1087 5.5449 6.9311 13.8622 0.0550 Constraint 852 1015 4.6187 5.7734 11.5468 0.0550 Constraint 499 789 4.8932 6.1165 12.2330 0.0550 Constraint 1225 1339 6.3171 7.8964 15.7928 0.0550 Constraint 317 562 5.4567 6.8209 13.6418 0.0548 Constraint 691 973 5.5415 6.9269 13.8537 0.0548 Constraint 510 641 6.2470 7.8088 15.6176 0.0548 Constraint 499 641 3.8426 4.8032 9.6064 0.0548 Constraint 488 641 5.0020 6.2525 12.5051 0.0548 Constraint 1281 1395 5.0879 6.3599 12.7198 0.0545 Constraint 562 781 5.9333 7.4167 14.8333 0.0544 Constraint 551 789 4.1522 5.1902 10.3804 0.0544 Constraint 833 1007 5.0569 6.3212 12.6423 0.0542 Constraint 431 756 5.6007 7.0009 14.0018 0.0542 Constraint 408 756 6.2500 7.8126 15.6251 0.0542 Constraint 532 789 4.6090 5.7612 11.5224 0.0542 Constraint 464 762 4.7714 5.9643 11.9286 0.0541 Constraint 833 998 5.5575 6.9469 13.8937 0.0540 Constraint 62 649 4.2919 5.3649 10.7297 0.0537 Constraint 362 488 5.5205 6.9006 13.8013 0.0537 Constraint 551 805 4.8792 6.0990 12.1981 0.0537 Constraint 177 814 6.1455 7.6819 15.3638 0.0536 Constraint 562 691 6.2815 7.8519 15.7038 0.0534 Constraint 100 362 6.0267 7.5334 15.0668 0.0533 Constraint 562 833 4.2851 5.3563 10.7127 0.0533 Constraint 794 981 5.5093 6.8866 13.7732 0.0532 Constraint 386 794 5.5519 6.9399 13.8798 0.0531 Constraint 585 1213 5.6698 7.0873 14.1746 0.0529 Constraint 579 683 6.0642 7.5803 15.1605 0.0529 Constraint 124 602 6.1876 7.7345 15.4690 0.0529 Constraint 124 335 5.3979 6.7474 13.4947 0.0529 Constraint 29 257 3.5121 4.3902 8.7803 0.0529 Constraint 92 343 6.0180 7.5225 15.0450 0.0529 Constraint 532 773 4.3636 5.4545 10.9090 0.0526 Constraint 610 773 5.0613 6.3266 12.6532 0.0525 Constraint 884 1095 4.2066 5.2583 10.5165 0.0519 Constraint 674 822 5.8872 7.3590 14.7180 0.0518 Constraint 394 915 6.0937 7.6171 15.2343 0.0518 Constraint 464 822 5.6938 7.1173 14.2346 0.0517 Constraint 417 981 5.1938 6.4922 12.9844 0.0517 Constraint 408 967 4.5766 5.7207 11.4414 0.0517 Constraint 408 958 5.5740 6.9675 13.9350 0.0517 Constraint 402 967 6.2915 7.8644 15.7288 0.0517 Constraint 402 958 3.7884 4.7354 9.4709 0.0517 Constraint 394 958 4.8123 6.0154 12.0307 0.0517 Constraint 69 373 4.0518 5.0648 10.1296 0.0517 Constraint 841 1075 4.7927 5.9909 11.9818 0.0516 Constraint 632 884 5.8066 7.2583 14.5165 0.0516 Constraint 632 756 5.2193 6.5241 13.0482 0.0513 Constraint 343 924 4.6358 5.7948 11.5895 0.0513 Constraint 624 973 4.6899 5.8624 11.7248 0.0513 Constraint 362 515 4.5409 5.6761 11.3523 0.0513 Constraint 317 510 5.9498 7.4372 14.8744 0.0513 Constraint 309 510 3.9875 4.9843 9.9687 0.0513 Constraint 163 515 4.1865 5.2331 10.4663 0.0512 Constraint 618 892 3.9703 4.9628 9.9257 0.0511 Constraint 394 618 5.2711 6.5889 13.1778 0.0510 Constraint 742 822 4.4749 5.5936 11.1873 0.0510 Constraint 62 864 3.7708 4.7135 9.4269 0.0510 Constraint 871 1095 4.0083 5.0104 10.0208 0.0509 Constraint 402 649 5.5707 6.9634 13.9267 0.0509 Constraint 69 596 5.4906 6.8632 13.7264 0.0508 Constraint 1159 1288 5.8631 7.3289 14.6577 0.0506 Constraint 408 781 5.6085 7.0106 14.0212 0.0505 Constraint 708 900 5.2909 6.6137 13.2274 0.0504 Constraint 551 852 4.2317 5.2897 10.5793 0.0504 Constraint 499 852 4.8065 6.0081 12.0162 0.0503 Constraint 351 814 4.2066 5.2583 10.5165 0.0502 Constraint 794 1066 4.3155 5.3944 10.7888 0.0502 Constraint 275 373 4.6533 5.8166 11.6333 0.0501 Constraint 249 362 4.7045 5.8806 11.7613 0.0501 Constraint 249 351 4.6003 5.7503 11.5007 0.0501 Constraint 163 249 5.3093 6.6366 13.2732 0.0500 Constraint 864 1024 4.8186 6.0232 12.0464 0.0498 Constraint 62 499 5.0725 6.3406 12.6811 0.0498 Constraint 62 488 4.6336 5.7920 11.5840 0.0498 Constraint 62 464 4.6964 5.8705 11.7409 0.0498 Constraint 907 981 5.0486 6.3108 12.6216 0.0495 Constraint 892 973 6.0308 7.5385 15.0771 0.0495 Constraint 900 1051 4.9754 6.2192 12.4385 0.0495 Constraint 841 1007 5.7860 7.2325 14.4649 0.0492 Constraint 431 864 5.4353 6.7941 13.5882 0.0492 Constraint 257 335 5.4066 6.7583 13.5166 0.0492 Constraint 373 841 5.4985 6.8731 13.7462 0.0491 Constraint 362 841 5.6529 7.0661 14.1323 0.0491 Constraint 499 596 5.4693 6.8367 13.6733 0.0491 Constraint 282 351 5.3944 6.7430 13.4860 0.0490 Constraint 309 624 4.3034 5.3793 10.7586 0.0489 Constraint 544 884 6.1121 7.6402 15.2804 0.0489 Constraint 532 924 5.4030 6.7537 13.5075 0.0489 Constraint 373 794 5.9095 7.3868 14.7736 0.0489 Constraint 408 691 5.2467 6.5584 13.1168 0.0488 Constraint 939 1106 5.6298 7.0372 14.0744 0.0486 Constraint 431 602 5.2925 6.6156 13.2312 0.0485 Constraint 464 742 4.9083 6.1354 12.2708 0.0485 Constraint 214 325 4.6222 5.7778 11.5555 0.0485 Constraint 408 570 5.1212 6.4015 12.8029 0.0484 Constraint 163 297 6.3013 7.8766 15.7533 0.0483 Constraint 115 249 4.9646 6.2058 12.4116 0.0483 Constraint 124 464 6.1238 7.6548 15.3095 0.0483 Constraint 579 924 5.8725 7.3406 14.6812 0.0483 Constraint 708 915 5.3330 6.6663 13.3325 0.0482 Constraint 499 924 5.2729 6.5912 13.1824 0.0482 Constraint 570 924 5.5338 6.9173 13.8345 0.0482 Constraint 570 884 5.9588 7.4485 14.8970 0.0482 Constraint 84 362 5.2972 6.6215 13.2431 0.0481 Constraint 900 1144 5.3696 6.7120 13.4241 0.0481 Constraint 257 343 4.5933 5.7416 11.4832 0.0480 Constraint 351 455 5.8496 7.3120 14.6240 0.0478 Constraint 924 1015 4.2205 5.2756 10.5512 0.0477 Constraint 1087 1192 5.7398 7.1748 14.3495 0.0476 Constraint 343 585 5.5720 6.9650 13.9300 0.0475 Constraint 185 544 3.7257 4.6571 9.3142 0.0474 Constraint 275 794 3.6554 4.5693 9.1386 0.0474 Constraint 275 789 4.8267 6.0334 12.0668 0.0474 Constraint 168 833 6.2578 7.8223 15.6445 0.0474 Constraint 472 794 5.6788 7.0985 14.1969 0.0473 Constraint 325 624 3.9996 4.9995 9.9990 0.0472 Constraint 402 1051 6.2878 7.8598 15.7196 0.0472 Constraint 852 1031 5.3092 6.6364 13.2729 0.0472 Constraint 177 822 4.8076 6.0095 12.0191 0.0471 Constraint 579 716 5.7212 7.1515 14.3030 0.0471 Constraint 570 716 5.5163 6.8954 13.7908 0.0471 Constraint 871 944 5.8043 7.2554 14.5109 0.0469 Constraint 205 674 5.9465 7.4331 14.8661 0.0468 Constraint 141 335 6.0246 7.5308 15.0616 0.0468 Constraint 431 841 5.1114 6.3892 12.7784 0.0468 Constraint 69 924 6.3239 7.9048 15.8097 0.0467 Constraint 69 871 3.3617 4.2022 8.4043 0.0467 Constraint 62 871 3.8687 4.8359 9.6719 0.0467 Constraint 54 951 5.5594 6.9492 13.8984 0.0467 Constraint 54 852 4.3407 5.4259 10.8519 0.0467 Constraint 54 649 5.0932 6.3665 12.7331 0.0467 Constraint 54 624 4.6785 5.8481 11.6963 0.0467 Constraint 54 618 5.2566 6.5708 13.1416 0.0467 Constraint 46 864 5.4990 6.8737 13.7474 0.0467 Constraint 46 852 6.1415 7.6769 15.3538 0.0467 Constraint 46 841 3.6571 4.5713 9.1427 0.0467 Constraint 46 610 6.1697 7.7121 15.4242 0.0467 Constraint 46 155 6.3494 7.9367 15.8735 0.0467 Constraint 41 841 5.5799 6.9748 13.9497 0.0467 Constraint 41 833 4.5279 5.6598 11.3197 0.0467 Constraint 41 822 5.4745 6.8432 13.6863 0.0467 Constraint 41 805 4.0233 5.0291 10.0582 0.0467 Constraint 41 781 5.6328 7.0410 14.0820 0.0467 Constraint 41 649 5.7826 7.2283 14.4566 0.0467 Constraint 29 841 5.9544 7.4430 14.8861 0.0467 Constraint 29 822 3.5401 4.4251 8.8502 0.0467 Constraint 29 814 5.5316 6.9145 13.8291 0.0467 Constraint 29 805 5.5736 6.9670 13.9340 0.0467 Constraint 29 596 5.5071 6.8839 13.7678 0.0467 Constraint 981 1066 4.9356 6.1694 12.3389 0.0467 Constraint 446 708 4.3035 5.3793 10.7587 0.0466 Constraint 408 841 4.5711 5.7139 11.4278 0.0464 Constraint 402 864 4.7166 5.8957 11.7914 0.0464 Constraint 464 1007 6.1418 7.6773 15.3546 0.0464 Constraint 488 683 5.1915 6.4893 12.9786 0.0464 Constraint 641 781 4.9939 6.2424 12.4848 0.0463 Constraint 669 805 5.5650 6.9562 13.9124 0.0461 Constraint 402 570 4.9386 6.1733 12.3465 0.0461 Constraint 728 998 6.1884 7.7355 15.4709 0.0461 Constraint 892 1095 6.0462 7.5578 15.1156 0.0460 Constraint 728 990 4.9400 6.1749 12.3499 0.0460 Constraint 317 624 6.1655 7.7069 15.4138 0.0459 Constraint 18 282 5.8706 7.3383 14.6766 0.0459 Constraint 18 275 4.3822 5.4778 10.9556 0.0459 Constraint 892 1192 5.3276 6.6595 13.3190 0.0459 Constraint 624 939 5.5336 6.9169 13.8339 0.0459 Constraint 132 275 6.2382 7.7978 15.5956 0.0459 Constraint 781 1066 5.7347 7.1683 14.3367 0.0458 Constraint 1031 1174 5.4169 6.7711 13.5422 0.0456 Constraint 510 728 5.9594 7.4492 14.8985 0.0455 Constraint 1075 1373 6.3831 7.9788 15.9576 0.0453 Constraint 1075 1362 5.9175 7.3968 14.7937 0.0453 Constraint 1075 1354 6.3754 7.9692 15.9385 0.0453 Constraint 1075 1347 5.1846 6.4808 12.9616 0.0453 Constraint 1075 1329 4.0991 5.1238 10.2477 0.0453 Constraint 481 1421 5.5413 6.9267 13.8534 0.0453 Constraint 472 683 3.8787 4.8484 9.6968 0.0453 Constraint 464 1347 6.2811 7.8514 15.7028 0.0453 Constraint 464 1339 3.3683 4.2104 8.4207 0.0453 Constraint 335 708 6.3133 7.8916 15.7832 0.0453 Constraint 335 481 4.6097 5.7621 11.5242 0.0453 Constraint 325 1395 6.1031 7.6288 15.2576 0.0453 Constraint 325 1354 5.9675 7.4593 14.9186 0.0453 Constraint 325 1347 2.8708 3.5885 7.1770 0.0453 Constraint 325 1339 4.6036 5.7544 11.5089 0.0453 Constraint 325 1066 3.4475 4.3094 8.6189 0.0453 Constraint 309 1430 5.5785 6.9731 13.9462 0.0453 Constraint 309 1421 6.2185 7.7731 15.5463 0.0453 Constraint 309 1395 6.1692 7.7115 15.4230 0.0453 Constraint 177 317 5.6030 7.0038 14.0076 0.0453 Constraint 155 317 4.4366 5.5457 11.0915 0.0453 Constraint 148 335 6.2732 7.8415 15.6830 0.0453 Constraint 148 317 5.8722 7.3402 14.6804 0.0453 Constraint 69 1075 6.3432 7.9290 15.8581 0.0453 Constraint 522 900 4.0054 5.0068 10.0136 0.0453 Constraint 510 931 6.3068 7.8835 15.7669 0.0453 Constraint 488 841 3.9215 4.9019 9.8038 0.0453 Constraint 900 973 4.6971 5.8714 11.7429 0.0452 Constraint 852 1395 4.6729 5.8411 11.6823 0.0451 Constraint 833 1430 6.1115 7.6394 15.2788 0.0451 Constraint 833 1421 5.2931 6.6163 13.2327 0.0451 Constraint 814 1451 5.6237 7.0297 14.0593 0.0451 Constraint 596 1430 5.1253 6.4066 12.8131 0.0451 Constraint 579 1459 4.6467 5.8084 11.6168 0.0451 Constraint 214 1430 5.8754 7.3442 14.6884 0.0451 Constraint 205 1402 3.9684 4.9605 9.9210 0.0451 Constraint 624 773 3.6859 4.6073 9.2147 0.0448 Constraint 708 822 4.8432 6.0540 12.1079 0.0448 Constraint 488 967 5.6286 7.0358 14.0715 0.0446 Constraint 373 1015 4.2402 5.3003 10.6006 0.0446 Constraint 362 1015 4.7413 5.9267 11.8534 0.0446 Constraint 343 1039 6.1665 7.7082 15.4163 0.0446 Constraint 343 1031 4.3736 5.4670 10.9340 0.0446 Constraint 297 408 4.8728 6.0910 12.1820 0.0446 Constraint 214 309 6.1350 7.6687 15.3374 0.0443 Constraint 177 1031 6.0978 7.6222 15.2445 0.0443 Constraint 973 1295 4.7741 5.9676 11.9352 0.0442 Constraint 351 852 5.8373 7.2966 14.5932 0.0442 Constraint 325 532 4.8451 6.0564 12.1127 0.0441 Constraint 155 257 5.2852 6.6065 13.2130 0.0441 Constraint 41 973 6.1371 7.6713 15.3426 0.0440 Constraint 472 762 5.3215 6.6518 13.3037 0.0440 Constraint 402 1066 3.7811 4.7264 9.4529 0.0439 Constraint 41 177 5.6958 7.1198 14.2396 0.0438 Constraint 562 884 5.4917 6.8647 13.7293 0.0438 Constraint 522 924 4.3568 5.4460 10.8919 0.0438 Constraint 522 884 5.9040 7.3799 14.7599 0.0438 Constraint 728 944 3.3811 4.2264 8.4528 0.0437 Constraint 822 915 4.9140 6.1425 12.2851 0.0436 Constraint 570 900 4.9463 6.1829 12.3657 0.0436 Constraint 417 602 4.1878 5.2347 10.4695 0.0436 Constraint 214 455 5.6849 7.1061 14.2122 0.0435 Constraint 464 1087 5.9725 7.4656 14.9312 0.0434 Constraint 115 351 4.8416 6.0520 12.1041 0.0434 Constraint 1174 1373 4.0913 5.1141 10.2283 0.0432 Constraint 499 742 4.8368 6.0460 12.0921 0.0431 Constraint 544 700 5.7423 7.1779 14.3558 0.0431 Constraint 297 794 4.3151 5.3939 10.7878 0.0431 Constraint 789 981 5.9235 7.4044 14.8087 0.0431 Constraint 931 1421 5.2974 6.6218 13.2436 0.0430 Constraint 924 1421 4.5924 5.7405 11.4810 0.0430 Constraint 309 1106 5.2207 6.5259 13.0518 0.0430 Constraint 309 439 5.8596 7.3246 14.6491 0.0430 Constraint 297 1106 4.2941 5.3677 10.7354 0.0430 Constraint 297 1095 5.3979 6.7474 13.4948 0.0430 Constraint 297 1087 5.5098 6.8872 13.7744 0.0430 Constraint 297 1075 5.6285 7.0356 14.0712 0.0430 Constraint 1106 1192 5.8537 7.3171 14.6343 0.0430 Constraint 214 596 6.2799 7.8499 15.6998 0.0428 Constraint 148 610 5.1123 6.3904 12.7808 0.0428 Constraint 92 618 4.0613 5.0766 10.1532 0.0428 Constraint 805 1087 5.6207 7.0258 14.0517 0.0427 Constraint 602 716 6.2879 7.8598 15.7197 0.0427 Constraint 380 833 5.9315 7.4144 14.8288 0.0427 Constraint 402 674 4.2558 5.3197 10.6395 0.0427 Constraint 723 852 4.8853 6.1066 12.2132 0.0425 Constraint 380 794 5.9039 7.3799 14.7599 0.0424 Constraint 132 309 4.6567 5.8209 11.6418 0.0422 Constraint 884 1106 4.4801 5.6001 11.2001 0.0421 Constraint 805 981 4.0263 5.0329 10.0658 0.0421 Constraint 380 570 4.5101 5.6377 11.2754 0.0420 Constraint 1095 1174 4.4078 5.5097 11.0195 0.0420 Constraint 1087 1186 4.7599 5.9499 11.8998 0.0420 Constraint 624 967 4.8112 6.0140 12.0279 0.0420 Constraint 394 610 5.0282 6.2852 12.5705 0.0419 Constraint 624 728 5.2575 6.5719 13.1438 0.0419 Constraint 84 214 5.2766 6.5957 13.1914 0.0418 Constraint 1087 1208 5.8412 7.3015 14.6030 0.0418 Constraint 163 532 5.2358 6.5447 13.0894 0.0417 Constraint 1124 1225 4.2142 5.2678 10.5355 0.0416 Constraint 700 1159 5.9822 7.4777 14.9555 0.0415 Constraint 1264 1413 4.5058 5.6322 11.2644 0.0414 Constraint 1264 1402 5.2608 6.5761 13.1521 0.0414 Constraint 1264 1395 5.0760 6.3450 12.6900 0.0414 Constraint 1256 1413 4.8886 6.1108 12.2215 0.0414 Constraint 1256 1386 5.1023 6.3779 12.7558 0.0414 Constraint 1244 1402 5.2101 6.5127 13.0254 0.0414 Constraint 1244 1386 5.4955 6.8694 13.7388 0.0414 Constraint 1235 1395 4.9108 6.1385 12.2770 0.0414 Constraint 1235 1386 4.9329 6.1662 12.3323 0.0414 Constraint 900 1124 5.7939 7.2424 14.4847 0.0414 Constraint 892 1347 6.3666 7.9583 15.9166 0.0414 Constraint 871 1402 6.3804 7.9755 15.9509 0.0414 Constraint 794 1087 5.2056 6.5070 13.0139 0.0414 Constraint 789 1039 2.8945 3.6181 7.2362 0.0414 Constraint 789 1031 5.5623 6.9528 13.9057 0.0414 Constraint 789 1024 5.2572 6.5715 13.1429 0.0414 Constraint 781 1039 5.5857 6.9821 13.9642 0.0414 Constraint 781 1031 5.6608 7.0760 14.1520 0.0414 Constraint 762 1024 5.2638 6.5798 13.1596 0.0414 Constraint 762 973 5.0027 6.2534 12.5068 0.0414 Constraint 742 990 5.7245 7.1557 14.3113 0.0414 Constraint 551 762 4.1406 5.1757 10.3514 0.0414 Constraint 551 700 4.1471 5.1839 10.3677 0.0414 Constraint 544 691 4.2374 5.2967 10.5934 0.0414 Constraint 544 683 5.6019 7.0024 14.0047 0.0414 Constraint 532 700 4.5901 5.7376 11.4753 0.0414 Constraint 532 691 6.3374 7.9218 15.8435 0.0414 Constraint 532 683 3.9000 4.8750 9.7499 0.0414 Constraint 522 683 5.5883 6.9853 13.9706 0.0414 Constraint 455 814 6.2851 7.8564 15.7128 0.0414 Constraint 422 833 5.2140 6.5175 13.0351 0.0414 Constraint 422 814 6.2980 7.8725 15.7450 0.0414 Constraint 335 814 5.9697 7.4621 14.9242 0.0414 Constraint 325 814 5.9538 7.4422 14.8845 0.0414 Constraint 325 805 4.3575 5.4468 10.8937 0.0414 Constraint 325 728 4.2340 5.2925 10.5850 0.0414 Constraint 317 822 6.2442 7.8053 15.6106 0.0414 Constraint 317 805 5.8930 7.3662 14.7325 0.0414 Constraint 309 773 5.9979 7.4974 14.9948 0.0414 Constraint 309 762 3.4563 4.3203 8.6406 0.0414 Constraint 297 781 4.9357 6.1696 12.3393 0.0414 Constraint 297 386 4.2886 5.3607 10.7214 0.0414 Constraint 291 789 4.6531 5.8164 11.6328 0.0414 Constraint 291 781 3.2748 4.0935 8.1871 0.0414 Constraint 291 773 5.7503 7.1879 14.3758 0.0414 Constraint 291 386 6.3966 7.9958 15.9915 0.0414 Constraint 291 380 4.6173 5.7716 11.5432 0.0414 Constraint 282 789 4.7922 5.9902 11.9804 0.0414 Constraint 282 386 4.5564 5.6954 11.3909 0.0414 Constraint 249 488 3.9496 4.9370 9.8739 0.0414 Constraint 214 446 5.1260 6.4075 12.8151 0.0414 Constraint 214 380 6.2341 7.7926 15.5852 0.0414 Constraint 185 446 6.3991 7.9988 15.9977 0.0414 Constraint 177 446 4.0616 5.0770 10.1540 0.0414 Constraint 177 422 4.6932 5.8665 11.7329 0.0414 Constraint 177 380 4.5187 5.6484 11.2969 0.0414 Constraint 155 362 5.8062 7.2577 14.5154 0.0414 Constraint 141 481 4.9034 6.1293 12.2585 0.0414 Constraint 431 551 4.0376 5.0470 10.0940 0.0413 Constraint 596 900 5.3163 6.6453 13.2907 0.0412 Constraint 700 900 4.5759 5.7198 11.4397 0.0412 Constraint 351 422 4.2990 5.3738 10.7476 0.0412 Constraint 373 864 5.4711 6.8389 13.6778 0.0412 Constraint 762 1075 5.0513 6.3141 12.6283 0.0412 Constraint 317 1430 5.7622 7.2027 14.4055 0.0411 Constraint 317 1395 5.2258 6.5323 13.0646 0.0411 Constraint 297 1459 5.7169 7.1461 14.2922 0.0411 Constraint 297 1430 5.0819 6.3523 12.7046 0.0411 Constraint 488 585 5.5441 6.9302 13.8603 0.0411 Constraint 185 683 6.1599 7.6998 15.3997 0.0410 Constraint 185 674 3.5551 4.4439 8.8877 0.0410 Constraint 871 1024 5.1988 6.4986 12.9971 0.0410 Constraint 309 431 5.2275 6.5344 13.0688 0.0409 Constraint 155 229 4.3962 5.4952 10.9905 0.0409 Constraint 488 833 5.7640 7.2050 14.4099 0.0409 Constraint 472 998 3.9004 4.8755 9.7511 0.0409 Constraint 380 852 4.4527 5.5659 11.1318 0.0408 Constraint 343 488 4.5642 5.7053 11.4106 0.0408 Constraint 464 944 4.7810 5.9763 11.9525 0.0408 Constraint 610 1213 5.1230 6.4038 12.8076 0.0408 Constraint 532 669 4.6907 5.8634 11.7268 0.0407 Constraint 532 660 5.9917 7.4897 14.9794 0.0407 Constraint 532 649 4.2453 5.3066 10.6131 0.0407 Constraint 417 990 3.0118 3.7647 7.5294 0.0407 Constraint 408 990 2.6860 3.3575 6.7150 0.0407 Constraint 408 981 4.7605 5.9506 11.9012 0.0407 Constraint 408 973 5.2184 6.5230 13.0460 0.0407 Constraint 402 981 3.7155 4.6444 9.2887 0.0407 Constraint 124 814 5.6146 7.0183 14.0365 0.0407 Constraint 62 532 5.4897 6.8622 13.7244 0.0407 Constraint 1087 1174 5.7866 7.2332 14.4664 0.0407 Constraint 335 1087 4.9165 6.1456 12.2912 0.0407 Constraint 674 773 5.1045 6.3806 12.7612 0.0406 Constraint 92 282 4.6206 5.7758 11.5516 0.0406 Constraint 562 649 5.4610 6.8262 13.6524 0.0406 Constraint 373 562 4.2635 5.3294 10.6588 0.0406 Constraint 177 852 6.0255 7.5318 15.0637 0.0406 Constraint 439 641 3.9770 4.9712 9.9425 0.0405 Constraint 431 762 6.1819 7.7273 15.4546 0.0405 Constraint 257 351 5.2735 6.5919 13.1837 0.0403 Constraint 351 841 5.1810 6.4763 12.9526 0.0403 Constraint 351 833 4.1495 5.1869 10.3737 0.0403 Constraint 814 1007 5.7411 7.1763 14.3526 0.0403 Constraint 660 814 5.1253 6.4067 12.8133 0.0403 Constraint 408 1051 4.9823 6.2278 12.4556 0.0401 Constraint 177 455 5.7517 7.1896 14.3792 0.0400 Constraint 864 1124 5.4475 6.8094 13.6187 0.0398 Constraint 1051 1256 5.4192 6.7740 13.5479 0.0396 Constraint 1051 1244 4.4597 5.5746 11.1491 0.0396 Constraint 1051 1213 5.5923 6.9904 13.9808 0.0396 Constraint 249 1264 5.2664 6.5831 13.1661 0.0396 Constraint 62 951 5.2655 6.5819 13.1638 0.0396 Constraint 54 1144 4.4860 5.6075 11.2149 0.0396 Constraint 46 1031 5.7354 7.1692 14.3384 0.0396 Constraint 41 1213 5.9331 7.4164 14.8328 0.0396 Constraint 41 1051 4.8164 6.0205 12.0410 0.0396 Constraint 41 1039 5.5055 6.8818 13.7636 0.0396 Constraint 41 1031 4.7871 5.9839 11.9677 0.0396 Constraint 29 1051 6.2159 7.7699 15.5398 0.0396 Constraint 18 1256 4.4275 5.5343 11.0687 0.0396 Constraint 18 1051 5.7787 7.2234 14.4467 0.0396 Constraint 18 257 5.7981 7.2477 14.4954 0.0396 Constraint 649 723 5.6527 7.0658 14.1317 0.0396 Constraint 431 683 5.4743 6.8428 13.6856 0.0395 Constraint 510 822 4.9296 6.1620 12.3240 0.0395 Constraint 570 781 5.6961 7.1202 14.2403 0.0394 Constraint 214 683 4.9227 6.1534 12.3067 0.0394 Constraint 214 674 4.5355 5.6694 11.3387 0.0394 Constraint 185 708 4.1224 5.1530 10.3060 0.0394 Constraint 185 700 3.3695 4.2118 8.4237 0.0394 Constraint 185 669 6.0189 7.5237 15.0473 0.0394 Constraint 177 674 2.9580 3.6975 7.3950 0.0394 Constraint 177 641 5.1625 6.4531 12.9062 0.0394 Constraint 579 981 4.5983 5.7479 11.4959 0.0393 Constraint 570 981 5.5797 6.9747 13.9493 0.0393 Constraint 155 297 4.0364 5.0455 10.0910 0.0393 Constraint 394 864 6.1116 7.6396 15.2791 0.0393 Constraint 386 884 4.6182 5.7728 11.5456 0.0392 Constraint 222 544 5.6118 7.0148 14.0296 0.0391 Constraint 439 728 4.6868 5.8585 11.7169 0.0391 Constraint 562 742 6.0459 7.5573 15.1146 0.0390 Constraint 723 924 4.1860 5.2325 10.4649 0.0389 Constraint 343 439 5.5701 6.9626 13.9253 0.0388 Constraint 602 990 6.0820 7.6026 15.2051 0.0388 Constraint 455 532 4.6300 5.7875 11.5750 0.0386 Constraint 69 148 3.8995 4.8744 9.7489 0.0386 Constraint 833 1192 5.2180 6.5224 13.0449 0.0386 Constraint 884 951 5.2158 6.5197 13.0395 0.0385 Constraint 335 1124 4.9540 6.1925 12.3850 0.0385 Constraint 115 822 4.0705 5.0881 10.1762 0.0385 Constraint 499 915 4.7741 5.9676 11.9352 0.0384 Constraint 641 756 4.7014 5.8767 11.7534 0.0384 Constraint 822 967 5.7583 7.1979 14.3957 0.0384 Constraint 402 907 5.9357 7.4196 14.8391 0.0383 Constraint 402 900 3.7617 4.7022 9.4043 0.0383 Constraint 579 951 4.7311 5.9139 11.8278 0.0383 Constraint 660 773 4.9447 6.1808 12.3616 0.0383 Constraint 408 481 4.7792 5.9740 11.9480 0.0383 Constraint 439 833 6.1079 7.6349 15.2697 0.0382 Constraint 781 864 5.1872 6.4841 12.9681 0.0382 Constraint 351 544 5.0666 6.3333 12.6665 0.0381 Constraint 649 728 5.5380 6.9225 13.8450 0.0381 Constraint 708 951 5.6953 7.1191 14.2381 0.0380 Constraint 951 1095 5.8511 7.3139 14.6277 0.0380 Constraint 394 700 4.3102 5.3877 10.7755 0.0380 Constraint 1106 1201 5.2405 6.5507 13.1014 0.0380 Constraint 515 596 4.1938 5.2422 10.4845 0.0379 Constraint 455 585 6.0527 7.5659 15.1318 0.0379 Constraint 841 1192 4.8617 6.0771 12.1541 0.0378 Constraint 871 1144 5.7828 7.2285 14.4571 0.0378 Constraint 907 990 5.8957 7.3697 14.7393 0.0376 Constraint 841 1295 5.6825 7.1031 14.2063 0.0376 Constraint 325 579 5.7000 7.1250 14.2499 0.0375 Constraint 1150 1235 4.6347 5.7934 11.5868 0.0375 Constraint 237 362 5.9104 7.3880 14.7760 0.0375 Constraint 610 1225 5.2181 6.5227 13.0453 0.0374 Constraint 610 900 5.1489 6.4361 12.8722 0.0373 Constraint 464 716 4.8110 6.0137 12.0274 0.0373 Constraint 510 951 4.3717 5.4647 10.9293 0.0372 Constraint 532 944 4.5952 5.7440 11.4879 0.0372 Constraint 515 944 6.0812 7.6015 15.2031 0.0372 Constraint 488 951 5.0946 6.3683 12.7366 0.0372 Constraint 417 756 5.6757 7.0947 14.1893 0.0372 Constraint 408 762 4.2505 5.3131 10.6263 0.0372 Constraint 386 998 5.0522 6.3153 12.6305 0.0372 Constraint 373 1007 6.3659 7.9574 15.9148 0.0372 Constraint 373 998 5.8722 7.3402 14.6805 0.0372 Constraint 362 1007 5.1653 6.4566 12.9132 0.0372 Constraint 362 998 6.0536 7.5670 15.1340 0.0372 Constraint 362 794 3.7137 4.6422 9.2843 0.0372 Constraint 351 1024 3.5170 4.3963 8.7926 0.0372 Constraint 351 1015 3.7553 4.6941 9.3882 0.0372 Constraint 351 1007 5.8870 7.3588 14.7176 0.0372 Constraint 343 1024 6.0223 7.5278 15.0557 0.0372 Constraint 343 1007 4.8897 6.1121 12.2241 0.0372 Constraint 343 805 5.0774 6.3467 12.6934 0.0372 Constraint 431 1007 5.5782 6.9727 13.9455 0.0372 Constraint 431 998 4.3923 5.4903 10.9807 0.0372 Constraint 716 915 4.5990 5.7488 11.4976 0.0371 Constraint 716 900 5.0882 6.3602 12.7205 0.0371 Constraint 708 892 4.3511 5.4388 10.8777 0.0371 Constraint 402 472 5.6215 7.0269 14.0537 0.0370 Constraint 924 1095 4.4863 5.6079 11.2157 0.0369 Constraint 69 177 5.4829 6.8536 13.7072 0.0369 Constraint 585 762 4.6957 5.8696 11.7393 0.0369 Constraint 579 762 4.2223 5.2779 10.5557 0.0369 Constraint 196 499 6.3396 7.9245 15.8490 0.0368 Constraint 700 1168 3.9980 4.9975 9.9951 0.0368 Constraint 700 1133 5.9769 7.4711 14.9422 0.0368 Constraint 610 1201 4.3308 5.4135 10.8270 0.0368 Constraint 610 1174 3.4503 4.3128 8.6257 0.0368 Constraint 585 900 3.2859 4.1074 8.2147 0.0368 Constraint 141 422 4.7636 5.9545 11.9090 0.0368 Constraint 892 1039 4.7323 5.9154 11.8309 0.0368 Constraint 781 998 3.5021 4.3776 8.7553 0.0367 Constraint 373 924 5.5505 6.9382 13.8764 0.0366 Constraint 177 522 5.5496 6.9369 13.8739 0.0366 Constraint 742 924 4.4653 5.5816 11.1632 0.0366 Constraint 723 915 5.7053 7.1316 14.2632 0.0366 Constraint 249 373 5.7250 7.1563 14.3126 0.0366 Constraint 907 1007 6.1479 7.6849 15.3698 0.0365 Constraint 544 618 5.8167 7.2709 14.5418 0.0365 Constraint 515 841 5.5715 6.9644 13.9288 0.0365 Constraint 515 618 3.7035 4.6294 9.2588 0.0365 Constraint 343 499 5.4672 6.8340 13.6680 0.0365 Constraint 380 579 5.2736 6.5920 13.1840 0.0365 Constraint 317 973 4.3840 5.4800 10.9599 0.0365 Constraint 309 610 5.3114 6.6392 13.2785 0.0365 Constraint 325 422 5.0931 6.3664 12.7328 0.0365 Constraint 841 1225 5.8219 7.2774 14.5547 0.0365 Constraint 464 924 5.1633 6.4541 12.9082 0.0364 Constraint 69 602 3.6804 4.6004 9.2009 0.0363 Constraint 380 805 6.0100 7.5125 15.0250 0.0363 Constraint 981 1150 5.1285 6.4106 12.8212 0.0361 Constraint 781 981 4.2272 5.2840 10.5680 0.0361 Constraint 1235 1373 4.6127 5.7659 11.5318 0.0361 Constraint 1225 1395 6.1125 7.6406 15.2813 0.0361 Constraint 1225 1373 5.9146 7.3933 14.7865 0.0361 Constraint 1213 1395 4.2012 5.2515 10.5030 0.0361 Constraint 1213 1373 4.5443 5.6804 11.3608 0.0361 Constraint 1208 1373 4.6774 5.8467 11.6934 0.0361 Constraint 1150 1421 6.2370 7.7963 15.5925 0.0361 Constraint 1150 1395 5.6780 7.0975 14.1949 0.0361 Constraint 1150 1386 4.0804 5.1005 10.2010 0.0361 Constraint 1024 1451 5.8850 7.3563 14.7125 0.0361 Constraint 915 981 6.0897 7.6121 15.2242 0.0361 Constraint 871 1213 5.1410 6.4263 12.8526 0.0361 Constraint 871 1208 6.1803 7.7254 15.4509 0.0361 Constraint 871 1186 5.6858 7.1072 14.2145 0.0361 Constraint 852 1430 6.0750 7.5938 15.1876 0.0361 Constraint 852 1421 4.0324 5.0404 10.0809 0.0361 Constraint 833 1451 2.7370 3.4213 6.8425 0.0361 Constraint 833 1442 5.5007 6.8759 13.7518 0.0361 Constraint 822 1451 6.1454 7.6817 15.3634 0.0361 Constraint 822 1007 5.7667 7.2084 14.4168 0.0361 Constraint 618 1192 5.4883 6.8604 13.7208 0.0361 Constraint 596 1459 6.0050 7.5062 15.0124 0.0361 Constraint 249 1459 6.1347 7.6684 15.3367 0.0361 Constraint 214 1459 5.8327 7.2909 14.5818 0.0361 Constraint 205 1430 5.9651 7.4564 14.9128 0.0361 Constraint 177 1430 5.0835 6.3544 12.7088 0.0361 Constraint 177 1402 5.4013 6.7516 13.5032 0.0361 Constraint 168 1402 6.1354 7.6692 15.3384 0.0361 Constraint 168 1235 3.6825 4.6031 9.2062 0.0361 Constraint 168 1225 4.5013 5.6266 11.2533 0.0361 Constraint 155 1225 5.4719 6.8399 13.6799 0.0361 Constraint 124 1225 4.3687 5.4608 10.9217 0.0361 Constraint 579 1451 6.3438 7.9298 15.8596 0.0361 Constraint 1066 1201 4.2699 5.3374 10.6747 0.0361 Constraint 196 488 5.0725 6.3406 12.6813 0.0360 Constraint 773 998 5.7444 7.1805 14.3610 0.0360 Constraint 214 515 5.2539 6.5673 13.1347 0.0360 Constraint 185 481 4.7712 5.9640 11.9280 0.0358 Constraint 1213 1413 4.8700 6.0876 12.1751 0.0358 Constraint 325 641 5.3612 6.7015 13.4030 0.0357 Constraint 325 632 3.2573 4.0716 8.1432 0.0357 Constraint 325 618 4.9662 6.2077 12.4155 0.0357 Constraint 317 632 5.4919 6.8649 13.7298 0.0357 Constraint 309 632 5.9298 7.4122 14.8244 0.0357 Constraint 177 805 4.3303 5.4129 10.8259 0.0357 Constraint 488 674 5.5537 6.9421 13.8843 0.0356 Constraint 649 990 5.8348 7.2934 14.5869 0.0356 Constraint 781 958 5.9063 7.3829 14.7658 0.0356 Constraint 973 1244 5.6506 7.0633 14.1266 0.0356 Constraint 570 762 5.2092 6.5115 13.0231 0.0355 Constraint 660 781 4.5899 5.7374 11.4748 0.0355 Constraint 1024 1174 5.4580 6.8225 13.6450 0.0355 Constraint 439 814 4.6400 5.8000 11.6000 0.0354 Constraint 325 951 5.7296 7.1620 14.3241 0.0354 Constraint 1133 1225 4.8661 6.0826 12.1651 0.0353 Constraint 373 884 5.6361 7.0452 14.0904 0.0353 Constraint 62 148 4.8222 6.0277 12.0554 0.0352 Constraint 499 610 5.1580 6.4475 12.8950 0.0351 Constraint 669 742 4.4935 5.6169 11.2339 0.0351 Constraint 325 544 4.9852 6.2315 12.4631 0.0351 Constraint 325 522 3.9553 4.9442 9.8883 0.0351 Constraint 805 944 5.9490 7.4363 14.8726 0.0351 Constraint 649 967 5.1022 6.3777 12.7554 0.0350 Constraint 380 814 4.3709 5.4636 10.9273 0.0350 Constraint 373 814 5.1486 6.4357 12.8715 0.0350 Constraint 362 446 6.3089 7.8861 15.7722 0.0350 Constraint 351 924 5.7211 7.1514 14.3028 0.0350 Constraint 343 841 4.6765 5.8456 11.6913 0.0350 Constraint 229 325 4.6672 5.8340 11.6681 0.0350 Constraint 222 325 6.0746 7.5932 15.1864 0.0350 Constraint 214 723 5.6197 7.0247 14.0493 0.0350 Constraint 214 708 3.3068 4.1335 8.2670 0.0350 Constraint 214 343 5.0798 6.3497 12.6994 0.0350 Constraint 205 325 5.0543 6.3178 12.6357 0.0350 Constraint 177 649 5.9763 7.4703 14.9407 0.0350 Constraint 163 700 6.2606 7.8257 15.6514 0.0350 Constraint 54 1087 5.1706 6.4632 12.9265 0.0348 Constraint 544 998 5.0405 6.3006 12.6012 0.0347 Constraint 871 990 5.5930 6.9913 13.9826 0.0346 Constraint 185 362 5.8214 7.2767 14.5535 0.0346 Constraint 84 282 5.4886 6.8607 13.7214 0.0346 Constraint 343 1421 4.6831 5.8538 11.7077 0.0346 Constraint 343 1395 4.7033 5.8792 11.7584 0.0346 Constraint 249 781 5.9717 7.4647 14.9293 0.0346 Constraint 249 773 4.5413 5.6766 11.3532 0.0346 Constraint 222 781 5.7177 7.1472 14.2943 0.0346 Constraint 222 773 5.9383 7.4229 14.8459 0.0346 Constraint 579 990 4.6892 5.8615 11.7230 0.0346 Constraint 570 990 6.1515 7.6894 15.3789 0.0346 Constraint 551 892 5.8948 7.3685 14.7370 0.0346 Constraint 481 716 6.2983 7.8729 15.7458 0.0346 Constraint 446 723 3.6328 4.5410 9.0819 0.0346 Constraint 446 716 4.8945 6.1181 12.2362 0.0346 Constraint 394 708 4.5722 5.7153 11.4306 0.0346 Constraint 386 708 6.1977 7.7471 15.4943 0.0346 Constraint 386 700 5.7311 7.1638 14.3277 0.0346 Constraint 386 691 5.5291 6.9114 13.8227 0.0346 Constraint 380 562 4.9632 6.2040 12.4079 0.0346 Constraint 222 762 6.3819 7.9773 15.9547 0.0346 Constraint 196 510 6.3155 7.8944 15.7888 0.0346 Constraint 951 1295 5.9352 7.4190 14.8379 0.0344 Constraint 794 998 4.5843 5.7304 11.4608 0.0344 Constraint 632 773 6.0356 7.5446 15.0891 0.0342 Constraint 551 822 4.8758 6.0947 12.1895 0.0341 Constraint 386 455 4.9034 6.1293 12.2585 0.0341 Constraint 871 973 6.1043 7.6303 15.2606 0.0340 Constraint 1087 1225 5.8170 7.2713 14.5425 0.0339 Constraint 132 291 6.3236 7.9045 15.8089 0.0339 Constraint 417 488 5.8038 7.2548 14.5096 0.0338 Constraint 522 852 6.0042 7.5053 15.0106 0.0338 Constraint 317 499 5.0430 6.3038 12.6076 0.0338 Constraint 532 967 6.1318 7.6647 15.3294 0.0337 Constraint 266 488 6.1347 7.6683 15.3366 0.0337 Constraint 100 317 6.0037 7.5047 15.0093 0.0337 Constraint 351 488 5.5640 6.9551 13.9101 0.0336 Constraint 789 915 5.0032 6.2540 12.5081 0.0334 Constraint 602 756 4.5811 5.7264 11.4527 0.0334 Constraint 1087 1264 4.4762 5.5953 11.1906 0.0332 Constraint 205 343 5.9740 7.4675 14.9351 0.0331 Constraint 488 602 5.4483 6.8104 13.6209 0.0330 Constraint 373 951 5.8176 7.2720 14.5440 0.0329 Constraint 343 1106 6.1237 7.6546 15.3091 0.0329 Constraint 335 1106 4.9991 6.2489 12.4978 0.0329 Constraint 205 275 6.0571 7.5714 15.1429 0.0329 Constraint 386 892 5.1156 6.3945 12.7889 0.0329 Constraint 915 1124 5.6209 7.0261 14.0523 0.0329 Constraint 522 641 4.1043 5.1304 10.2608 0.0329 Constraint 439 1075 4.9307 6.1634 12.3268 0.0329 Constraint 417 1075 3.0105 3.7631 7.5263 0.0329 Constraint 417 1066 5.1113 6.3892 12.7784 0.0329 Constraint 408 1095 4.8039 6.0049 12.0097 0.0329 Constraint 408 1075 2.7570 3.4462 6.8924 0.0329 Constraint 408 1066 4.5142 5.6428 11.2855 0.0329 Constraint 408 1039 5.5915 6.9894 13.9787 0.0329 Constraint 402 1075 4.8542 6.0678 12.1356 0.0329 Constraint 402 1039 3.6470 4.5588 9.1176 0.0329 Constraint 266 728 3.8374 4.7967 9.5934 0.0329 Constraint 257 728 5.4784 6.8480 13.6960 0.0329 Constraint 297 402 5.4638 6.8297 13.6594 0.0328 Constraint 297 394 4.5095 5.6369 11.2738 0.0328 Constraint 291 394 5.6492 7.0615 14.1230 0.0328 Constraint 439 596 5.0084 6.2606 12.5211 0.0328 Constraint 683 773 4.8235 6.0294 12.0589 0.0327 Constraint 257 380 5.4725 6.8406 13.6811 0.0327 Constraint 237 380 6.0608 7.5761 15.1521 0.0327 Constraint 683 944 3.9274 4.9093 9.8186 0.0327 Constraint 275 343 5.3939 6.7424 13.4848 0.0327 Constraint 275 362 3.5224 4.4030 8.8061 0.0327 Constraint 931 1075 5.0015 6.2518 12.5037 0.0326 Constraint 756 915 5.7667 7.2084 14.4168 0.0326 Constraint 579 944 4.1282 5.1603 10.3206 0.0326 Constraint 386 632 5.9077 7.3846 14.7692 0.0326 Constraint 691 805 5.7903 7.2379 14.4758 0.0325 Constraint 155 464 5.2273 6.5341 13.0683 0.0324 Constraint 472 805 5.5942 6.9927 13.9855 0.0324 Constraint 115 781 4.8380 6.0475 12.0951 0.0323 Constraint 115 773 5.6291 7.0364 14.0728 0.0323 Constraint 185 510 4.7088 5.8860 11.7721 0.0323 Constraint 973 1168 5.4702 6.8378 13.6756 0.0321 Constraint 944 1015 4.8343 6.0429 12.0858 0.0321 Constraint 931 1402 5.5851 6.9814 13.9628 0.0321 Constraint 924 1402 4.9041 6.1301 12.2602 0.0321 Constraint 900 1007 5.7007 7.1258 14.2517 0.0321 Constraint 892 1402 6.0131 7.5164 15.0328 0.0321 Constraint 708 1168 6.1039 7.6299 15.2598 0.0321 Constraint 700 1174 5.4734 6.8418 13.6836 0.0321 Constraint 700 871 3.4347 4.2934 8.5867 0.0321 Constraint 700 864 3.6305 4.5381 9.0762 0.0321 Constraint 674 1174 4.1313 5.1641 10.3282 0.0321 Constraint 674 1168 3.9043 4.8803 9.7606 0.0321 Constraint 674 1133 3.6532 4.5665 9.1329 0.0321 Constraint 632 1186 5.1496 6.4370 12.8740 0.0321 Constraint 632 1174 3.0813 3.8516 7.7032 0.0321 Constraint 632 1168 5.6680 7.0850 14.1701 0.0321 Constraint 618 1174 6.1215 7.6519 15.3038 0.0321 Constraint 610 1186 5.8910 7.3637 14.7274 0.0321 Constraint 602 1201 6.3979 7.9974 15.9948 0.0321 Constraint 602 1174 6.3918 7.9897 15.9794 0.0321 Constraint 602 907 5.4988 6.8734 13.7469 0.0321 Constraint 585 1201 5.2139 6.5173 13.0346 0.0321 Constraint 579 1213 6.1941 7.7426 15.4851 0.0321 Constraint 579 1201 4.3331 5.4163 10.8326 0.0321 Constraint 522 892 4.5686 5.7107 11.4214 0.0321 Constraint 522 618 5.6336 7.0421 14.0841 0.0321 Constraint 515 924 5.0738 6.3422 12.6844 0.0321 Constraint 515 852 5.2839 6.6048 13.2097 0.0321 Constraint 515 833 4.2104 5.2631 10.5261 0.0321 Constraint 515 624 5.0135 6.2669 12.5338 0.0321 Constraint 510 990 3.1449 3.9311 7.8623 0.0321 Constraint 510 981 6.0847 7.6059 15.2118 0.0321 Constraint 510 944 3.3722 4.2152 8.4304 0.0321 Constraint 510 924 3.3834 4.2293 8.4586 0.0321 Constraint 510 915 6.0867 7.6084 15.2168 0.0321 Constraint 510 841 4.2657 5.3321 10.6642 0.0321 Constraint 499 998 5.7724 7.2155 14.4310 0.0321 Constraint 499 990 4.8442 6.0553 12.1106 0.0321 Constraint 488 998 5.0764 6.3456 12.6911 0.0321 Constraint 488 990 3.5798 4.4748 8.9495 0.0321 Constraint 488 822 4.6212 5.7766 11.5531 0.0321 Constraint 481 998 4.4404 5.5506 11.1011 0.0321 Constraint 481 990 6.1233 7.6542 15.3083 0.0321 Constraint 481 822 5.6674 7.0842 14.1684 0.0321 Constraint 417 907 5.1253 6.4066 12.8133 0.0321 Constraint 417 585 5.6626 7.0783 14.1565 0.0321 Constraint 408 1133 4.9934 6.2418 12.4836 0.0321 Constraint 394 907 2.7220 3.4025 6.8050 0.0321 Constraint 386 1095 6.1855 7.7318 15.4636 0.0321 Constraint 343 998 5.1951 6.4938 12.9877 0.0321 Constraint 325 1087 4.2024 5.2530 10.5060 0.0321 Constraint 317 1087 3.4277 4.2846 8.5692 0.0321 Constraint 317 1031 5.2429 6.5536 13.1072 0.0321 Constraint 317 967 5.9819 7.4774 14.9548 0.0321 Constraint 317 958 4.6700 5.8375 11.6749 0.0321 Constraint 309 1095 3.7260 4.6574 9.3149 0.0321 Constraint 309 1087 3.9094 4.8868 9.7736 0.0321 Constraint 309 998 4.6865 5.8581 11.7163 0.0321 Constraint 309 951 5.3541 6.6927 13.3853 0.0321 Constraint 309 394 5.9737 7.4672 14.9343 0.0321 Constraint 297 1015 4.6082 5.7602 11.5205 0.0321 Constraint 297 931 6.2681 7.8351 15.6702 0.0321 Constraint 282 1451 4.9949 6.2436 12.4873 0.0321 Constraint 282 1402 4.8883 6.1104 12.2207 0.0321 Constraint 282 1386 4.3049 5.3811 10.7622 0.0321 Constraint 275 1402 5.2189 6.5237 13.0473 0.0321 Constraint 275 1395 4.3011 5.3764 10.7529 0.0321 Constraint 275 1386 5.8005 7.2506 14.5011 0.0321 Constraint 266 1395 4.9580 6.1975 12.3949 0.0321 Constraint 266 1386 4.4325 5.5406 11.0812 0.0321 Constraint 257 1430 5.1643 6.4553 12.9107 0.0321 Constraint 257 1386 5.0893 6.3616 12.7233 0.0321 Constraint 177 257 3.4365 4.2956 8.5913 0.0321 Constraint 177 249 6.0756 7.5945 15.1890 0.0321 Constraint 141 1451 5.5445 6.9306 13.8612 0.0321 Constraint 455 579 6.0599 7.5748 15.1496 0.0321 Constraint 683 924 5.7712 7.2141 14.4281 0.0321 Constraint 431 532 4.6727 5.8409 11.6818 0.0320 Constraint 570 871 5.4052 6.7565 13.5130 0.0320 Constraint 163 924 5.4565 6.8207 13.6413 0.0319 Constraint 115 852 5.8793 7.3491 14.6982 0.0319 Constraint 115 841 3.5640 4.4550 8.9100 0.0319 Constraint 386 464 5.6590 7.0737 14.1474 0.0319 Constraint 100 275 5.1371 6.4213 12.8426 0.0318 Constraint 864 1174 5.5858 6.9822 13.9645 0.0318 Constraint 579 871 5.5488 6.9360 13.8721 0.0318 Constraint 1087 1256 5.5332 6.9165 13.8330 0.0317 Constraint 1288 1395 6.1984 7.7480 15.4960 0.0317 Constraint 884 1150 3.9053 4.8817 9.7634 0.0316 Constraint 1264 1386 4.5076 5.6345 11.2690 0.0316 Constraint 551 833 5.2858 6.6072 13.2144 0.0316 Constraint 417 762 3.9433 4.9291 9.8583 0.0315 Constraint 649 789 3.7186 4.6482 9.2964 0.0315 Constraint 618 708 5.4123 6.7654 13.5309 0.0314 Constraint 155 805 4.8225 6.0281 12.0563 0.0314 Constraint 1106 1208 5.2062 6.5078 13.0156 0.0314 Constraint 1174 1430 4.7958 5.9948 11.9896 0.0313 Constraint 716 892 4.1502 5.1878 10.3755 0.0313 Constraint 380 990 5.8301 7.2877 14.5753 0.0312 Constraint 62 1087 5.9967 7.4959 14.9918 0.0312 Constraint 472 551 4.9103 6.1379 12.2758 0.0309 Constraint 981 1256 5.0677 6.3346 12.6693 0.0308 Constraint 380 1024 5.5059 6.8824 13.7648 0.0307 Constraint 373 1039 4.9541 6.1927 12.3853 0.0307 Constraint 373 1031 5.1457 6.4322 12.8643 0.0307 Constraint 373 1024 3.7234 4.6543 9.3086 0.0307 Constraint 84 864 5.3053 6.6316 13.2632 0.0307 Constraint 907 1024 5.8955 7.3694 14.7389 0.0307 Constraint 1106 1256 5.3416 6.6770 13.3541 0.0307 Constraint 1225 1354 4.2467 5.3084 10.6169 0.0304 Constraint 249 394 3.9692 4.9615 9.9231 0.0304 Constraint 100 386 5.3587 6.6983 13.3967 0.0304 Constraint 973 1133 5.9720 7.4650 14.9301 0.0304 Constraint 990 1075 4.2674 5.3343 10.6685 0.0302 Constraint 864 1201 5.9737 7.4671 14.9343 0.0302 Constraint 852 1201 4.1082 5.1352 10.2704 0.0302 Constraint 852 990 4.6231 5.7788 11.5577 0.0302 Constraint 422 641 4.8119 6.0149 12.0299 0.0302 Constraint 402 669 4.9127 6.1409 12.2818 0.0302 Constraint 394 649 6.2337 7.7921 15.5842 0.0302 Constraint 394 641 4.0104 5.0130 10.0259 0.0302 Constraint 380 1347 6.2460 7.8076 15.6151 0.0302 Constraint 380 674 6.0935 7.6169 15.2339 0.0302 Constraint 343 1386 5.1510 6.4388 12.8776 0.0302 Constraint 343 1347 5.3482 6.6852 13.3704 0.0302 Constraint 343 1339 3.8580 4.8225 9.6451 0.0302 Constraint 343 481 4.9232 6.1540 12.3079 0.0302 Constraint 317 1354 5.8979 7.3724 14.7448 0.0302 Constraint 282 1459 5.1822 6.4777 12.9555 0.0302 Constraint 214 864 5.8477 7.3096 14.6192 0.0302 Constraint 214 781 5.8099 7.2624 14.5248 0.0302 Constraint 185 781 4.9997 6.2497 12.4993 0.0302 Constraint 177 907 6.1912 7.7389 15.4779 0.0302 Constraint 177 297 3.6282 4.5353 9.0705 0.0302 Constraint 155 924 3.9711 4.9639 9.9278 0.0302 Constraint 155 915 4.3414 5.4267 10.8535 0.0302 Constraint 155 907 5.3245 6.6556 13.3112 0.0302 Constraint 155 900 6.1105 7.6382 15.2764 0.0302 Constraint 148 1106 6.1266 7.6583 15.3166 0.0302 Constraint 148 924 5.7532 7.1915 14.3830 0.0302 Constraint 148 907 4.2069 5.2586 10.5172 0.0302 Constraint 148 900 6.0721 7.5902 15.1803 0.0302 Constraint 141 990 4.7060 5.8825 11.7650 0.0302 Constraint 141 967 6.1166 7.6458 15.2915 0.0302 Constraint 141 958 4.8656 6.0820 12.1640 0.0302 Constraint 141 931 5.0299 6.2874 12.5747 0.0302 Constraint 141 907 3.2773 4.0966 8.1933 0.0302 Constraint 141 871 3.7593 4.6991 9.3981 0.0302 Constraint 141 864 5.8395 7.2994 14.5988 0.0302 Constraint 141 852 6.3202 7.9003 15.8005 0.0302 Constraint 132 781 4.4514 5.5642 11.1284 0.0302 Constraint 132 214 5.0313 6.2891 12.5783 0.0302 Constraint 124 1201 5.8138 7.2672 14.5345 0.0302 Constraint 124 1015 4.4295 5.5369 11.0737 0.0302 Constraint 124 990 5.0708 6.3385 12.6771 0.0302 Constraint 124 981 5.4932 6.8665 13.7330 0.0302 Constraint 124 822 3.2514 4.0643 8.1286 0.0302 Constraint 124 794 4.4442 5.5552 11.1104 0.0302 Constraint 124 789 5.7363 7.1704 14.3407 0.0302 Constraint 124 781 5.9207 7.4009 14.8018 0.0302 Constraint 115 864 4.0715 5.0894 10.1788 0.0302 Constraint 115 833 5.8083 7.2604 14.5208 0.0302 Constraint 115 789 5.5094 6.8868 13.7736 0.0302 Constraint 115 214 5.1002 6.3752 12.7504 0.0302 Constraint 62 249 5.8613 7.3267 14.6534 0.0302 Constraint 499 700 5.2941 6.6176 13.2352 0.0301 Constraint 789 990 5.2694 6.5867 13.1734 0.0301 Constraint 499 951 5.3929 6.7412 13.4823 0.0300 Constraint 602 762 5.4255 6.7818 13.5636 0.0299 Constraint 1144 1244 4.9713 6.2141 12.4282 0.0299 Constraint 41 981 5.8592 7.3240 14.6480 0.0299 Constraint 422 499 5.2688 6.5860 13.1720 0.0298 Constraint 499 871 6.1402 7.6753 15.3505 0.0298 Constraint 417 660 4.6084 5.7605 11.5209 0.0298 Constraint 944 1024 3.4327 4.2909 8.5817 0.0297 Constraint 417 998 4.9053 6.1316 12.2632 0.0297 Constraint 402 1124 6.0629 7.5787 15.1573 0.0297 Constraint 62 373 5.1476 6.4345 12.8691 0.0297 Constraint 1039 1256 5.4493 6.8116 13.6233 0.0295 Constraint 1039 1244 4.4708 5.5886 11.1771 0.0295 Constraint 1039 1213 5.5918 6.9897 13.9794 0.0295 Constraint 1024 1213 5.4520 6.8150 13.6300 0.0295 Constraint 386 924 4.8537 6.0672 12.1344 0.0295 Constraint 386 915 6.2673 7.8342 15.6684 0.0295 Constraint 177 1024 6.2489 7.8111 15.6222 0.0295 Constraint 69 1144 4.5280 5.6599 11.3199 0.0295 Constraint 69 1031 5.9550 7.4438 14.8875 0.0295 Constraint 69 1024 4.5259 5.6574 11.3148 0.0295 Constraint 62 1051 4.9524 6.1905 12.3811 0.0295 Constraint 62 1031 3.5462 4.4328 8.8656 0.0295 Constraint 62 1024 5.7525 7.1907 14.3814 0.0295 Constraint 54 1256 5.9581 7.4476 14.8952 0.0295 Constraint 54 1213 5.9248 7.4061 14.8121 0.0295 Constraint 54 1051 6.0206 7.5257 15.0515 0.0295 Constraint 237 394 5.3760 6.7200 13.4399 0.0295 Constraint 1244 1459 5.6670 7.0837 14.1675 0.0294 Constraint 1244 1451 5.8569 7.3211 14.6422 0.0294 Constraint 708 833 5.2820 6.6025 13.2051 0.0294 Constraint 510 789 5.2391 6.5488 13.0976 0.0294 Constraint 596 1213 5.4833 6.8541 13.7081 0.0294 Constraint 822 900 5.6631 7.0789 14.1577 0.0292 Constraint 794 900 3.7893 4.7366 9.4733 0.0292 Constraint 789 900 4.4567 5.5709 11.1418 0.0292 Constraint 762 915 4.3502 5.4378 10.8756 0.0292 Constraint 762 907 5.8002 7.2502 14.5005 0.0292 Constraint 762 900 4.5304 5.6631 11.3261 0.0292 Constraint 570 915 4.1209 5.1512 10.3024 0.0292 Constraint 532 907 5.9674 7.4593 14.9186 0.0292 Constraint 522 907 4.3713 5.4641 10.9283 0.0292 Constraint 602 884 5.2388 6.5486 13.0971 0.0291 Constraint 362 551 4.2802 5.3502 10.7005 0.0291 Constraint 351 551 5.8861 7.3576 14.7152 0.0291 Constraint 343 544 5.3453 6.6816 13.3631 0.0291 Constraint 618 805 5.1763 6.4704 12.9408 0.0289 Constraint 309 455 4.7272 5.9090 11.8180 0.0289 Constraint 373 871 4.6571 5.8214 11.6429 0.0289 Constraint 373 852 5.1184 6.3981 12.7961 0.0289 Constraint 532 794 5.4830 6.8537 13.7075 0.0288 Constraint 532 814 5.4400 6.8001 13.6001 0.0287 Constraint 222 532 4.4736 5.5920 11.1841 0.0287 Constraint 522 708 5.7533 7.1916 14.3832 0.0287 Constraint 892 1075 5.2258 6.5323 13.0646 0.0287 Constraint 1281 1381 3.7469 4.6837 9.3673 0.0287 Constraint 610 789 4.3826 5.4783 10.9565 0.0287 Constraint 431 1031 5.5231 6.9039 13.8079 0.0287 Constraint 205 362 6.3418 7.9273 15.8545 0.0287 Constraint 141 343 3.9321 4.9151 9.8302 0.0287 Constraint 1007 1095 5.2463 6.5579 13.1157 0.0286 Constraint 716 833 5.3290 6.6613 13.3225 0.0285 Constraint 510 781 5.6539 7.0674 14.1347 0.0285 Constraint 892 1087 4.2008 5.2509 10.5019 0.0285 Constraint 742 852 5.7908 7.2384 14.4769 0.0283 Constraint 373 464 5.4370 6.7962 13.5924 0.0283 Constraint 852 1225 6.3537 7.9421 15.8842 0.0282 Constraint 46 822 6.3670 7.9587 15.9174 0.0282 Constraint 168 805 6.3451 7.9313 15.8627 0.0282 Constraint 422 708 5.1565 6.4457 12.8913 0.0282 Constraint 100 291 5.1906 6.4883 12.9765 0.0281 Constraint 1124 1264 4.0718 5.0897 10.1794 0.0281 Constraint 864 1051 4.9374 6.1717 12.3435 0.0280 Constraint 596 884 4.7558 5.9447 11.8895 0.0280 Constraint 163 481 4.8462 6.0578 12.1155 0.0279 Constraint 62 674 4.9128 6.1410 12.2821 0.0279 Constraint 585 708 5.7507 7.1884 14.3767 0.0279 Constraint 124 275 6.3435 7.9294 15.8588 0.0278 Constraint 115 185 4.6682 5.8352 11.6704 0.0278 Constraint 222 562 5.6024 7.0030 14.0059 0.0276 Constraint 177 515 3.8597 4.8247 9.6493 0.0276 Constraint 155 515 3.3173 4.1466 8.2932 0.0276 Constraint 155 510 6.3439 7.9299 15.8597 0.0276 Constraint 141 515 5.6954 7.1192 14.2385 0.0276 Constraint 141 488 5.1382 6.4228 12.8456 0.0276 Constraint 141 455 5.0362 6.2953 12.5906 0.0276 Constraint 362 499 5.6713 7.0891 14.1781 0.0276 Constraint 335 522 4.2123 5.2653 10.5307 0.0275 Constraint 54 124 5.8291 7.2864 14.5728 0.0274 Constraint 177 481 4.5890 5.7363 11.4725 0.0274 Constraint 544 814 5.1713 6.4641 12.9281 0.0274 Constraint 864 1186 4.1122 5.1403 10.2806 0.0274 Constraint 716 907 4.9077 6.1346 12.2692 0.0274 Constraint 708 884 5.6879 7.1099 14.2197 0.0274 Constraint 446 674 4.8193 6.0242 12.0483 0.0273 Constraint 585 871 5.2037 6.5047 13.0094 0.0272 Constraint 691 864 5.7155 7.1444 14.2888 0.0272 Constraint 100 177 4.1264 5.1580 10.3161 0.0272 Constraint 92 275 5.8109 7.2637 14.5274 0.0272 Constraint 168 532 5.7753 7.2191 14.4381 0.0272 Constraint 394 1051 5.9087 7.3859 14.7718 0.0271 Constraint 1106 1225 5.4481 6.8101 13.6202 0.0270 Constraint 951 1256 4.8809 6.1011 12.2022 0.0269 Constraint 551 841 4.8894 6.1117 12.2235 0.0269 Constraint 343 852 4.3645 5.4556 10.9113 0.0268 Constraint 931 998 4.6010 5.7512 11.5025 0.0268 Constraint 624 931 5.1394 6.4242 12.8484 0.0267 Constraint 439 973 4.9461 6.1826 12.3652 0.0267 Constraint 439 951 4.9953 6.2441 12.4883 0.0267 Constraint 852 1007 4.7737 5.9671 11.9342 0.0267 Constraint 981 1174 5.9866 7.4832 14.9665 0.0266 Constraint 69 249 5.6722 7.0902 14.1804 0.0266 Constraint 981 1144 4.9176 6.1471 12.2941 0.0264 Constraint 814 1051 5.2860 6.6075 13.2149 0.0264 Constraint 1133 1288 6.0697 7.5872 15.1743 0.0263 Constraint 499 632 5.7631 7.2039 14.4078 0.0263 Constraint 488 632 4.4126 5.5158 11.0316 0.0263 Constraint 472 951 5.0753 6.3441 12.6883 0.0263 Constraint 282 373 5.0952 6.3691 12.7381 0.0262 Constraint 214 373 5.3936 6.7420 13.4840 0.0262 Constraint 852 1186 5.6686 7.0857 14.1714 0.0262 Constraint 649 951 5.6490 7.0613 14.1226 0.0262 Constraint 773 958 5.7212 7.1515 14.3031 0.0260 Constraint 54 973 6.1810 7.7262 15.4525 0.0259 Constraint 884 1066 6.0131 7.5163 15.0326 0.0259 Constraint 641 794 5.5037 6.8796 13.7592 0.0259 Constraint 1295 1395 5.6895 7.1119 14.2239 0.0258 Constraint 257 362 5.2987 6.6233 13.2467 0.0258 Constraint 291 431 4.4764 5.5955 11.1909 0.0258 Constraint 394 632 4.6492 5.8115 11.6229 0.0258 Constraint 585 1144 5.2735 6.5919 13.1837 0.0257 Constraint 939 1264 5.7135 7.1419 14.2838 0.0256 Constraint 789 998 5.4745 6.8431 13.6862 0.0256 Constraint 723 805 4.7624 5.9530 11.9060 0.0254 Constraint 297 446 6.2920 7.8650 15.7299 0.0254 Constraint 155 394 6.2548 7.8185 15.6370 0.0254 Constraint 132 394 5.9193 7.3991 14.7981 0.0254 Constraint 805 1075 4.9572 6.1965 12.3930 0.0253 Constraint 499 716 6.1561 7.6951 15.3902 0.0252 Constraint 214 551 4.1859 5.2324 10.4648 0.0252 Constraint 431 814 5.2563 6.5704 13.1408 0.0251 Constraint 515 716 5.2950 6.6187 13.2374 0.0251 Constraint 762 864 6.1385 7.6731 15.3462 0.0251 Constraint 422 522 4.5827 5.7283 11.4566 0.0250 Constraint 394 884 4.2833 5.3542 10.7084 0.0250 Constraint 373 579 5.7964 7.2455 14.4909 0.0250 Constraint 660 892 5.7108 7.1385 14.2769 0.0250 Constraint 325 585 5.2093 6.5116 13.0233 0.0249 Constraint 544 762 5.4753 6.8441 13.6883 0.0248 Constraint 579 973 4.6464 5.8080 11.6160 0.0247 Constraint 700 781 5.1836 6.4795 12.9589 0.0247 Constraint 275 544 5.5586 6.9482 13.8965 0.0247 Constraint 266 544 4.7020 5.8775 11.7551 0.0247 Constraint 257 544 4.2190 5.2737 10.5474 0.0247 Constraint 362 1087 4.6648 5.8310 11.6619 0.0247 Constraint 155 700 5.5045 6.8806 13.7613 0.0247 Constraint 579 1256 4.8019 6.0024 12.0048 0.0247 Constraint 439 532 5.5354 6.9193 13.8385 0.0246 Constraint 871 1015 4.9824 6.2280 12.4560 0.0244 Constraint 624 762 6.0135 7.5168 15.0336 0.0244 Constraint 669 822 6.2911 7.8639 15.7278 0.0244 Constraint 249 325 4.7126 5.8908 11.7816 0.0242 Constraint 431 716 5.6750 7.0938 14.1875 0.0242 Constraint 257 373 4.5000 5.6250 11.2499 0.0242 Constraint 871 1007 4.9059 6.1324 12.2648 0.0242 Constraint 990 1144 5.2777 6.5971 13.1942 0.0241 Constraint 115 257 4.4884 5.6105 11.2210 0.0241 Constraint 660 789 5.5410 6.9262 13.8524 0.0241 Constraint 343 515 4.8435 6.0543 12.1087 0.0241 Constraint 998 1144 5.4977 6.8721 13.7442 0.0240 Constraint 362 944 6.2069 7.7586 15.5171 0.0240 Constraint 362 924 4.9437 6.1796 12.3591 0.0240 Constraint 431 610 5.4374 6.7968 13.5935 0.0240 Constraint 1168 1244 5.0277 6.2847 12.5694 0.0240 Constraint 155 343 4.9695 6.2118 12.4237 0.0239 Constraint 544 805 4.3814 5.4768 10.9535 0.0239 Constraint 237 522 5.6178 7.0222 14.0444 0.0239 Constraint 237 515 5.3796 6.7245 13.4490 0.0239 Constraint 585 1095 4.6323 5.7904 11.5807 0.0238 Constraint 257 562 5.5924 6.9905 13.9809 0.0237 Constraint 141 570 5.1556 6.4445 12.8890 0.0237 Constraint 610 762 4.6708 5.8385 11.6771 0.0237 Constraint 325 402 5.1056 6.3820 12.7641 0.0236 Constraint 196 532 4.5126 5.6407 11.2814 0.0236 Constraint 155 852 5.9333 7.4166 14.8332 0.0236 Constraint 155 585 5.5547 6.9434 13.8869 0.0236 Constraint 69 674 5.8367 7.2958 14.5917 0.0236 Constraint 62 708 5.9333 7.4167 14.8334 0.0236 Constraint 62 683 6.2545 7.8182 15.6364 0.0236 Constraint 54 325 6.1241 7.6552 15.3103 0.0236 Constraint 46 805 6.2539 7.8174 15.6347 0.0236 Constraint 41 185 6.3577 7.9472 15.8944 0.0236 Constraint 624 915 4.8074 6.0093 12.0186 0.0236 Constraint 814 931 5.2106 6.5132 13.0265 0.0235 Constraint 62 237 4.3684 5.4606 10.9211 0.0235 Constraint 924 1087 5.2832 6.6040 13.2081 0.0234 Constraint 266 362 6.1025 7.6281 15.2562 0.0234 Constraint 249 386 5.1307 6.4134 12.8268 0.0234 Constraint 532 610 5.6835 7.1044 14.2088 0.0234 Constraint 1031 1225 3.7813 4.7266 9.4532 0.0233 Constraint 1031 1201 4.7884 5.9855 11.9711 0.0233 Constraint 1015 1201 4.6661 5.8326 11.6652 0.0233 Constraint 1007 1235 5.7364 7.1705 14.3410 0.0233 Constraint 1007 1225 5.9353 7.4191 14.8383 0.0233 Constraint 931 1264 2.9251 3.6564 7.3128 0.0233 Constraint 931 1235 5.6626 7.0783 14.1566 0.0233 Constraint 723 1095 5.5392 6.9240 13.8479 0.0233 Constraint 455 944 5.9089 7.3861 14.7723 0.0233 Constraint 431 944 6.2983 7.8729 15.7458 0.0233 Constraint 362 1075 4.0503 5.0629 10.1259 0.0233 Constraint 362 773 5.1757 6.4697 12.9393 0.0233 Constraint 351 1225 5.9829 7.4787 14.9573 0.0233 Constraint 351 1075 4.6265 5.7831 11.5662 0.0233 Constraint 335 1150 6.0743 7.5928 15.1857 0.0233 Constraint 229 864 4.8784 6.0980 12.1960 0.0233 Constraint 214 841 5.7682 7.2103 14.4206 0.0233 Constraint 205 864 5.4469 6.8087 13.6174 0.0233 Constraint 205 841 5.5445 6.9306 13.8612 0.0233 Constraint 446 532 6.2561 7.8202 15.6403 0.0232 Constraint 871 958 5.5834 6.9792 13.9585 0.0231 Constraint 674 789 5.9341 7.4176 14.8352 0.0231 Constraint 570 951 3.6866 4.6083 9.2166 0.0231 Constraint 551 951 6.3711 7.9638 15.9276 0.0231 Constraint 386 756 5.6433 7.0541 14.1083 0.0231 Constraint 386 742 3.8633 4.8291 9.6583 0.0231 Constraint 380 551 5.6235 7.0293 14.0586 0.0231 Constraint 373 742 6.3990 7.9988 15.9975 0.0231 Constraint 362 544 5.8577 7.3221 14.6442 0.0231 Constraint 343 522 4.7171 5.8963 11.7927 0.0231 Constraint 185 562 5.0957 6.3697 12.7394 0.0231 Constraint 773 973 4.6897 5.8621 11.7242 0.0230 Constraint 155 446 5.4156 6.7695 13.5391 0.0230 Constraint 141 446 4.2147 5.2683 10.5367 0.0230 Constraint 900 1133 5.9125 7.3906 14.7813 0.0230 Constraint 431 781 5.7507 7.1884 14.3768 0.0229 Constraint 291 464 4.6041 5.7551 11.5102 0.0228 Constraint 69 214 5.5110 6.8888 13.7775 0.0228 Constraint 551 794 4.4067 5.5084 11.0168 0.0227 Constraint 544 794 5.1860 6.4825 12.9651 0.0227 Constraint 1133 1347 5.4918 6.8647 13.7294 0.0227 Constraint 1124 1347 5.7359 7.1699 14.3397 0.0227 Constraint 1106 1339 5.0730 6.3413 12.6826 0.0227 Constraint 291 544 5.0144 6.2680 12.5360 0.0227 Constraint 439 742 4.7052 5.8815 11.7631 0.0227 Constraint 222 515 4.7088 5.8860 11.7720 0.0227 Constraint 1106 1264 5.2719 6.5899 13.1797 0.0226 Constraint 510 585 5.1530 6.4412 12.8825 0.0226 Constraint 871 1031 5.2357 6.5446 13.0892 0.0225 Constraint 1087 1201 3.8321 4.7902 9.5803 0.0225 Constraint 931 1159 5.6252 7.0315 14.0631 0.0225 Constraint 871 967 5.3983 6.7479 13.4959 0.0225 Constraint 275 551 4.1173 5.1466 10.2932 0.0224 Constraint 1133 1264 5.3355 6.6694 13.3388 0.0224 Constraint 884 1186 4.3505 5.4381 10.8763 0.0224 Constraint 884 1174 5.0851 6.3564 12.7127 0.0224 Constraint 624 892 4.8930 6.1162 12.2325 0.0223 Constraint 394 998 6.2930 7.8663 15.7325 0.0223 Constraint 115 343 3.8152 4.7690 9.5379 0.0223 Constraint 408 915 4.0699 5.0874 10.1749 0.0223 Constraint 708 998 5.7037 7.1296 14.2591 0.0223 Constraint 177 309 4.8981 6.1227 12.2453 0.0223 Constraint 185 455 5.9616 7.4520 14.9040 0.0222 Constraint 92 177 4.2624 5.3281 10.6561 0.0222 Constraint 92 168 3.4616 4.3270 8.6540 0.0222 Constraint 84 177 4.5956 5.7445 11.4891 0.0222 Constraint 62 335 5.4285 6.7857 13.5713 0.0222 Constraint 951 1288 4.3617 5.4522 10.9044 0.0221 Constraint 54 579 4.4407 5.5509 11.1017 0.0221 Constraint 1201 1402 4.4924 5.6155 11.2309 0.0221 Constraint 1075 1272 5.1972 6.4965 12.9930 0.0219 Constraint 931 1124 4.4380 5.5475 11.0950 0.0219 Constraint 924 1124 5.3933 6.7416 13.4832 0.0219 Constraint 915 1150 5.6825 7.1031 14.2062 0.0219 Constraint 907 1124 4.2509 5.3136 10.6272 0.0219 Constraint 515 632 4.0356 5.0445 10.0890 0.0219 Constraint 380 522 5.0049 6.2562 12.5123 0.0219 Constraint 257 762 6.3746 7.9683 15.9365 0.0219 Constraint 249 674 5.0388 6.2986 12.5971 0.0219 Constraint 249 641 4.5154 5.6442 11.2885 0.0219 Constraint 249 343 5.5778 6.9722 13.9444 0.0219 Constraint 944 1295 5.0070 6.2587 12.5174 0.0219 Constraint 446 544 5.7116 7.1395 14.2790 0.0219 Constraint 439 544 4.8071 6.0089 12.0178 0.0219 Constraint 773 864 5.3069 6.6336 13.2673 0.0218 Constraint 69 132 6.0565 7.5706 15.1411 0.0218 Constraint 343 618 5.9153 7.3942 14.7883 0.0217 Constraint 446 728 5.5513 6.9391 13.8782 0.0217 Constraint 282 981 5.9963 7.4953 14.9907 0.0217 Constraint 464 852 5.8959 7.3698 14.7397 0.0216 Constraint 1106 1347 4.3135 5.3919 10.7839 0.0216 Constraint 1095 1347 5.2888 6.6110 13.2221 0.0216 Constraint 488 579 5.2120 6.5149 13.0299 0.0216 Constraint 532 998 5.0969 6.3711 12.7422 0.0215 Constraint 431 822 4.4618 5.5772 11.1544 0.0215 Constraint 41 562 4.7258 5.9073 11.8146 0.0215 Constraint 515 700 4.6371 5.7964 11.5928 0.0214 Constraint 100 373 5.6102 7.0127 14.0254 0.0214 Constraint 54 1106 4.9472 6.1840 12.3680 0.0214 Constraint 100 1124 5.2515 6.5644 13.1289 0.0213 Constraint 100 1066 6.2910 7.8638 15.7276 0.0213 Constraint 100 864 4.7208 5.9010 11.8021 0.0213 Constraint 18 1476 5.9316 7.4145 14.8289 0.0213 Constraint 544 723 5.7732 7.2165 14.4331 0.0213 Constraint 716 924 5.8772 7.3465 14.6930 0.0213 Constraint 900 1015 5.2133 6.5166 13.0333 0.0213 Constraint 373 1075 4.6349 5.7937 11.5873 0.0213 Constraint 585 716 4.5360 5.6700 11.3401 0.0212 Constraint 100 214 5.8173 7.2716 14.5433 0.0212 Constraint 100 185 5.3644 6.7056 13.4111 0.0212 Constraint 84 275 4.3740 5.4675 10.9350 0.0212 Constraint 84 249 4.7952 5.9940 11.9879 0.0212 Constraint 579 674 5.9945 7.4931 14.9862 0.0212 Constraint 417 641 5.8418 7.3022 14.6045 0.0212 Constraint 602 723 5.2837 6.6046 13.2092 0.0211 Constraint 100 249 5.1230 6.4038 12.8076 0.0211 Constraint 100 237 6.0639 7.5799 15.1599 0.0211 Constraint 124 343 5.2535 6.5669 13.1338 0.0211 Constraint 1144 1235 5.9106 7.3883 14.7766 0.0210 Constraint 1007 1339 5.6503 7.0629 14.1257 0.0210 Constraint 1007 1306 5.6845 7.1056 14.2112 0.0210 Constraint 981 1362 4.3992 5.4990 10.9980 0.0210 Constraint 981 1306 5.2398 6.5497 13.0994 0.0210 Constraint 973 1306 5.5996 6.9995 13.9990 0.0210 Constraint 973 1288 5.5173 6.8966 13.7932 0.0210 Constraint 951 1306 6.2065 7.7582 15.5163 0.0210 Constraint 944 1288 4.2992 5.3740 10.7480 0.0210 Constraint 944 1244 6.0944 7.6180 15.2359 0.0210 Constraint 924 1288 5.1081 6.3851 12.7703 0.0210 Constraint 998 1106 5.8298 7.2873 14.5745 0.0209 Constraint 728 939 5.3308 6.6636 13.3271 0.0208 Constraint 723 931 5.5783 6.9729 13.9458 0.0208 Constraint 1144 1329 5.0801 6.3501 12.7001 0.0208 Constraint 1295 1402 6.3145 7.8931 15.7863 0.0207 Constraint 1264 1430 6.0758 7.5948 15.1895 0.0207 Constraint 1264 1421 5.2303 6.5379 13.0757 0.0207 Constraint 1244 1430 4.1713 5.2141 10.4282 0.0207 Constraint 1235 1467 6.3018 7.8772 15.7545 0.0207 Constraint 1235 1354 2.9872 3.7340 7.4679 0.0207 Constraint 1235 1329 4.6581 5.8226 11.6452 0.0207 Constraint 1225 1467 3.1268 3.9085 7.8170 0.0207 Constraint 1225 1386 4.6697 5.8371 11.6742 0.0207 Constraint 1213 1467 5.6288 7.0360 14.0720 0.0207 Constraint 1213 1459 5.7175 7.1469 14.2938 0.0207 Constraint 1213 1451 5.8772 7.3465 14.6929 0.0207 Constraint 1208 1467 6.1443 7.6804 15.3608 0.0207 Constraint 1208 1459 6.2272 7.7840 15.5681 0.0207 Constraint 1208 1451 4.1182 5.1478 10.2956 0.0207 Constraint 1186 1451 5.4021 6.7526 13.5052 0.0207 Constraint 1174 1451 3.7296 4.6620 9.3239 0.0207 Constraint 1174 1421 3.9867 4.9833 9.9666 0.0207 Constraint 1168 1451 5.2483 6.5604 13.1208 0.0207 Constraint 1168 1421 4.5144 5.6430 11.2859 0.0207 Constraint 1159 1421 5.8212 7.2765 14.5531 0.0207 Constraint 1150 1264 5.5697 6.9621 13.9243 0.0207 Constraint 1144 1421 5.7112 7.1390 14.2780 0.0207 Constraint 1144 1381 5.4764 6.8455 13.6911 0.0207 Constraint 1133 1430 6.2365 7.7957 15.5914 0.0207 Constraint 1133 1395 3.3579 4.1973 8.3946 0.0207 Constraint 884 1318 6.0207 7.5258 15.0516 0.0207 Constraint 789 1075 5.0816 6.3520 12.7041 0.0207 Constraint 522 773 5.2872 6.6090 13.2179 0.0207 Constraint 515 773 5.9005 7.3757 14.7513 0.0207 Constraint 488 669 6.0675 7.5844 15.1689 0.0207 Constraint 402 683 5.8756 7.3445 14.6890 0.0207 Constraint 402 660 4.1429 5.1787 10.3573 0.0207 Constraint 282 402 6.3754 7.9693 15.9385 0.0207 Constraint 275 402 6.0520 7.5650 15.1299 0.0207 Constraint 275 394 4.8231 6.0288 12.0577 0.0207 Constraint 266 402 2.9743 3.7179 7.4358 0.0207 Constraint 266 394 5.9486 7.4357 14.8714 0.0207 Constraint 257 402 4.2597 5.3247 10.6493 0.0207 Constraint 249 716 6.0840 7.6050 15.2101 0.0207 Constraint 249 708 5.0159 6.2699 12.5399 0.0207 Constraint 249 402 4.6963 5.8704 11.7409 0.0207 Constraint 229 708 5.0249 6.2811 12.5621 0.0207 Constraint 214 394 3.4769 4.3462 8.6923 0.0207 Constraint 196 700 6.2533 7.8166 15.6332 0.0207 Constraint 325 691 5.5773 6.9717 13.9433 0.0206 Constraint 325 683 3.6132 4.5165 9.0331 0.0206 Constraint 649 892 4.9312 6.1640 12.3280 0.0206 Constraint 814 998 4.4360 5.5450 11.0900 0.0205 Constraint 900 1087 5.8767 7.3459 14.6919 0.0205 Constraint 544 822 5.1116 6.3895 12.7790 0.0204 Constraint 716 822 5.2643 6.5803 13.1606 0.0204 Constraint 669 762 5.5207 6.9008 13.8016 0.0204 Constraint 944 1075 5.5122 6.8902 13.7805 0.0203 Constraint 351 624 4.1934 5.2417 10.4835 0.0202 Constraint 669 756 5.0111 6.2639 12.5277 0.0202 Constraint 100 624 6.0558 7.5697 15.1395 0.0202 Constraint 794 967 5.5100 6.8876 13.7751 0.0202 Constraint 579 884 5.4619 6.8273 13.6547 0.0202 Constraint 1015 1168 6.1258 7.6573 15.3145 0.0201 Constraint 781 990 4.5381 5.6726 11.3452 0.0200 Constraint 325 439 4.6256 5.7819 11.5639 0.0200 Constraint 351 951 5.8919 7.3648 14.7297 0.0199 Constraint 177 335 5.5032 6.8789 13.7579 0.0199 Constraint 408 585 4.8871 6.1088 12.2177 0.0198 Constraint 275 464 4.9258 6.1573 12.3145 0.0198 Constraint 439 691 6.1595 7.6994 15.3988 0.0198 Constraint 431 669 3.9200 4.9000 9.8000 0.0198 Constraint 499 1087 5.9818 7.4773 14.9545 0.0197 Constraint 54 237 5.4807 6.8509 13.7018 0.0197 Constraint 1318 1421 4.6824 5.8529 11.7059 0.0197 Constraint 762 981 6.0201 7.5251 15.0502 0.0197 Constraint 439 773 4.8565 6.0706 12.1411 0.0197 Constraint 394 924 4.8147 6.0183 12.0367 0.0197 Constraint 394 871 4.2805 5.3506 10.7012 0.0197 Constraint 386 990 4.6688 5.8360 11.6719 0.0197 Constraint 386 981 4.4974 5.6217 11.2434 0.0197 Constraint 380 981 5.4432 6.8040 13.6080 0.0197 Constraint 380 951 6.1015 7.6269 15.2537 0.0197 Constraint 380 924 5.0074 6.2592 12.5184 0.0197 Constraint 362 951 5.7597 7.1997 14.3993 0.0197 Constraint 362 864 4.2587 5.3234 10.6468 0.0197 Constraint 177 1087 6.2479 7.8098 15.6197 0.0197 Constraint 92 990 4.0150 5.0187 10.0375 0.0197 Constraint 92 981 6.2557 7.8196 15.6391 0.0197 Constraint 92 380 4.3198 5.3997 10.7994 0.0197 Constraint 92 373 5.2857 6.6071 13.2141 0.0197 Constraint 84 380 5.4158 6.7698 13.5396 0.0197 Constraint 84 373 5.1576 6.4469 12.8939 0.0197 Constraint 69 1095 5.9910 7.4887 14.9774 0.0197 Constraint 69 1087 4.5678 5.7097 11.4195 0.0197 Constraint 62 1095 3.5624 4.4530 8.9060 0.0197 Constraint 62 362 5.4701 6.8376 13.6753 0.0197 Constraint 54 1095 5.5175 6.8968 13.7936 0.0197 Constraint 46 1106 6.2828 7.8535 15.7071 0.0197 Constraint 431 510 5.3796 6.7245 13.4490 0.0196 Constraint 325 472 4.4089 5.5112 11.0223 0.0195 Constraint 967 1039 6.0771 7.5963 15.1927 0.0195 Constraint 958 1039 5.1613 6.4516 12.9033 0.0195 Constraint 266 373 3.8076 4.7596 9.5191 0.0195 Constraint 249 380 5.0067 6.2583 12.5166 0.0195 Constraint 237 488 3.7485 4.6857 9.3713 0.0195 Constraint 237 481 4.2402 5.3002 10.6005 0.0195 Constraint 237 455 4.0277 5.0347 10.0693 0.0195 Constraint 214 362 3.6281 4.5352 9.0703 0.0195 Constraint 205 522 5.5747 6.9683 13.9367 0.0195 Constraint 100 579 4.6448 5.8059 11.6119 0.0195 Constraint 100 282 5.6765 7.0957 14.1913 0.0195 Constraint 351 510 4.4589 5.5736 11.1471 0.0195 Constraint 439 610 5.1439 6.4299 12.8599 0.0194 Constraint 510 805 5.7434 7.1793 14.3586 0.0194 Constraint 257 570 5.3610 6.7012 13.4024 0.0194 Constraint 408 892 5.6281 7.0352 14.0703 0.0193 Constraint 990 1159 5.8776 7.3470 14.6939 0.0193 Constraint 708 1150 4.8961 6.1201 12.2401 0.0192 Constraint 455 544 6.3876 7.9844 15.9689 0.0192 Constraint 998 1150 4.0972 5.1215 10.2430 0.0191 Constraint 551 649 4.3300 5.4125 10.8250 0.0191 Constraint 422 973 6.2562 7.8203 15.6406 0.0191 Constraint 214 852 5.3892 6.7365 13.4729 0.0191 Constraint 362 728 6.2400 7.8000 15.6001 0.0191 Constraint 335 924 5.2222 6.5278 13.0555 0.0191 Constraint 499 618 5.5734 6.9668 13.9335 0.0190 Constraint 394 570 4.9542 6.1927 12.3854 0.0190 Constraint 596 773 4.6070 5.7587 11.5175 0.0189 Constraint 380 1007 5.3237 6.6546 13.3092 0.0189 Constraint 585 973 5.5589 6.9487 13.8973 0.0189 Constraint 431 624 5.0765 6.3456 12.6912 0.0189 Constraint 163 455 4.9451 6.1813 12.3626 0.0189 Constraint 1015 1144 5.6450 7.0562 14.1124 0.0188 Constraint 1007 1087 4.0221 5.0276 10.0552 0.0188 Constraint 716 1159 5.7891 7.2364 14.4728 0.0188 Constraint 610 742 5.4410 6.8013 13.6025 0.0188 Constraint 522 700 4.5417 5.6772 11.3543 0.0188 Constraint 515 1075 5.4150 6.7687 13.5375 0.0188 Constraint 499 1075 3.9325 4.9157 9.8313 0.0188 Constraint 488 1075 2.1011 2.6264 5.2528 0.0188 Constraint 488 1066 5.1098 6.3873 12.7745 0.0188 Constraint 488 1051 5.5399 6.9248 13.8497 0.0188 Constraint 481 1075 6.1617 7.7021 15.4041 0.0188 Constraint 472 602 5.9044 7.3805 14.7610 0.0188 Constraint 464 1075 5.1618 6.4522 12.9044 0.0188 Constraint 464 1051 3.1671 3.9589 7.9178 0.0188 Constraint 464 1031 4.9666 6.2083 12.4166 0.0188 Constraint 455 1051 3.3053 4.1317 8.2634 0.0188 Constraint 439 1051 5.8261 7.2826 14.5652 0.0188 Constraint 362 455 4.7724 5.9655 11.9310 0.0188 Constraint 585 700 5.4108 6.7635 13.5271 0.0188 Constraint 464 700 3.6322 4.5402 9.0804 0.0188 Constraint 455 700 6.0268 7.5335 15.0669 0.0188 Constraint 431 700 3.6590 4.5737 9.1475 0.0188 Constraint 84 596 5.7561 7.1951 14.3901 0.0188 Constraint 431 990 6.3792 7.9740 15.9479 0.0188 Constraint 967 1075 5.2240 6.5300 13.0600 0.0187 Constraint 1031 1373 6.0978 7.6223 15.2446 0.0187 Constraint 544 990 4.3016 5.3770 10.7539 0.0187 Constraint 931 1168 5.5274 6.9092 13.8184 0.0187 Constraint 716 794 5.9881 7.4851 14.9702 0.0186 Constraint 794 1007 6.1787 7.7233 15.4467 0.0185 Constraint 762 958 5.3918 6.7397 13.4795 0.0185 Constraint 756 967 5.6328 7.0410 14.0820 0.0185 Constraint 756 944 4.3504 5.4379 10.8759 0.0185 Constraint 756 939 4.9141 6.1426 12.2852 0.0185 Constraint 756 931 6.1186 7.6483 15.2966 0.0185 Constraint 742 973 5.2590 6.5737 13.1474 0.0185 Constraint 742 967 4.0988 5.1235 10.2469 0.0185 Constraint 742 931 6.1222 7.6528 15.3056 0.0185 Constraint 41 610 6.2259 7.7823 15.5646 0.0185 Constraint 998 1159 3.8583 4.8229 9.6458 0.0185 Constraint 871 1386 6.2844 7.8554 15.7109 0.0185 Constraint 408 618 6.1347 7.6684 15.3368 0.0184 Constraint 297 439 6.0701 7.5876 15.1752 0.0184 Constraint 291 439 4.5841 5.7301 11.4602 0.0184 Constraint 214 562 4.8601 6.0751 12.1502 0.0184 Constraint 155 472 6.2811 7.8514 15.7027 0.0184 Constraint 618 742 5.5776 6.9720 13.9439 0.0183 Constraint 939 1031 5.2067 6.5084 13.0167 0.0183 Constraint 54 266 5.2758 6.5947 13.1894 0.0182 Constraint 841 1174 6.2307 7.7884 15.5768 0.0181 Constraint 756 924 4.4839 5.6049 11.2098 0.0181 Constraint 728 915 6.0708 7.5885 15.1769 0.0181 Constraint 723 907 6.0758 7.5948 15.1896 0.0181 Constraint 351 789 4.9616 6.2020 12.4040 0.0181 Constraint 343 794 5.9220 7.4025 14.8050 0.0181 Constraint 343 789 4.3466 5.4332 10.8664 0.0181 Constraint 335 794 3.8020 4.7525 9.5051 0.0181 Constraint 335 789 5.8733 7.3417 14.6834 0.0181 Constraint 317 794 4.9964 6.2455 12.4911 0.0181 Constraint 196 275 6.1341 7.6677 15.3353 0.0181 Constraint 196 266 5.8855 7.3569 14.7137 0.0181 Constraint 141 351 4.4503 5.5629 11.1258 0.0181 Constraint 132 317 5.7844 7.2304 14.4609 0.0181 Constraint 132 297 5.1128 6.3909 12.7819 0.0181 Constraint 124 257 5.7726 7.2157 14.4314 0.0181 Constraint 124 249 4.1294 5.1617 10.3234 0.0181 Constraint 100 343 3.8179 4.7724 9.5449 0.0181 Constraint 84 402 2.8949 3.6186 7.2372 0.0181 Constraint 562 973 5.7377 7.1721 14.3442 0.0181 Constraint 472 841 4.8272 6.0340 12.0680 0.0181 Constraint 317 884 4.3679 5.4599 10.9198 0.0181 Constraint 317 871 6.2273 7.7842 15.5683 0.0181 Constraint 297 944 6.2001 7.7501 15.5003 0.0181 Constraint 297 924 5.2050 6.5062 13.0124 0.0181 Constraint 297 852 5.7097 7.1371 14.2742 0.0181 Constraint 282 973 4.6234 5.7793 11.5585 0.0181 Constraint 282 951 5.5977 6.9971 13.9942 0.0181 Constraint 196 544 5.5514 6.9393 13.8786 0.0181 Constraint 177 551 6.3132 7.8915 15.7830 0.0181 Constraint 177 544 5.1076 6.3845 12.7690 0.0181 Constraint 177 532 6.0259 7.5323 15.0646 0.0181 Constraint 168 544 6.2341 7.7926 15.5853 0.0181 Constraint 155 551 5.7066 7.1332 14.2664 0.0181 Constraint 155 532 4.9000 6.1250 12.2500 0.0181 Constraint 132 455 5.7619 7.2024 14.4048 0.0181 Constraint 62 551 6.1410 7.6763 15.3526 0.0181 Constraint 54 924 5.6319 7.0399 14.0798 0.0181 Constraint 41 951 4.7073 5.8841 11.7683 0.0181 Constraint 362 708 5.0025 6.2532 12.5063 0.0180 Constraint 756 981 5.0372 6.2965 12.5929 0.0180 Constraint 408 728 5.4755 6.8444 13.6888 0.0180 Constraint 805 973 5.7420 7.1775 14.3550 0.0180 Constraint 84 422 6.2586 7.8233 15.6465 0.0180 Constraint 499 1007 4.5408 5.6760 11.3519 0.0179 Constraint 408 924 5.0605 6.3257 12.6513 0.0179 Constraint 168 481 6.1697 7.7122 15.4243 0.0179 Constraint 168 249 5.2156 6.5195 13.0389 0.0179 Constraint 499 683 5.9230 7.4038 14.8075 0.0178 Constraint 1225 1318 4.7776 5.9720 11.9441 0.0178 Constraint 464 649 5.0894 6.3617 12.7235 0.0178 Constraint 551 814 4.9441 6.1801 12.3601 0.0177 Constraint 915 998 4.4748 5.5935 11.1870 0.0176 Constraint 214 317 5.6962 7.1203 14.2406 0.0176 Constraint 602 1095 4.8805 6.1007 12.2014 0.0175 Constraint 532 1133 5.2204 6.5255 13.0510 0.0175 Constraint 455 669 5.2635 6.5794 13.1588 0.0175 Constraint 69 266 4.7971 5.9964 11.9927 0.0175 Constraint 373 570 4.1888 5.2360 10.4720 0.0175 Constraint 69 585 6.3294 7.9117 15.8234 0.0175 Constraint 62 579 5.5741 6.9676 13.9352 0.0175 Constraint 728 1174 5.9145 7.3931 14.7863 0.0175 Constraint 499 944 5.1022 6.3778 12.7556 0.0175 Constraint 402 973 5.7477 7.1847 14.3693 0.0175 Constraint 394 794 5.7640 7.2050 14.4101 0.0175 Constraint 386 814 5.0829 6.3536 12.7072 0.0175 Constraint 386 805 6.0173 7.5216 15.0432 0.0175 Constraint 362 781 5.6902 7.1127 14.2254 0.0175 Constraint 155 669 3.8697 4.8371 9.6743 0.0175 Constraint 155 641 5.1792 6.4739 12.9479 0.0175 Constraint 624 1087 4.7020 5.8775 11.7550 0.0175 Constraint 618 1087 5.4023 6.7528 13.5056 0.0175 Constraint 472 1007 5.2808 6.6011 13.2021 0.0175 Constraint 100 297 4.1790 5.2237 10.4474 0.0174 Constraint 1095 1192 4.9207 6.1509 12.3017 0.0174 Constraint 1075 1186 4.4227 5.5284 11.0568 0.0174 Constraint 708 841 4.5971 5.7463 11.4927 0.0173 Constraint 343 864 3.8724 4.8405 9.6811 0.0173 Constraint 237 649 5.0296 6.2870 12.5741 0.0172 Constraint 924 1213 4.7517 5.9396 11.8791 0.0170 Constraint 1106 1235 5.4320 6.7900 13.5801 0.0170 Constraint 1124 1272 6.3049 7.8812 15.7623 0.0169 Constraint 237 1256 4.8528 6.0661 12.1321 0.0169 Constraint 237 1213 5.7719 7.2149 14.4298 0.0169 Constraint 229 1192 5.8621 7.3276 14.6552 0.0169 Constraint 205 1213 4.1185 5.1482 10.2964 0.0169 Constraint 205 1174 5.5138 6.8923 13.7845 0.0169 Constraint 168 1174 5.3940 6.7425 13.4850 0.0169 Constraint 148 1159 6.1476 7.6845 15.3690 0.0169 Constraint 148 852 6.3864 7.9830 15.9660 0.0169 Constraint 115 402 5.0378 6.2973 12.5946 0.0169 Constraint 115 394 4.9337 6.1671 12.3343 0.0169 Constraint 1015 1087 5.4735 6.8418 13.6836 0.0169 Constraint 981 1168 4.2547 5.3183 10.6366 0.0169 Constraint 805 951 4.1333 5.1666 10.3332 0.0169 Constraint 900 1159 5.9806 7.4757 14.9515 0.0168 Constraint 1186 1272 5.9075 7.3844 14.7688 0.0168 Constraint 990 1381 6.0766 7.5957 15.1914 0.0168 Constraint 981 1381 4.0408 5.0511 10.1021 0.0168 Constraint 981 1373 5.3777 6.7221 13.4442 0.0168 Constraint 958 1381 3.9741 4.9676 9.9353 0.0168 Constraint 958 1373 6.3251 7.9063 15.8127 0.0168 Constraint 951 1381 5.6194 7.0243 14.0486 0.0168 Constraint 951 1373 4.6243 5.7803 11.5607 0.0168 Constraint 944 1192 6.3198 7.8997 15.7994 0.0168 Constraint 864 1272 4.6022 5.7528 11.5056 0.0168 Constraint 864 1235 4.8772 6.0965 12.1930 0.0168 Constraint 841 1168 6.3083 7.8854 15.7708 0.0168 Constraint 177 351 5.5628 6.9535 13.9069 0.0168 Constraint 958 1451 5.9491 7.4364 14.8728 0.0167 Constraint 532 708 5.1480 6.4350 12.8699 0.0167 Constraint 924 1039 5.3057 6.6321 13.2641 0.0167 Constraint 939 1024 4.8994 6.1242 12.2485 0.0166 Constraint 417 723 5.8019 7.2524 14.5049 0.0166 Constraint 464 610 5.5011 6.8763 13.7527 0.0166 Constraint 373 455 5.6158 7.0197 14.0395 0.0166 Constraint 499 931 4.8839 6.1048 12.2096 0.0166 Constraint 610 728 5.4175 6.7719 13.5438 0.0166 Constraint 1192 1430 5.6482 7.0602 14.1204 0.0164 Constraint 1192 1421 4.2960 5.3699 10.7399 0.0164 Constraint 431 742 4.6959 5.8699 11.7398 0.0164 Constraint 439 864 3.6956 4.6195 9.2391 0.0164 Constraint 532 1007 6.0531 7.5664 15.1328 0.0164 Constraint 551 900 5.8537 7.3171 14.6342 0.0162 Constraint 1208 1413 4.8379 6.0474 12.0947 0.0162 Constraint 1201 1395 5.2784 6.5980 13.1960 0.0162 Constraint 1192 1395 4.8087 6.0109 12.0217 0.0162 Constraint 439 660 4.8384 6.0480 12.0960 0.0161 Constraint 773 1066 5.2314 6.5393 13.0786 0.0161 Constraint 585 951 5.5398 6.9247 13.8494 0.0161 Constraint 499 674 5.8053 7.2566 14.5132 0.0160 Constraint 257 579 5.6211 7.0264 14.0528 0.0160 Constraint 46 257 5.4666 6.8332 13.6664 0.0160 Constraint 343 871 5.2317 6.5396 13.0792 0.0160 Constraint 544 1007 5.7417 7.1771 14.3542 0.0160 Constraint 54 257 5.9588 7.4485 14.8970 0.0158 Constraint 958 1201 4.4940 5.6176 11.2351 0.0158 Constraint 781 1144 5.8052 7.2565 14.5129 0.0158 Constraint 762 1144 4.4756 5.5945 11.1889 0.0158 Constraint 562 841 4.5571 5.6964 11.3928 0.0158 Constraint 951 1201 5.2898 6.6123 13.2246 0.0157 Constraint 931 1201 5.2284 6.5355 13.0711 0.0157 Constraint 884 1201 5.3316 6.6645 13.3290 0.0157 Constraint 624 756 4.7240 5.9049 11.8099 0.0157 Constraint 317 439 5.3989 6.7486 13.4972 0.0156 Constraint 864 967 5.7114 7.1392 14.2785 0.0156 Constraint 632 907 5.0711 6.3388 12.6777 0.0155 Constraint 472 789 5.4168 6.7710 13.5420 0.0155 Constraint 864 958 4.1991 5.2488 10.4977 0.0154 Constraint 1087 1354 6.1990 7.7488 15.4976 0.0154 Constraint 924 998 5.0022 6.2528 12.5056 0.0154 Constraint 402 610 3.7191 4.6489 9.2977 0.0153 Constraint 205 455 3.7941 4.7426 9.4853 0.0153 Constraint 196 455 3.8417 4.8021 9.6042 0.0153 Constraint 624 907 3.9812 4.9765 9.9530 0.0152 Constraint 683 998 5.6654 7.0818 14.1636 0.0152 Constraint 551 624 5.9907 7.4883 14.9767 0.0152 Constraint 455 1421 4.8048 6.0060 12.0120 0.0151 Constraint 455 1395 4.5419 5.6774 11.3547 0.0151 Constraint 455 1386 5.1649 6.4561 12.9122 0.0151 Constraint 455 1347 5.3599 6.6998 13.3997 0.0151 Constraint 455 1339 3.8198 4.7747 9.5495 0.0151 Constraint 196 362 4.0006 5.0007 10.0014 0.0151 Constraint 168 362 3.7514 4.6892 9.3785 0.0151 Constraint 168 351 5.8512 7.3140 14.6279 0.0151 Constraint 168 343 3.3669 4.2087 8.4173 0.0151 Constraint 168 257 4.9990 6.2488 12.4975 0.0151 Constraint 163 362 6.0788 7.5985 15.1969 0.0151 Constraint 163 343 4.8210 6.0263 12.0526 0.0151 Constraint 100 773 5.6290 7.0362 14.0724 0.0151 Constraint 92 317 4.1234 5.1543 10.3085 0.0151 Constraint 92 309 3.7131 4.6413 9.2827 0.0151 Constraint 84 1347 6.2581 7.8227 15.6453 0.0151 Constraint 84 1066 5.2411 6.5514 13.1027 0.0151 Constraint 84 841 6.3339 7.9173 15.8347 0.0151 Constraint 84 649 4.1818 5.2273 10.4545 0.0151 Constraint 84 464 5.9404 7.4255 14.8510 0.0151 Constraint 54 115 6.3808 7.9760 15.9520 0.0151 Constraint 900 1256 5.0699 6.3373 12.6747 0.0151 Constraint 69 275 4.9164 6.1455 12.2909 0.0151 Constraint 931 1066 6.0064 7.5081 15.0161 0.0150 Constraint 602 1124 5.1131 6.3914 12.7827 0.0150 Constraint 585 1329 5.9717 7.4646 14.9293 0.0150 Constraint 431 892 5.0636 6.3295 12.6590 0.0149 Constraint 728 1051 6.1662 7.7077 15.4154 0.0149 Constraint 723 1051 3.4167 4.2709 8.5418 0.0149 Constraint 1201 1413 4.7891 5.9864 11.9728 0.0149 Constraint 177 499 5.4297 6.7871 13.5742 0.0149 Constraint 1295 1386 5.2669 6.5837 13.1673 0.0149 Constraint 551 773 6.3878 7.9847 15.9694 0.0149 Constraint 488 814 5.2751 6.5939 13.1878 0.0149 Constraint 488 781 5.0325 6.2906 12.5811 0.0149 Constraint 488 773 5.9502 7.4378 14.8755 0.0149 Constraint 488 762 5.8462 7.3077 14.6154 0.0149 Constraint 481 781 5.0188 6.2735 12.5469 0.0149 Constraint 481 773 3.1198 3.8997 7.7995 0.0149 Constraint 422 1007 4.9494 6.1868 12.3735 0.0148 Constraint 422 998 3.9902 4.9877 9.9754 0.0148 Constraint 408 660 5.4667 6.8334 13.6668 0.0148 Constraint 624 716 5.6937 7.1171 14.2341 0.0148 Constraint 446 551 6.2936 7.8670 15.7341 0.0148 Constraint 439 551 5.5707 6.9634 13.9269 0.0148 Constraint 944 1087 5.4250 6.7813 13.5626 0.0148 Constraint 814 1075 4.9077 6.1346 12.2693 0.0148 Constraint 610 1106 4.9512 6.1890 12.3780 0.0148 Constraint 446 522 4.5429 5.6786 11.3572 0.0147 Constraint 618 700 5.7776 7.2220 14.4441 0.0147 Constraint 773 1075 5.3487 6.6859 13.3717 0.0146 Constraint 168 499 6.1273 7.6592 15.3183 0.0146 Constraint 981 1192 5.0952 6.3690 12.7380 0.0146 Constraint 981 1159 5.4002 6.7503 13.5006 0.0146 Constraint 805 1144 4.7115 5.8893 11.7787 0.0146 Constraint 805 1133 5.1106 6.3882 12.7764 0.0146 Constraint 789 1150 4.8348 6.0435 12.0869 0.0146 Constraint 781 1150 5.3783 6.7229 13.4458 0.0146 Constraint 522 602 3.9811 4.9764 9.9527 0.0146 Constraint 464 618 5.7316 7.1644 14.3289 0.0146 Constraint 257 386 4.6336 5.7920 11.5840 0.0146 Constraint 100 596 4.0821 5.1027 10.2053 0.0146 Constraint 100 585 4.0668 5.0835 10.1671 0.0146 Constraint 92 585 5.4159 6.7699 13.5398 0.0146 Constraint 84 585 4.3105 5.3881 10.7762 0.0146 Constraint 84 522 5.9462 7.4328 14.8656 0.0146 Constraint 177 708 5.5528 6.9410 13.8820 0.0146 Constraint 472 669 5.5187 6.8983 13.7967 0.0146 Constraint 756 841 4.4554 5.5692 11.1384 0.0145 Constraint 716 852 4.5137 5.6421 11.2842 0.0145 Constraint 708 852 6.0065 7.5081 15.0163 0.0145 Constraint 973 1144 5.6223 7.0279 14.0558 0.0144 Constraint 756 900 5.8830 7.3537 14.7074 0.0144 Constraint 1386 1459 5.3336 6.6669 13.3339 0.0143 Constraint 1186 1430 5.3921 6.7402 13.4803 0.0143 Constraint 1186 1386 5.0570 6.3213 12.6426 0.0143 Constraint 1186 1381 4.5134 5.6418 11.2835 0.0143 Constraint 1174 1381 5.0174 6.2717 12.5434 0.0143 Constraint 532 990 3.1808 3.9760 7.9520 0.0143 Constraint 402 871 5.6251 7.0314 14.0628 0.0143 Constraint 380 864 6.1975 7.7468 15.4937 0.0143 Constraint 998 1168 4.4225 5.5281 11.0562 0.0143 Constraint 892 1031 6.0373 7.5466 15.0932 0.0141 Constraint 900 1201 6.1766 7.7207 15.4415 0.0141 Constraint 716 1150 5.8223 7.2779 14.5558 0.0141 Constraint 708 1159 4.3461 5.4326 10.8652 0.0141 Constraint 618 723 5.9960 7.4950 14.9900 0.0141 Constraint 618 691 5.2707 6.5884 13.1767 0.0141 Constraint 522 1075 4.1544 5.1930 10.3861 0.0141 Constraint 522 716 5.5586 6.9482 13.8964 0.0141 Constraint 488 691 5.0595 6.3244 12.6487 0.0141 Constraint 723 871 5.4595 6.8244 13.6488 0.0141 Constraint 716 864 6.0026 7.5032 15.0065 0.0141 Constraint 380 1075 5.3390 6.6737 13.3475 0.0141 Constraint 794 1168 5.2806 6.6008 13.2016 0.0139 Constraint 624 708 4.5176 5.6469 11.2939 0.0139 Constraint 1031 1159 5.2842 6.6052 13.2104 0.0138 Constraint 522 723 5.8475 7.3094 14.6188 0.0138 Constraint 222 499 4.1123 5.1404 10.2809 0.0138 Constraint 222 488 5.4664 6.8330 13.6660 0.0138 Constraint 185 464 3.9876 4.9844 9.9689 0.0138 Constraint 163 464 5.8773 7.3467 14.6933 0.0138 Constraint 155 431 5.5667 6.9584 13.9167 0.0138 Constraint 84 488 4.7718 5.9647 11.9294 0.0138 Constraint 69 522 5.3624 6.7030 13.4059 0.0138 Constraint 62 351 4.6944 5.8680 11.7360 0.0138 Constraint 46 249 5.4942 6.8678 13.7356 0.0138 Constraint 691 871 5.7801 7.2252 14.4503 0.0138 Constraint 716 998 3.3504 4.1880 8.3760 0.0138 Constraint 291 455 4.3149 5.3936 10.7872 0.0138 Constraint 257 522 6.0181 7.5226 15.0453 0.0138 Constraint 762 990 4.0220 5.0275 10.0550 0.0138 Constraint 884 967 5.6462 7.0578 14.1155 0.0137 Constraint 789 951 6.0231 7.5289 15.0578 0.0137 Constraint 422 669 5.9046 7.3808 14.7615 0.0136 Constraint 439 515 5.5357 6.9196 13.8392 0.0136 Constraint 431 951 5.0536 6.3170 12.6340 0.0136 Constraint 408 939 4.9060 6.1325 12.2651 0.0136 Constraint 624 990 6.2319 7.7898 15.5797 0.0136 Constraint 624 981 5.8695 7.3369 14.6738 0.0136 Constraint 596 981 5.6178 7.0223 14.0446 0.0136 Constraint 742 981 5.5929 6.9911 13.9821 0.0135 Constraint 446 562 5.6723 7.0903 14.1807 0.0135 Constraint 439 562 4.7493 5.9366 11.8732 0.0135 Constraint 69 335 3.9214 4.9018 9.8036 0.0135 Constraint 1087 1306 5.4217 6.7771 13.5542 0.0135 Constraint 1087 1295 4.6416 5.8020 11.6040 0.0135 Constraint 351 522 5.5782 6.9728 13.9455 0.0135 Constraint 351 515 5.7090 7.1362 14.2725 0.0135 Constraint 343 510 5.8215 7.2769 14.5538 0.0135 Constraint 386 585 5.7129 7.1411 14.2823 0.0134 Constraint 177 833 5.4444 6.8055 13.6110 0.0134 Constraint 691 884 5.6169 7.0212 14.0423 0.0134 Constraint 205 585 5.3172 6.6465 13.2931 0.0134 Constraint 1192 1402 5.3393 6.6741 13.3483 0.0134 Constraint 351 446 5.6835 7.1044 14.2087 0.0134 Constraint 596 781 3.8182 4.7727 9.5454 0.0133 Constraint 402 700 3.7759 4.7198 9.4396 0.0133 Constraint 185 325 4.9371 6.1714 12.3427 0.0133 Constraint 958 1144 4.4702 5.5877 11.1755 0.0133 Constraint 386 1024 6.0283 7.5354 15.0708 0.0132 Constraint 907 998 5.7881 7.2351 14.4702 0.0132 Constraint 871 998 3.2552 4.0690 8.1381 0.0132 Constraint 864 1007 3.2983 4.1228 8.2457 0.0132 Constraint 864 998 4.1118 5.1398 10.2796 0.0132 Constraint 805 1051 5.4243 6.7803 13.5606 0.0132 Constraint 762 1066 5.8486 7.3107 14.6215 0.0132 Constraint 762 1051 6.2571 7.8213 15.6426 0.0132 Constraint 742 1075 6.2100 7.7625 15.5250 0.0132 Constraint 728 1087 6.1142 7.6428 15.2855 0.0132 Constraint 728 1075 4.1641 5.2052 10.4104 0.0132 Constraint 723 1007 6.2073 7.7592 15.5184 0.0132 Constraint 532 1144 6.0608 7.5760 15.1520 0.0132 Constraint 510 900 4.7078 5.8847 11.7695 0.0132 Constraint 499 900 4.9022 6.1277 12.2554 0.0132 Constraint 472 931 5.7547 7.1934 14.3868 0.0132 Constraint 439 981 5.8261 7.2826 14.5653 0.0132 Constraint 237 422 5.7215 7.1519 14.3037 0.0132 Constraint 229 455 5.4414 6.8018 13.6036 0.0132 Constraint 229 422 5.2231 6.5289 13.0579 0.0132 Constraint 205 431 4.4050 5.5062 11.0124 0.0132 Constraint 205 422 5.4552 6.8190 13.6379 0.0132 Constraint 196 481 5.9339 7.4173 14.8347 0.0132 Constraint 585 1106 5.2166 6.5207 13.0414 0.0132 Constraint 723 892 5.4993 6.8742 13.7483 0.0131 Constraint 669 781 5.9061 7.3827 14.7653 0.0131 Constraint 602 1133 4.9926 6.2407 12.4814 0.0131 Constraint 579 1133 5.6883 7.1104 14.2207 0.0131 Constraint 499 624 5.0595 6.3244 12.6488 0.0131 Constraint 455 674 5.0754 6.3443 12.6886 0.0131 Constraint 455 660 6.1846 7.7308 15.4616 0.0131 Constraint 446 669 4.8111 6.0138 12.0277 0.0131 Constraint 907 1051 4.9913 6.2391 12.4782 0.0131 Constraint 649 1106 4.7485 5.9357 11.8714 0.0131 Constraint 649 1095 5.5464 6.9330 13.8660 0.0131 Constraint 624 1095 4.8409 6.0512 12.1023 0.0131 Constraint 618 1095 4.2682 5.3352 10.6704 0.0131 Constraint 610 1095 4.4804 5.6005 11.2010 0.0131 Constraint 602 1144 6.0847 7.6059 15.2118 0.0131 Constraint 551 674 6.1154 7.6443 15.2886 0.0131 Constraint 551 641 3.7509 4.6886 9.3773 0.0131 Constraint 510 1007 5.4899 6.8624 13.7247 0.0131 Constraint 499 1106 4.9770 6.2213 12.4426 0.0131 Constraint 488 716 3.4637 4.3296 8.6592 0.0131 Constraint 488 708 5.8432 7.3040 14.6079 0.0131 Constraint 472 990 3.8134 4.7668 9.5335 0.0131 Constraint 472 973 6.0390 7.5488 15.0975 0.0131 Constraint 464 931 5.3239 6.6549 13.3097 0.0131 Constraint 455 723 5.8546 7.3183 14.6366 0.0131 Constraint 455 716 5.7291 7.1613 14.3226 0.0131 Constraint 446 990 5.5977 6.9972 13.9943 0.0131 Constraint 446 973 5.1730 6.4662 12.9324 0.0131 Constraint 439 944 3.0810 3.8512 7.7024 0.0131 Constraint 439 939 6.2588 7.8235 15.6470 0.0131 Constraint 417 973 5.1081 6.3852 12.7703 0.0131 Constraint 417 944 4.9135 6.1418 12.2837 0.0131 Constraint 408 944 4.9446 6.1808 12.3615 0.0131 Constraint 237 373 6.2300 7.7875 15.5749 0.0131 Constraint 196 291 4.5423 5.6779 11.3558 0.0131 Constraint 185 373 4.5987 5.7484 11.4969 0.0131 Constraint 163 291 6.3423 7.9278 15.8557 0.0131 Constraint 439 618 6.2913 7.8641 15.7282 0.0131 Constraint 1159 1244 6.1142 7.6428 15.2856 0.0130 Constraint 852 1256 6.2963 7.8704 15.7407 0.0130 Constraint 852 1244 6.3782 7.9728 15.9456 0.0130 Constraint 515 1264 5.7770 7.2212 14.4424 0.0130 Constraint 499 1256 5.1652 6.4565 12.9129 0.0130 Constraint 488 1264 4.3435 5.4293 10.8587 0.0130 Constraint 488 1256 2.8541 3.5676 7.1352 0.0130 Constraint 488 1225 4.0717 5.0896 10.1792 0.0130 Constraint 481 1225 5.8368 7.2960 14.5919 0.0130 Constraint 464 1256 4.4003 5.5004 11.0008 0.0130 Constraint 455 1256 5.7573 7.1966 14.3932 0.0130 Constraint 455 1225 4.8665 6.0832 12.1664 0.0130 Constraint 455 1213 5.0664 6.3330 12.6660 0.0130 Constraint 455 1192 5.1883 6.4854 12.9708 0.0130 Constraint 431 1213 6.3308 7.9135 15.8270 0.0130 Constraint 431 1159 5.5753 6.9692 13.9383 0.0130 Constraint 69 464 5.5176 6.8970 13.7939 0.0130 Constraint 69 439 4.3210 5.4013 10.8025 0.0130 Constraint 69 431 4.5246 5.6557 11.3114 0.0130 Constraint 69 408 4.6933 5.8667 11.7333 0.0130 Constraint 69 402 4.5843 5.7304 11.4609 0.0130 Constraint 62 624 5.7983 7.2479 14.4958 0.0130 Constraint 54 472 6.1126 7.6408 15.2815 0.0130 Constraint 54 464 4.8693 6.0866 12.1732 0.0130 Constraint 54 439 5.5894 6.9868 13.9736 0.0130 Constraint 46 683 5.9600 7.4501 14.9001 0.0130 Constraint 46 674 5.6674 7.0843 14.1685 0.0130 Constraint 46 649 6.2315 7.7893 15.5787 0.0130 Constraint 41 499 5.1256 6.4070 12.8139 0.0130 Constraint 29 562 5.7010 7.1262 14.2524 0.0130 Constraint 18 570 5.7288 7.1610 14.3220 0.0130 Constraint 18 562 4.1940 5.2425 10.4851 0.0130 Constraint 11 570 4.3715 5.4643 10.9287 0.0130 Constraint 11 562 4.8580 6.0726 12.1451 0.0130 Constraint 11 551 4.7778 5.9723 11.9446 0.0130 Constraint 805 884 5.8291 7.2864 14.5728 0.0129 Constraint 951 1264 4.8503 6.0628 12.1256 0.0129 Constraint 351 499 5.6163 7.0204 14.0408 0.0129 Constraint 464 794 5.1949 6.4936 12.9873 0.0128 Constraint 907 1281 5.1676 6.4595 12.9189 0.0128 Constraint 907 1256 5.4086 6.7607 13.5214 0.0128 Constraint 237 309 4.8432 6.0540 12.1079 0.0128 Constraint 691 981 5.7025 7.1281 14.2562 0.0127 Constraint 683 981 3.5804 4.4755 8.9510 0.0127 Constraint 632 973 5.9679 7.4599 14.9198 0.0127 Constraint 115 602 4.3186 5.3983 10.7966 0.0127 Constraint 84 266 5.7879 7.2349 14.4699 0.0127 Constraint 69 394 5.8374 7.2968 14.5936 0.0127 Constraint 62 422 6.1275 7.6594 15.3189 0.0127 Constraint 62 408 5.7457 7.1821 14.3643 0.0127 Constraint 62 402 6.0823 7.6029 15.2057 0.0127 Constraint 62 394 6.3607 7.9508 15.9017 0.0127 Constraint 422 700 5.7555 7.1944 14.3888 0.0127 Constraint 814 1288 5.5334 6.9168 13.8336 0.0127 Constraint 884 1168 5.0619 6.3274 12.6547 0.0127 Constraint 317 1106 5.4383 6.7979 13.5958 0.0126 Constraint 708 814 4.8058 6.0072 12.0144 0.0126 Constraint 632 762 4.2150 5.2687 10.5374 0.0126 Constraint 325 481 5.2538 6.5672 13.1344 0.0125 Constraint 958 1075 4.5208 5.6510 11.3021 0.0123 Constraint 951 1075 3.4505 4.3132 8.6263 0.0123 Constraint 981 1295 4.4240 5.5300 11.0599 0.0123 Constraint 464 789 6.0459 7.5574 15.1149 0.0123 Constraint 624 822 4.1123 5.1403 10.2807 0.0122 Constraint 871 1133 5.3425 6.6781 13.3563 0.0122 Constraint 439 915 6.2548 7.8184 15.6369 0.0121 Constraint 1095 1339 4.5865 5.7331 11.4663 0.0121 Constraint 967 1295 4.7736 5.9669 11.9339 0.0121 Constraint 291 649 4.4650 5.5813 11.1626 0.0121 Constraint 464 1106 4.7152 5.8940 11.7881 0.0121 Constraint 951 1144 6.0509 7.5637 15.1274 0.0121 Constraint 708 924 4.2293 5.2866 10.5732 0.0121 Constraint 841 915 5.5616 6.9520 13.9041 0.0120 Constraint 814 900 6.3098 7.8873 15.7745 0.0120 Constraint 596 691 6.0956 7.6195 15.2390 0.0120 Constraint 570 691 4.6194 5.7743 11.5486 0.0120 Constraint 570 674 4.1035 5.1294 10.2587 0.0120 Constraint 515 708 5.7633 7.2041 14.4082 0.0120 Constraint 141 275 6.0594 7.5742 15.1485 0.0120 Constraint 132 257 6.1983 7.7479 15.4958 0.0120 Constraint 841 967 6.3177 7.8972 15.7943 0.0120 Constraint 431 884 4.8492 6.0615 12.1230 0.0119 Constraint 723 998 5.5203 6.9003 13.8007 0.0119 Constraint 275 864 5.3286 6.6608 13.3216 0.0118 Constraint 472 649 4.1164 5.1454 10.2909 0.0118 Constraint 343 973 5.9079 7.3849 14.7698 0.0118 Constraint 343 944 4.0249 5.0311 10.0622 0.0118 Constraint 1174 1347 5.1226 6.4032 12.8064 0.0118 Constraint 1095 1329 3.3415 4.1769 8.3538 0.0118 Constraint 1087 1329 5.5273 6.9092 13.8183 0.0118 Constraint 1087 1318 4.6243 5.7804 11.5608 0.0118 Constraint 1075 1306 4.6653 5.8316 11.6633 0.0118 Constraint 1039 1201 4.2237 5.2796 10.5592 0.0117 Constraint 892 1150 5.4907 6.8634 13.7268 0.0117 Constraint 762 1087 5.7617 7.2021 14.4042 0.0117 Constraint 762 1039 3.9663 4.9579 9.9157 0.0117 Constraint 756 1039 6.3430 7.9288 15.8576 0.0117 Constraint 742 1174 6.1228 7.6534 15.3069 0.0117 Constraint 742 1095 5.8695 7.3369 14.6739 0.0117 Constraint 728 1095 5.8696 7.3369 14.6739 0.0117 Constraint 532 864 5.0696 6.3369 12.6739 0.0117 Constraint 522 944 5.1941 6.4926 12.9852 0.0117 Constraint 394 805 4.6967 5.8709 11.7419 0.0117 Constraint 386 1039 6.3157 7.8946 15.7893 0.0117 Constraint 386 822 2.9400 3.6750 7.3500 0.0117 Constraint 380 1051 6.2189 7.7736 15.5473 0.0117 Constraint 380 1039 3.1651 3.9563 7.9127 0.0117 Constraint 380 822 5.8625 7.3281 14.6563 0.0117 Constraint 373 1051 4.6844 5.8555 11.7110 0.0117 Constraint 362 1066 4.7843 5.9804 11.9609 0.0117 Constraint 362 1039 3.5738 4.4673 8.9346 0.0117 Constraint 362 762 3.1939 3.9923 7.9847 0.0117 Constraint 362 756 6.2820 7.8525 15.7050 0.0117 Constraint 362 742 6.2203 7.7754 15.5508 0.0117 Constraint 351 1066 5.8181 7.2727 14.5453 0.0117 Constraint 351 1051 5.8467 7.3084 14.6167 0.0117 Constraint 351 931 4.9430 6.1788 12.3575 0.0117 Constraint 351 915 6.0317 7.5396 15.0792 0.0117 Constraint 343 1075 4.0596 5.0745 10.1491 0.0117 Constraint 335 1075 5.3318 6.6648 13.3296 0.0117 Constraint 335 931 5.7155 7.1444 14.2887 0.0117 Constraint 335 915 4.7775 5.9719 11.9438 0.0117 Constraint 335 892 2.7408 3.4260 6.8521 0.0117 Constraint 229 871 4.8218 6.0272 12.0544 0.0117 Constraint 205 871 5.5053 6.8816 13.7631 0.0117 Constraint 205 852 5.5445 6.9306 13.8612 0.0117 Constraint 373 708 4.7657 5.9571 11.9142 0.0116 Constraint 871 1051 5.6071 7.0089 14.0178 0.0116 Constraint 871 1039 3.5676 4.4596 8.9191 0.0116 Constraint 864 1039 6.0933 7.6167 15.2333 0.0116 Constraint 924 1168 5.6039 7.0049 14.0097 0.0115 Constraint 924 1159 5.5508 6.9385 13.8770 0.0115 Constraint 900 967 3.4738 4.3422 8.6844 0.0115 Constraint 822 907 5.6068 7.0085 14.0171 0.0115 Constraint 814 939 3.4075 4.2594 8.5188 0.0115 Constraint 814 915 5.6335 7.0419 14.0837 0.0115 Constraint 805 939 4.2350 5.2938 10.5876 0.0115 Constraint 805 931 5.1298 6.4123 12.8245 0.0115 Constraint 805 924 4.9409 6.1762 12.3523 0.0115 Constraint 805 915 3.6809 4.6011 9.2022 0.0115 Constraint 649 915 6.3198 7.8997 15.7994 0.0115 Constraint 641 892 5.4990 6.8738 13.7475 0.0115 Constraint 570 967 3.7497 4.6871 9.3742 0.0115 Constraint 551 967 6.3780 7.9725 15.9449 0.0115 Constraint 422 570 5.2367 6.5459 13.0919 0.0115 Constraint 408 1087 6.2008 7.7510 15.5021 0.0115 Constraint 402 602 4.9487 6.1858 12.3716 0.0115 Constraint 402 585 4.1716 5.2144 10.4289 0.0115 Constraint 402 579 5.7656 7.2070 14.4140 0.0115 Constraint 373 669 5.7660 7.2075 14.4149 0.0115 Constraint 362 990 4.0784 5.0980 10.1960 0.0115 Constraint 362 981 6.1411 7.6764 15.3528 0.0115 Constraint 351 618 5.1417 6.4272 12.8543 0.0115 Constraint 335 417 6.1977 7.7472 15.4944 0.0115 Constraint 325 708 6.2068 7.7585 15.5171 0.0115 Constraint 325 700 5.4731 6.8414 13.6827 0.0115 Constraint 317 394 3.1404 3.9255 7.8510 0.0115 Constraint 266 1024 4.2083 5.2603 10.5207 0.0115 Constraint 266 551 5.3064 6.6330 13.2660 0.0115 Constraint 249 1024 4.7013 5.8766 11.7532 0.0115 Constraint 249 998 5.5077 6.8846 13.7691 0.0115 Constraint 237 998 5.0458 6.3072 12.6144 0.0115 Constraint 214 1024 5.3467 6.6834 13.3667 0.0115 Constraint 214 998 5.0090 6.2613 12.5225 0.0115 Constraint 205 998 4.8401 6.0501 12.1002 0.0115 Constraint 205 967 4.6157 5.7696 11.5392 0.0115 Constraint 177 998 6.3037 7.8796 15.7592 0.0115 Constraint 177 990 5.2092 6.5115 13.0230 0.0115 Constraint 177 967 4.5805 5.7257 11.4513 0.0115 Constraint 177 951 5.8212 7.2765 14.5530 0.0115 Constraint 177 282 6.3271 7.9088 15.8177 0.0115 Constraint 168 967 5.5692 6.9615 13.9231 0.0115 Constraint 62 1039 6.3923 7.9903 15.9806 0.0115 Constraint 214 822 6.1531 7.6914 15.3827 0.0115 Constraint 716 939 6.1884 7.7355 15.4710 0.0114 Constraint 544 841 5.2615 6.5768 13.1537 0.0114 Constraint 723 884 5.7429 7.1786 14.3571 0.0113 Constraint 610 907 5.4246 6.7808 13.5615 0.0113 Constraint 596 931 3.6160 4.5200 9.0400 0.0113 Constraint 579 931 6.0133 7.5167 15.0334 0.0113 Constraint 439 805 6.3152 7.8940 15.7880 0.0113 Constraint 386 488 6.1030 7.6288 15.2575 0.0112 Constraint 115 624 5.2969 6.6211 13.2422 0.0112 Constraint 958 1106 4.9966 6.2457 12.4915 0.0111 Constraint 1318 1395 3.9973 4.9966 9.9932 0.0110 Constraint 1306 1395 6.0843 7.6053 15.2106 0.0110 Constraint 1306 1386 6.3239 7.9048 15.8097 0.0110 Constraint 1288 1421 5.3236 6.6545 13.3089 0.0110 Constraint 1281 1451 5.1079 6.3849 12.7697 0.0110 Constraint 1281 1430 4.4331 5.5413 11.0826 0.0110 Constraint 1281 1421 5.3290 6.6613 13.3225 0.0110 Constraint 1264 1451 4.3069 5.3837 10.7673 0.0110 Constraint 1144 1347 5.0129 6.2662 12.5323 0.0110 Constraint 1133 1329 3.1147 3.8934 7.7868 0.0110 Constraint 1133 1318 5.1655 6.4569 12.9137 0.0110 Constraint 1124 1329 5.2874 6.6093 13.2185 0.0110 Constraint 1124 1318 5.0593 6.3241 12.6483 0.0110 Constraint 1124 1235 5.9649 7.4562 14.9123 0.0110 Constraint 1095 1354 4.5321 5.6652 11.3303 0.0110 Constraint 1095 1235 4.1957 5.2446 10.4892 0.0110 Constraint 1095 1208 3.3389 4.1736 8.3472 0.0110 Constraint 1087 1244 6.2588 7.8235 15.6469 0.0110 Constraint 1075 1281 5.2772 6.5965 13.1929 0.0110 Constraint 1075 1264 5.2124 6.5156 13.0311 0.0110 Constraint 1075 1256 3.4254 4.2817 8.5634 0.0110 Constraint 1031 1272 6.0609 7.5761 15.1522 0.0110 Constraint 1024 1295 5.0851 6.3563 12.7126 0.0110 Constraint 1024 1288 4.8415 6.0519 12.1038 0.0110 Constraint 1024 1281 5.6568 7.0710 14.1420 0.0110 Constraint 1024 1272 5.1815 6.4768 12.9537 0.0110 Constraint 1015 1306 5.3160 6.6450 13.2899 0.0110 Constraint 1015 1295 4.2104 5.2630 10.5260 0.0110 Constraint 1015 1288 5.7118 7.1397 14.2795 0.0110 Constraint 1015 1244 6.3783 7.9728 15.9457 0.0110 Constraint 1007 1295 4.7394 5.9242 11.8485 0.0110 Constraint 958 1159 4.4883 5.6104 11.2208 0.0110 Constraint 951 1339 6.1807 7.7258 15.4517 0.0110 Constraint 944 1402 5.8323 7.2904 14.5808 0.0110 Constraint 944 1395 4.9410 6.1762 12.3525 0.0110 Constraint 944 1339 4.5325 5.6656 11.3313 0.0110 Constraint 939 1159 6.2344 7.7930 15.5861 0.0110 Constraint 915 1106 4.1786 5.2233 10.4466 0.0110 Constraint 915 1024 5.9138 7.3923 14.7846 0.0110 Constraint 907 1133 6.2626 7.8283 15.6565 0.0110 Constraint 884 1024 4.3165 5.3957 10.7914 0.0110 Constraint 864 1430 4.6573 5.8216 11.6432 0.0110 Constraint 864 1281 4.7103 5.8879 11.7757 0.0110 Constraint 852 1168 4.5259 5.6573 11.3147 0.0110 Constraint 841 1459 4.1619 5.2023 10.4047 0.0110 Constraint 841 1430 6.0773 7.5966 15.1931 0.0110 Constraint 833 1186 5.7701 7.2126 14.4251 0.0110 Constraint 833 1168 6.2753 7.8441 15.6882 0.0110 Constraint 822 1208 5.4696 6.8370 13.6739 0.0110 Constraint 756 884 4.3790 5.4738 10.9476 0.0110 Constraint 742 1124 4.7451 5.9313 11.8627 0.0110 Constraint 618 756 6.0071 7.5089 15.0178 0.0110 Constraint 455 1459 6.3859 7.9823 15.9647 0.0110 Constraint 455 1442 5.8637 7.3296 14.6592 0.0110 Constraint 422 1413 3.8300 4.7875 9.5749 0.0110 Constraint 422 1402 5.4007 6.7509 13.5019 0.0110 Constraint 422 1381 6.1682 7.7103 15.4206 0.0110 Constraint 408 1402 5.3106 6.6382 13.2764 0.0110 Constraint 408 998 4.8268 6.0335 12.0671 0.0110 Constraint 402 1133 5.0753 6.3442 12.6883 0.0110 Constraint 683 1007 5.9865 7.4831 14.9662 0.0110 Constraint 1264 1381 4.1576 5.1970 10.3941 0.0109 Constraint 1264 1373 5.1344 6.4179 12.8359 0.0109 Constraint 1256 1381 6.3909 7.9886 15.9772 0.0109 Constraint 1256 1373 4.3201 5.4001 10.8002 0.0109 Constraint 1095 1459 3.8422 4.8028 9.6056 0.0109 Constraint 1075 1459 3.8647 4.8308 9.6617 0.0109 Constraint 951 1451 4.6996 5.8745 11.7490 0.0109 Constraint 924 1395 5.2782 6.5977 13.1955 0.0109 Constraint 900 1386 5.5952 6.9940 13.9879 0.0109 Constraint 884 1395 5.5005 6.8756 13.7512 0.0109 Constraint 884 1386 6.2179 7.7723 15.5447 0.0109 Constraint 884 1244 5.0987 6.3733 12.7467 0.0109 Constraint 864 939 6.2944 7.8680 15.7360 0.0109 Constraint 579 1075 5.5610 6.9513 13.9026 0.0109 Constraint 551 1087 5.3695 6.7119 13.4239 0.0109 Constraint 481 700 5.6678 7.0848 14.1695 0.0109 Constraint 446 641 5.9841 7.4801 14.9602 0.0109 Constraint 439 1106 5.9170 7.3962 14.7924 0.0109 Constraint 335 649 5.1488 6.4360 12.8720 0.0109 Constraint 335 641 2.2980 2.8726 5.7451 0.0109 Constraint 335 618 4.1268 5.1585 10.3169 0.0109 Constraint 335 446 5.1275 6.4094 12.8187 0.0109 Constraint 297 973 5.4298 6.7873 13.5746 0.0109 Constraint 291 1106 5.4385 6.7981 13.5963 0.0109 Constraint 291 1095 5.7331 7.1664 14.3329 0.0109 Constraint 291 1087 3.0197 3.7746 7.5492 0.0109 Constraint 291 1075 5.5713 6.9642 13.9283 0.0109 Constraint 282 1087 5.7409 7.1761 14.3522 0.0109 Constraint 282 1075 4.3883 5.4853 10.9706 0.0109 Constraint 282 1066 4.4027 5.5034 11.0068 0.0109 Constraint 275 1087 4.5466 5.6832 11.3664 0.0109 Constraint 257 551 5.8433 7.3041 14.6082 0.0109 Constraint 249 1087 5.5865 6.9831 13.9663 0.0109 Constraint 249 551 2.8700 3.5875 7.1750 0.0109 Constraint 249 544 4.2548 5.3186 10.6371 0.0109 Constraint 990 1174 5.2233 6.5292 13.0583 0.0109 Constraint 814 1208 5.0755 6.3443 12.6886 0.0109 Constraint 660 907 5.4712 6.8391 13.6781 0.0109 Constraint 683 1015 4.2034 5.2542 10.5085 0.0108 Constraint 163 641 5.4775 6.8468 13.6937 0.0108 Constraint 155 325 5.6564 7.0705 14.1409 0.0107 Constraint 499 691 4.8444 6.0555 12.1110 0.0107 Constraint 973 1192 6.0837 7.6046 15.2093 0.0107 Constraint 1039 1133 3.8604 4.8255 9.6509 0.0106 Constraint 1354 1430 5.1366 6.4208 12.8415 0.0106 Constraint 1339 1430 3.2051 4.0064 8.0128 0.0106 Constraint 1235 1318 4.6405 5.8007 11.6014 0.0106 Constraint 1201 1339 4.0586 5.0732 10.1464 0.0106 Constraint 1201 1318 4.8394 6.0492 12.0985 0.0106 Constraint 1174 1354 5.9796 7.4745 14.9490 0.0106 Constraint 1174 1339 4.5120 5.6400 11.2801 0.0106 Constraint 1106 1329 5.5227 6.9034 13.8068 0.0106 Constraint 1106 1318 6.2278 7.7847 15.5694 0.0106 Constraint 1075 1295 5.8114 7.2642 14.5284 0.0106 Constraint 1066 1295 5.0375 6.2969 12.5938 0.0106 Constraint 981 1288 4.2529 5.3162 10.6323 0.0106 Constraint 967 1051 4.8778 6.0973 12.1946 0.0106 Constraint 924 1256 5.6761 7.0951 14.1902 0.0106 Constraint 924 1225 5.1838 6.4798 12.9596 0.0106 Constraint 900 1213 5.3489 6.6861 13.3722 0.0106 Constraint 864 1225 6.3477 7.9346 15.8692 0.0106 Constraint 833 1347 6.3317 7.9146 15.8291 0.0106 Constraint 814 1329 4.4549 5.5686 11.1371 0.0106 Constraint 716 1066 5.8184 7.2730 14.5460 0.0106 Constraint 716 1051 5.3262 6.6578 13.3156 0.0106 Constraint 691 1051 4.3621 5.4526 10.9052 0.0106 Constraint 683 1066 5.2902 6.6127 13.2254 0.0106 Constraint 683 1051 2.9280 3.6600 7.3200 0.0106 Constraint 660 1051 4.0747 5.0934 10.1868 0.0106 Constraint 649 1051 6.2717 7.8396 15.6791 0.0106 Constraint 610 967 6.0583 7.5729 15.1458 0.0106 Constraint 488 789 6.1465 7.6831 15.3663 0.0106 Constraint 488 742 6.0741 7.5927 15.1853 0.0106 Constraint 380 1124 6.3580 7.9475 15.8950 0.0106 Constraint 266 570 5.1388 6.4234 12.8469 0.0106 Constraint 266 562 6.2927 7.8658 15.7316 0.0106 Constraint 100 1347 6.2372 7.7965 15.5930 0.0106 Constraint 100 1133 6.2868 7.8585 15.7170 0.0106 Constraint 100 309 6.1138 7.6422 15.2845 0.0106 Constraint 641 728 4.1803 5.2253 10.4507 0.0106 Constraint 222 297 6.0943 7.6179 15.2359 0.0105 Constraint 168 822 6.3444 7.9305 15.8610 0.0105 Constraint 924 1272 6.3985 7.9982 15.9963 0.0105 Constraint 362 624 5.7777 7.2221 14.4441 0.0105 Constraint 343 624 6.1082 7.6353 15.2705 0.0105 Constraint 618 814 5.7681 7.2101 14.4203 0.0105 Constraint 1039 1144 5.3837 6.7296 13.4592 0.0104 Constraint 1024 1150 6.0533 7.5666 15.1333 0.0104 Constraint 708 958 6.2254 7.7817 15.5634 0.0103 Constraint 700 814 3.9720 4.9650 9.9300 0.0103 Constraint 585 944 4.6325 5.7907 11.5813 0.0102 Constraint 408 610 5.0861 6.3576 12.7152 0.0102 Constraint 683 1024 6.0352 7.5440 15.0879 0.0102 Constraint 1075 1430 5.9315 7.4144 14.8288 0.0102 Constraint 510 700 4.7354 5.9193 11.8385 0.0102 Constraint 431 618 5.9173 7.3967 14.7933 0.0102 Constraint 362 522 5.3303 6.6628 13.3257 0.0102 Constraint 351 464 5.7841 7.2301 14.4601 0.0102 Constraint 1106 1281 6.1241 7.6551 15.3101 0.0100 Constraint 1124 1201 5.1813 6.4766 12.9532 0.0100 Constraint 610 990 4.7562 5.9452 11.8904 0.0100 Constraint 343 1124 6.3173 7.8966 15.7933 0.0099 Constraint 632 728 5.5949 6.9936 13.9872 0.0098 Constraint 1225 1329 4.2993 5.3741 10.7482 0.0097 Constraint 1213 1354 4.4932 5.6165 11.2329 0.0097 Constraint 1192 1362 5.4076 6.7595 13.5191 0.0097 Constraint 1192 1354 4.4831 5.6038 11.2077 0.0097 Constraint 1075 1339 5.9285 7.4107 14.8213 0.0097 Constraint 990 1186 5.6566 7.0707 14.1414 0.0097 Constraint 990 1150 3.2698 4.0873 8.1746 0.0097 Constraint 981 1213 5.4781 6.8476 13.6952 0.0097 Constraint 981 1208 5.6033 7.0041 14.0081 0.0097 Constraint 981 1186 2.1685 2.7106 5.4213 0.0097 Constraint 973 1256 6.1774 7.7217 15.4434 0.0097 Constraint 973 1213 3.1882 3.9853 7.9706 0.0097 Constraint 973 1208 3.7378 4.6723 9.3446 0.0097 Constraint 973 1186 4.2168 5.2710 10.5421 0.0097 Constraint 967 1244 6.0243 7.5303 15.0607 0.0097 Constraint 951 1213 4.7798 5.9748 11.9496 0.0097 Constraint 944 1256 5.7164 7.1455 14.2910 0.0097 Constraint 864 1295 6.1539 7.6923 15.3847 0.0097 Constraint 852 1295 6.3381 7.9226 15.8452 0.0097 Constraint 805 1192 3.9550 4.9438 9.8875 0.0097 Constraint 805 1150 4.5039 5.6298 11.2597 0.0097 Constraint 805 1106 4.9515 6.1893 12.3786 0.0097 Constraint 805 1095 5.2097 6.5121 13.0243 0.0097 Constraint 794 1192 5.9914 7.4892 14.9784 0.0097 Constraint 794 1150 3.9124 4.8905 9.7809 0.0097 Constraint 794 1144 5.5914 6.9893 13.9785 0.0097 Constraint 794 1133 4.3334 5.4167 10.8335 0.0097 Constraint 789 1168 4.2993 5.3741 10.7483 0.0097 Constraint 781 1168 4.9372 6.1715 12.3429 0.0097 Constraint 773 1168 4.9407 6.1758 12.3516 0.0097 Constraint 773 1159 5.0300 6.2875 12.5749 0.0097 Constraint 773 1150 5.3829 6.7286 13.4573 0.0097 Constraint 773 1144 4.4531 5.5663 11.1326 0.0097 Constraint 762 1159 5.2853 6.6066 13.2132 0.0097 Constraint 762 1150 4.8494 6.0618 12.1235 0.0097 Constraint 742 864 3.8973 4.8717 9.7433 0.0097 Constraint 716 884 6.3350 7.9188 15.8376 0.0097 Constraint 716 871 4.7865 5.9831 11.9662 0.0097 Constraint 708 1133 5.4037 6.7546 13.5092 0.0097 Constraint 708 944 5.4679 6.8348 13.6696 0.0097 Constraint 674 951 5.7642 7.2052 14.4105 0.0097 Constraint 624 723 6.1979 7.7474 15.4948 0.0097 Constraint 237 660 6.3123 7.8904 15.7808 0.0097 Constraint 229 649 4.8752 6.0940 12.1880 0.0097 Constraint 841 1186 6.2141 7.7676 15.5352 0.0097 Constraint 62 214 5.0496 6.3120 12.6240 0.0097 Constraint 62 205 5.5268 6.9086 13.8171 0.0097 Constraint 373 1095 5.3417 6.6772 13.3543 0.0096 Constraint 373 1087 3.9970 4.9963 9.9925 0.0096 Constraint 373 931 6.0025 7.5031 15.0062 0.0096 Constraint 814 958 6.2714 7.8393 15.6785 0.0096 Constraint 756 1159 5.2373 6.5466 13.0933 0.0096 Constraint 610 998 6.0120 7.5150 15.0300 0.0096 Constraint 973 1124 4.8652 6.0815 12.1630 0.0095 Constraint 602 973 5.3316 6.6645 13.3291 0.0095 Constraint 602 967 5.7957 7.2446 14.4891 0.0095 Constraint 585 967 5.4143 6.7679 13.5359 0.0095 Constraint 1024 1159 5.9861 7.4827 14.9653 0.0095 Constraint 1015 1159 6.1869 7.7336 15.4673 0.0094 Constraint 1007 1168 5.4111 6.7639 13.5277 0.0094 Constraint 1007 1159 5.3108 6.6385 13.2769 0.0094 Constraint 900 1192 6.3482 7.9352 15.8704 0.0094 Constraint 892 1174 5.8124 7.2655 14.5311 0.0094 Constraint 871 1201 4.8321 6.0401 12.0802 0.0094 Constraint 700 1150 2.5702 3.2128 6.4256 0.0094 Constraint 700 1144 3.5678 4.4598 8.9196 0.0094 Constraint 632 742 5.5274 6.9092 13.8185 0.0094 Constraint 624 742 4.8875 6.1094 12.2188 0.0094 Constraint 610 1168 3.7914 4.7392 9.4784 0.0094 Constraint 610 1159 4.5799 5.7249 11.4498 0.0094 Constraint 610 1150 4.7806 5.9757 11.9515 0.0094 Constraint 610 700 4.5220 5.6525 11.3049 0.0094 Constraint 610 691 4.3977 5.4971 10.9942 0.0094 Constraint 602 728 5.2161 6.5201 13.0402 0.0094 Constraint 515 691 6.1828 7.7286 15.4571 0.0094 Constraint 488 700 3.8475 4.8093 9.6187 0.0094 Constraint 481 683 4.6801 5.8502 11.7003 0.0094 Constraint 481 674 6.3197 7.8996 15.7993 0.0094 Constraint 237 1075 3.1678 3.9597 7.9195 0.0094 Constraint 229 1075 5.7082 7.1352 14.2705 0.0094 Constraint 214 1075 4.5514 5.6892 11.3784 0.0094 Constraint 205 1051 4.3725 5.4657 10.9313 0.0094 Constraint 177 1051 3.3378 4.1723 8.3446 0.0094 Constraint 939 1051 4.6839 5.8549 11.7099 0.0093 Constraint 700 805 4.1060 5.1325 10.2651 0.0093 Constraint 907 1039 4.8003 6.0004 12.0008 0.0093 Constraint 805 1159 4.7902 5.9877 11.9755 0.0093 Constraint 789 1159 5.1405 6.4256 12.8512 0.0093 Constraint 155 781 5.1182 6.3978 12.7956 0.0093 Constraint 907 1213 5.8903 7.3629 14.7257 0.0093 Constraint 833 958 5.4055 6.7569 13.5138 0.0093 Constraint 716 931 5.6705 7.0881 14.1762 0.0093 Constraint 708 907 4.1345 5.1682 10.3363 0.0093 Constraint 62 132 4.5310 5.6637 11.3274 0.0093 Constraint 29 163 3.5140 4.3925 8.7849 0.0093 Constraint 29 148 5.1443 6.4304 12.8608 0.0093 Constraint 11 163 6.0257 7.5322 15.0643 0.0093 Constraint 464 915 5.5250 6.9062 13.8125 0.0092 Constraint 532 1031 6.2701 7.8376 15.6752 0.0092 Constraint 532 1024 4.6105 5.7631 11.5261 0.0092 Constraint 532 1015 4.5306 5.6632 11.3264 0.0092 Constraint 499 1024 5.6080 7.0100 14.0201 0.0092 Constraint 464 1024 6.1768 7.7210 15.4420 0.0092 Constraint 464 981 5.9015 7.3768 14.7537 0.0092 Constraint 431 852 5.7409 7.1761 14.3521 0.0092 Constraint 408 951 4.5984 5.7481 11.4961 0.0092 Constraint 380 1095 5.3448 6.6810 13.3620 0.0092 Constraint 291 1031 4.5579 5.6974 11.3949 0.0092 Constraint 266 805 4.8743 6.0929 12.1857 0.0092 Constraint 266 579 3.6732 4.5915 9.1830 0.0092 Constraint 222 579 5.8464 7.3080 14.6160 0.0092 Constraint 196 562 6.2943 7.8679 15.7358 0.0092 Constraint 196 551 3.8010 4.7512 9.5024 0.0092 Constraint 742 1159 5.0135 6.2668 12.5337 0.0091 Constraint 641 789 5.6247 7.0309 14.0617 0.0091 Constraint 632 781 5.2623 6.5779 13.1558 0.0091 Constraint 610 1133 5.7196 7.1495 14.2991 0.0091 Constraint 579 967 6.2728 7.8410 15.6820 0.0091 Constraint 373 488 4.9943 6.2429 12.4858 0.0091 Constraint 958 1124 6.1892 7.7365 15.4730 0.0091 Constraint 814 1174 3.8021 4.7526 9.5052 0.0091 Constraint 805 1174 5.8529 7.3162 14.6323 0.0091 Constraint 1272 1354 5.3057 6.6322 13.2644 0.0091 Constraint 884 1015 6.2541 7.8177 15.6353 0.0091 Constraint 884 990 5.6354 7.0443 14.0885 0.0091 Constraint 884 981 4.1358 5.1697 10.3395 0.0091 Constraint 871 1373 6.3369 7.9212 15.8423 0.0091 Constraint 723 944 5.9648 7.4560 14.9120 0.0091 Constraint 700 944 5.0146 6.2682 12.5364 0.0091 Constraint 700 939 6.0571 7.5714 15.1429 0.0091 Constraint 700 924 5.6463 7.0579 14.1158 0.0091 Constraint 700 915 5.5663 6.9579 13.9157 0.0091 Constraint 700 907 3.3808 4.2260 8.4520 0.0091 Constraint 700 892 5.1932 6.4915 12.9830 0.0091 Constraint 700 884 4.1804 5.2255 10.4510 0.0091 Constraint 683 884 5.4230 6.7787 13.5574 0.0091 Constraint 683 871 4.3441 5.4302 10.8603 0.0091 Constraint 674 871 5.6947 7.1183 14.2367 0.0091 Constraint 674 864 4.0443 5.0554 10.1107 0.0091 Constraint 669 1024 6.1404 7.6755 15.3510 0.0091 Constraint 669 1015 5.1157 6.3946 12.7892 0.0091 Constraint 669 871 5.3935 6.7418 13.4837 0.0091 Constraint 669 852 3.7185 4.6481 9.2962 0.0091 Constraint 669 841 5.4235 6.7794 13.5587 0.0091 Constraint 596 1451 6.3900 7.9874 15.9749 0.0091 Constraint 570 641 5.3356 6.6695 13.3389 0.0091 Constraint 562 674 6.3429 7.9287 15.8573 0.0091 Constraint 562 660 3.3958 4.2448 8.4896 0.0091 Constraint 562 641 5.8802 7.3503 14.7006 0.0091 Constraint 515 789 5.3183 6.6479 13.2959 0.0091 Constraint 510 814 6.2739 7.8423 15.6847 0.0091 Constraint 417 669 6.1887 7.7359 15.4718 0.0091 Constraint 335 691 6.1881 7.7352 15.4703 0.0091 Constraint 325 1024 6.0514 7.5643 15.1285 0.0091 Constraint 325 990 4.5473 5.6841 11.3682 0.0091 Constraint 325 674 6.3566 7.9457 15.8914 0.0091 Constraint 317 683 5.2828 6.6035 13.2069 0.0091 Constraint 317 674 3.6819 4.6024 9.2048 0.0091 Constraint 317 669 5.7497 7.1871 14.3742 0.0091 Constraint 317 660 5.7299 7.1624 14.3248 0.0091 Constraint 309 1024 4.1737 5.2171 10.4343 0.0091 Constraint 309 1015 5.8932 7.3665 14.7329 0.0091 Constraint 309 683 5.3167 6.6459 13.2918 0.0091 Constraint 309 674 6.1873 7.7342 15.4683 0.0091 Constraint 309 669 3.5979 4.4973 8.9947 0.0091 Constraint 309 660 6.0097 7.5121 15.0243 0.0091 Constraint 297 669 5.7072 7.1340 14.2680 0.0091 Constraint 297 660 3.8128 4.7660 9.5319 0.0091 Constraint 297 649 5.5815 6.9768 13.9537 0.0091 Constraint 297 641 4.7365 5.9206 11.8413 0.0091 Constraint 291 669 6.1789 7.7236 15.4472 0.0091 Constraint 291 641 6.0647 7.5809 15.1617 0.0091 Constraint 282 649 5.5586 6.9482 13.8964 0.0091 Constraint 282 641 5.1871 6.4838 12.9677 0.0091 Constraint 282 624 6.0576 7.5720 15.1440 0.0091 Constraint 275 641 4.3116 5.3895 10.7789 0.0091 Constraint 205 602 3.9339 4.9173 9.8346 0.0091 Constraint 205 596 3.4832 4.3541 8.7081 0.0091 Constraint 196 641 6.2549 7.8186 15.6372 0.0091 Constraint 196 602 6.0783 7.5979 15.1959 0.0091 Constraint 196 596 2.6308 3.2885 6.5770 0.0091 Constraint 196 585 3.5342 4.4178 8.8355 0.0091 Constraint 196 570 5.9997 7.4997 14.9993 0.0091 Constraint 185 585 6.1959 7.7448 15.4896 0.0091 Constraint 168 570 4.4995 5.6244 11.2488 0.0091 Constraint 168 522 4.9723 6.2154 12.4307 0.0091 Constraint 163 585 5.0671 6.3339 12.6679 0.0091 Constraint 163 570 4.1136 5.1421 10.2841 0.0091 Constraint 148 522 3.8176 4.7720 9.5441 0.0091 Constraint 141 1442 5.1357 6.4196 12.8392 0.0091 Constraint 141 1430 6.0534 7.5667 15.1335 0.0091 Constraint 141 1421 4.2792 5.3491 10.6981 0.0091 Constraint 141 532 4.2397 5.2997 10.5993 0.0091 Constraint 141 522 3.2188 4.0235 8.0470 0.0091 Constraint 132 1430 3.9142 4.8927 9.7855 0.0091 Constraint 132 1421 5.7833 7.2292 14.4584 0.0091 Constraint 124 522 6.3814 7.9767 15.9534 0.0091 Constraint 115 522 3.8077 4.7596 9.5192 0.0091 Constraint 115 515 3.1608 3.9509 7.9019 0.0091 Constraint 100 515 5.8316 7.2895 14.5790 0.0091 Constraint 92 1244 6.2684 7.8355 15.6710 0.0091 Constraint 92 1235 5.5886 6.9858 13.9715 0.0091 Constraint 92 1225 5.4800 6.8501 13.7001 0.0091 Constraint 92 1213 5.5193 6.8991 13.7981 0.0091 Constraint 92 1208 4.2286 5.2857 10.5714 0.0091 Constraint 92 924 5.2179 6.5223 13.0447 0.0091 Constraint 92 756 4.6317 5.7896 11.5793 0.0091 Constraint 92 742 5.7257 7.1571 14.3142 0.0091 Constraint 84 1213 3.7408 4.6760 9.3521 0.0091 Constraint 84 1208 5.9844 7.4805 14.9610 0.0091 Constraint 84 951 4.9803 6.2254 12.4507 0.0091 Constraint 84 944 5.2954 6.6192 13.2384 0.0091 Constraint 54 132 3.3861 4.2327 8.4654 0.0091 Constraint 41 1362 5.5954 6.9943 13.9886 0.0091 Constraint 41 1354 4.8355 6.0444 12.0889 0.0091 Constraint 1208 1421 5.0532 6.3165 12.6330 0.0091 Constraint 1208 1402 5.8587 7.3234 14.6468 0.0091 Constraint 1208 1395 4.2008 5.2510 10.5021 0.0091 Constraint 1186 1395 6.2431 7.8039 15.6077 0.0091 Constraint 1007 1451 6.1478 7.6847 15.3694 0.0091 Constraint 1007 1421 4.6634 5.8293 11.6586 0.0091 Constraint 1007 1395 6.2134 7.7667 15.5334 0.0091 Constraint 1007 1144 5.2459 6.5574 13.1148 0.0091 Constraint 998 1451 5.7484 7.1854 14.3709 0.0091 Constraint 833 1395 5.3161 6.6451 13.2902 0.0091 Constraint 814 1459 6.0510 7.5637 15.1274 0.0091 Constraint 814 1430 5.7258 7.1573 14.3145 0.0091 Constraint 716 1007 5.8631 7.3289 14.6577 0.0091 Constraint 716 990 5.3700 6.7125 13.4250 0.0091 Constraint 708 990 6.0725 7.5906 15.1813 0.0091 Constraint 700 990 6.2907 7.8634 15.7268 0.0091 Constraint 632 892 5.2723 6.5904 13.1809 0.0091 Constraint 618 1159 6.2780 7.8475 15.6951 0.0091 Constraint 602 1007 6.3444 7.9305 15.8610 0.0091 Constraint 596 1395 5.5990 6.9988 13.9976 0.0091 Constraint 596 1256 6.3516 7.9395 15.8790 0.0091 Constraint 579 1430 4.8553 6.0691 12.1382 0.0091 Constraint 422 544 6.2777 7.8472 15.6944 0.0091 Constraint 275 522 3.9567 4.9459 9.8918 0.0091 Constraint 249 1430 6.2201 7.7751 15.5502 0.0091 Constraint 249 1402 6.3484 7.9355 15.8711 0.0091 Constraint 237 1402 3.7391 4.6739 9.3478 0.0091 Constraint 214 1402 4.9388 6.1735 12.3470 0.0091 Constraint 214 1395 6.0907 7.6134 15.2268 0.0091 Constraint 177 1395 6.1432 7.6790 15.3580 0.0091 Constraint 155 499 5.7066 7.1332 14.2664 0.0091 Constraint 141 309 5.0737 6.3421 12.6842 0.0091 Constraint 92 683 5.1879 6.4849 12.9698 0.0091 Constraint 92 674 3.5792 4.4740 8.9481 0.0091 Constraint 92 649 5.3633 6.7041 13.4082 0.0091 Constraint 92 464 6.3560 7.9449 15.8899 0.0091 Constraint 92 439 5.8568 7.3211 14.6421 0.0091 Constraint 84 297 5.5805 6.9756 13.9512 0.0091 Constraint 69 282 3.4982 4.3728 8.7455 0.0091 Constraint 69 185 4.7932 5.9915 11.9831 0.0091 Constraint 62 522 5.6604 7.0754 14.1509 0.0091 Constraint 602 951 5.3640 6.7050 13.4100 0.0091 Constraint 585 781 5.4987 6.8734 13.7469 0.0090 Constraint 618 728 5.8123 7.2654 14.5307 0.0089 Constraint 939 1095 5.6651 7.0814 14.1628 0.0089 Constraint 1201 1329 6.0972 7.6216 15.2431 0.0088 Constraint 1174 1329 4.6811 5.8514 11.7028 0.0088 Constraint 1174 1281 5.8264 7.2830 14.5661 0.0088 Constraint 915 1007 6.1835 7.7294 15.4588 0.0088 Constraint 915 990 5.0695 6.3369 12.6738 0.0088 Constraint 892 998 4.2958 5.3697 10.7394 0.0088 Constraint 864 1015 4.8376 6.0470 12.0939 0.0088 Constraint 852 998 6.0193 7.5241 15.0482 0.0088 Constraint 794 1051 4.2607 5.3259 10.6518 0.0088 Constraint 579 1095 4.7060 5.8825 11.7649 0.0088 Constraint 579 1087 5.7502 7.1877 14.3754 0.0088 Constraint 570 1039 5.2753 6.5941 13.1883 0.0088 Constraint 544 864 3.8552 4.8190 9.6379 0.0088 Constraint 532 1106 5.0519 6.3149 12.6297 0.0088 Constraint 522 1133 5.3483 6.6854 13.3708 0.0088 Constraint 488 1106 5.4593 6.8241 13.6481 0.0088 Constraint 472 660 4.8669 6.0836 12.1671 0.0088 Constraint 237 343 5.6477 7.0597 14.1194 0.0088 Constraint 168 488 3.7929 4.7411 9.4821 0.0088 Constraint 168 464 3.5197 4.3996 8.7992 0.0088 Constraint 168 455 3.6032 4.5040 9.0080 0.0088 Constraint 163 386 5.2977 6.6221 13.2443 0.0088 Constraint 163 257 6.3859 7.9824 15.9648 0.0088 Constraint 155 237 5.6953 7.1192 14.2384 0.0088 Constraint 148 362 5.4837 6.8547 13.7093 0.0088 Constraint 148 249 6.3835 7.9794 15.9588 0.0088 Constraint 148 237 3.7984 4.7480 9.4960 0.0088 Constraint 148 229 5.5707 6.9634 13.9268 0.0088 Constraint 141 282 6.2583 7.8228 15.6456 0.0088 Constraint 141 237 4.4227 5.5284 11.0567 0.0088 Constraint 141 229 4.0493 5.0616 10.1233 0.0088 Constraint 394 773 5.1949 6.4936 12.9873 0.0088 Constraint 649 1087 6.1703 7.7129 15.4258 0.0088 Constraint 602 1106 4.3589 5.4486 10.8972 0.0088 Constraint 602 1087 4.6169 5.7711 11.5422 0.0088 Constraint 464 660 5.3035 6.6294 13.2587 0.0088 Constraint 1318 1430 4.9239 6.1548 12.3097 0.0087 Constraint 1318 1413 3.6502 4.5627 9.1254 0.0087 Constraint 1318 1402 4.3545 5.4432 10.8863 0.0087 Constraint 1306 1451 6.2075 7.7594 15.5188 0.0087 Constraint 1306 1430 3.6522 4.5652 9.1305 0.0087 Constraint 1306 1421 3.9095 4.8869 9.7737 0.0087 Constraint 1306 1402 6.1428 7.6785 15.3570 0.0087 Constraint 1256 1430 5.2759 6.5949 13.1897 0.0087 Constraint 1051 1159 4.5718 5.7147 11.4295 0.0087 Constraint 683 900 5.4014 6.7518 13.5036 0.0087 Constraint 632 1087 6.2668 7.8336 15.6671 0.0087 Constraint 624 1106 5.0148 6.2685 12.5369 0.0087 Constraint 624 1024 5.8964 7.3705 14.7411 0.0087 Constraint 602 1186 4.1207 5.1508 10.3017 0.0087 Constraint 602 1159 6.1582 7.6977 15.3955 0.0087 Constraint 596 1133 3.8935 4.8669 9.7338 0.0087 Constraint 585 1186 5.0562 6.3203 12.6405 0.0087 Constraint 585 1133 3.4125 4.2657 8.5313 0.0087 Constraint 510 998 4.7838 5.9797 11.9594 0.0087 Constraint 499 1015 5.0681 6.3351 12.6702 0.0087 Constraint 472 1015 5.1605 6.4506 12.9013 0.0087 Constraint 464 900 5.7350 7.1688 14.3375 0.0087 Constraint 455 762 6.3449 7.9312 15.8624 0.0087 Constraint 455 649 4.4975 5.6218 11.2437 0.0087 Constraint 446 660 5.0006 6.2507 12.5015 0.0087 Constraint 446 649 5.7273 7.1591 14.3182 0.0087 Constraint 439 931 5.1436 6.4294 12.8589 0.0087 Constraint 439 924 2.8878 3.6097 7.2194 0.0087 Constraint 431 924 3.5739 4.4674 8.9348 0.0087 Constraint 417 924 6.3402 7.9252 15.8504 0.0087 Constraint 402 884 5.7117 7.1397 14.2793 0.0087 Constraint 1174 1272 5.4087 6.7609 13.5218 0.0086 Constraint 794 1159 4.6073 5.7591 11.5181 0.0086 Constraint 69 257 3.9667 4.9583 9.9166 0.0085 Constraint 62 266 3.8112 4.7640 9.5280 0.0085 Constraint 62 257 5.3132 6.6415 13.2831 0.0085 Constraint 944 1133 5.0232 6.2790 12.5579 0.0085 Constraint 833 1281 5.8899 7.3623 14.7247 0.0085 Constraint 674 981 6.1213 7.6517 15.3033 0.0085 Constraint 674 973 6.2150 7.7687 15.5374 0.0085 Constraint 632 967 6.0072 7.5090 15.0179 0.0085 Constraint 570 1288 3.6649 4.5811 9.1623 0.0085 Constraint 562 1288 4.0650 5.0812 10.1624 0.0085 Constraint 386 674 5.9796 7.4745 14.9490 0.0085 Constraint 373 472 4.8325 6.0406 12.0812 0.0085 Constraint 62 641 5.5787 6.9734 13.9467 0.0085 Constraint 46 551 3.7187 4.6483 9.2967 0.0085 Constraint 41 551 4.9009 6.1261 12.2523 0.0085 Constraint 864 1288 6.3834 7.9792 15.9584 0.0084 Constraint 789 884 5.8514 7.3142 14.6285 0.0084 Constraint 660 805 4.0158 5.0197 10.0394 0.0084 Constraint 632 805 4.2627 5.3283 10.6566 0.0084 Constraint 155 422 5.7724 7.2155 14.4310 0.0084 Constraint 92 155 6.0862 7.6077 15.2154 0.0084 Constraint 84 205 6.2653 7.8316 15.6631 0.0084 Constraint 84 168 6.3437 7.9296 15.8592 0.0084 Constraint 54 335 4.4498 5.5622 11.1245 0.0084 Constraint 46 237 5.0687 6.3358 12.6716 0.0084 Constraint 41 317 4.2759 5.3449 10.6898 0.0084 Constraint 579 1015 6.3048 7.8810 15.7620 0.0084 Constraint 967 1087 4.0531 5.0664 10.1328 0.0082 Constraint 967 1066 4.1490 5.1862 10.3724 0.0082 Constraint 716 814 5.9863 7.4829 14.9658 0.0082 Constraint 669 794 5.9362 7.4202 14.8405 0.0082 Constraint 610 1075 6.0926 7.6157 15.2315 0.0082 Constraint 562 1144 6.1811 7.7264 15.4528 0.0082 Constraint 386 1075 4.1310 5.1638 10.3276 0.0082 Constraint 386 1051 4.0637 5.0796 10.1593 0.0082 Constraint 373 1106 6.1963 7.7454 15.4907 0.0082 Constraint 373 967 4.8984 6.1231 12.2461 0.0082 Constraint 362 1095 4.3808 5.4760 10.9519 0.0082 Constraint 351 1124 5.9055 7.3818 14.7637 0.0082 Constraint 325 1144 5.0441 6.3051 12.6103 0.0082 Constraint 317 1144 4.0160 5.0200 10.0400 0.0082 Constraint 196 1144 6.1998 7.7498 15.4996 0.0082 Constraint 196 579 6.3654 7.9568 15.9135 0.0082 Constraint 196 325 4.3853 5.4817 10.9634 0.0082 Constraint 196 317 3.6988 4.6236 9.2471 0.0082 Constraint 185 1159 5.2489 6.5611 13.1221 0.0082 Constraint 185 1144 5.8710 7.3387 14.6774 0.0082 Constraint 185 1124 5.1954 6.4942 12.9884 0.0082 Constraint 185 579 5.1147 6.3934 12.7868 0.0082 Constraint 185 335 3.6693 4.5866 9.1731 0.0082 Constraint 185 317 6.2863 7.8578 15.7157 0.0082 Constraint 177 579 5.5172 6.8965 13.7930 0.0082 Constraint 163 1159 4.8179 6.0224 12.0447 0.0082 Constraint 141 841 6.1567 7.6959 15.3918 0.0082 Constraint 141 822 5.5106 6.8882 13.7764 0.0082 Constraint 742 892 6.0064 7.5079 15.0159 0.0081 Constraint 602 892 4.0672 5.0839 10.1679 0.0081 Constraint 62 141 4.3995 5.4994 10.9987 0.0081 Constraint 602 931 4.6092 5.7615 11.5231 0.0080 Constraint 214 472 5.9246 7.4058 14.8115 0.0079 Constraint 214 464 4.6292 5.7865 11.5730 0.0079 Constraint 205 464 4.3771 5.4714 10.9428 0.0079 Constraint 892 981 4.8514 6.0643 12.1285 0.0078 Constraint 728 814 5.6892 7.1115 14.2231 0.0078 Constraint 1031 1208 5.6775 7.0968 14.1937 0.0077 Constraint 362 884 3.0461 3.8076 7.6153 0.0075 Constraint 596 1087 5.3213 6.6516 13.3032 0.0074 Constraint 728 1015 4.5970 5.7462 11.4925 0.0074 Constraint 551 1015 6.0070 7.5088 15.0175 0.0074 Constraint 551 924 6.2146 7.7682 15.5364 0.0074 Constraint 488 756 5.8587 7.3234 14.6467 0.0074 Constraint 481 756 4.6324 5.7906 11.5811 0.0074 Constraint 431 773 5.9535 7.4419 14.8838 0.0074 Constraint 422 781 5.0381 6.2977 12.5954 0.0074 Constraint 422 773 3.1952 3.9940 7.9880 0.0074 Constraint 422 756 4.6760 5.8450 11.6900 0.0074 Constraint 422 742 5.7898 7.2372 14.4744 0.0074 Constraint 422 532 5.0802 6.3502 12.7004 0.0074 Constraint 422 510 4.6660 5.8325 11.6651 0.0074 Constraint 417 773 6.3779 7.9723 15.9447 0.0074 Constraint 417 742 4.5623 5.7029 11.4058 0.0074 Constraint 417 522 6.0392 7.5490 15.0979 0.0074 Constraint 417 510 5.0703 6.3378 12.6756 0.0074 Constraint 408 794 6.3883 7.9854 15.9708 0.0074 Constraint 408 742 4.8753 6.0941 12.1882 0.0074 Constraint 402 781 5.9290 7.4113 14.8225 0.0074 Constraint 402 762 4.2218 5.2773 10.5546 0.0074 Constraint 394 781 4.2390 5.2987 10.5974 0.0074 Constraint 394 532 4.0922 5.1153 10.2305 0.0074 Constraint 394 522 4.4615 5.5769 11.1539 0.0074 Constraint 386 579 2.9502 3.6878 7.3756 0.0074 Constraint 386 570 5.3513 6.6891 13.3782 0.0074 Constraint 380 998 4.5478 5.6847 11.3694 0.0074 Constraint 291 408 4.6437 5.8047 11.6093 0.0074 Constraint 291 402 5.1985 6.4982 12.9963 0.0074 Constraint 275 852 4.8908 6.1135 12.2270 0.0074 Constraint 275 841 3.5952 4.4940 8.9879 0.0074 Constraint 266 852 4.1553 5.1941 10.3881 0.0074 Constraint 266 841 5.9004 7.3755 14.7511 0.0074 Constraint 266 833 4.6510 5.8138 11.6275 0.0074 Constraint 257 871 6.3274 7.9093 15.8185 0.0074 Constraint 257 864 3.5627 4.4534 8.9067 0.0074 Constraint 257 852 4.9701 6.2126 12.4252 0.0074 Constraint 257 602 5.0433 6.3041 12.6083 0.0074 Constraint 249 884 5.8961 7.3702 14.7404 0.0074 Constraint 249 871 3.5054 4.3818 8.7635 0.0074 Constraint 249 864 5.0991 6.3738 12.7477 0.0074 Constraint 249 852 3.6918 4.6148 9.2296 0.0074 Constraint 249 649 6.2179 7.7723 15.5446 0.0074 Constraint 249 602 3.7245 4.6557 9.3113 0.0074 Constraint 237 951 4.6076 5.7595 11.5190 0.0074 Constraint 237 924 6.0779 7.5974 15.1949 0.0074 Constraint 237 884 4.2050 5.2562 10.5125 0.0074 Constraint 237 871 5.2278 6.5348 13.0695 0.0074 Constraint 237 674 4.6030 5.7537 11.5074 0.0074 Constraint 237 641 6.0684 7.5855 15.1710 0.0074 Constraint 229 951 6.0660 7.5826 15.1651 0.0074 Constraint 229 674 6.1210 7.6513 15.3026 0.0074 Constraint 214 871 6.2144 7.7680 15.5360 0.0074 Constraint 214 833 6.0772 7.5965 15.1931 0.0074 Constraint 214 351 5.0685 6.3356 12.6712 0.0074 Constraint 205 981 4.9806 6.2258 12.4516 0.0074 Constraint 205 973 5.6043 7.0053 14.0106 0.0074 Constraint 205 958 5.0806 6.3507 12.7014 0.0074 Constraint 205 951 4.4147 5.5183 11.0367 0.0074 Constraint 205 708 5.0197 6.2746 12.5491 0.0074 Constraint 205 700 5.7413 7.1766 14.3532 0.0074 Constraint 205 683 4.9678 6.2097 12.4194 0.0074 Constraint 177 1007 6.3429 7.9286 15.8571 0.0074 Constraint 177 981 5.0206 6.2757 12.5515 0.0074 Constraint 177 958 5.4283 6.7854 13.5708 0.0074 Constraint 177 728 6.2815 7.8518 15.7036 0.0074 Constraint 177 683 5.2759 6.5949 13.1898 0.0074 Constraint 177 570 6.1078 7.6347 15.2694 0.0074 Constraint 168 981 4.0897 5.1121 10.2243 0.0074 Constraint 168 708 4.0761 5.0951 10.1902 0.0074 Constraint 944 1031 6.3239 7.9049 15.8097 0.0074 Constraint 728 871 4.4790 5.5988 11.1976 0.0074 Constraint 499 864 5.9581 7.4477 14.8953 0.0074 Constraint 488 864 6.0875 7.6094 15.2188 0.0074 Constraint 488 852 6.1436 7.6795 15.3591 0.0074 Constraint 481 967 6.1528 7.6910 15.3821 0.0074 Constraint 472 624 5.7738 7.2172 14.4345 0.0074 Constraint 472 618 6.2735 7.8419 15.6838 0.0074 Constraint 472 610 4.4521 5.5652 11.1304 0.0074 Constraint 455 1015 6.0529 7.5662 15.1324 0.0074 Constraint 455 998 3.0499 3.8124 7.6248 0.0074 Constraint 455 990 6.1035 7.6294 15.2587 0.0074 Constraint 455 967 4.3991 5.4989 10.9977 0.0074 Constraint 446 998 5.4267 6.7834 13.5668 0.0074 Constraint 439 624 5.9378 7.4223 14.8446 0.0074 Constraint 431 1015 3.8223 4.7779 9.5559 0.0074 Constraint 408 683 4.3619 5.4524 10.9048 0.0074 Constraint 402 1015 5.1788 6.4735 12.9469 0.0074 Constraint 402 1007 2.0677 2.5847 5.1693 0.0074 Constraint 402 998 5.0118 6.2647 12.5295 0.0074 Constraint 394 1007 5.8727 7.3409 14.6817 0.0074 Constraint 386 1007 5.7405 7.1756 14.3512 0.0074 Constraint 380 1015 3.9531 4.9414 9.8828 0.0074 Constraint 380 708 4.9007 6.1259 12.2517 0.0074 Constraint 380 683 3.9634 4.9542 9.9084 0.0074 Constraint 373 716 4.2793 5.3492 10.6983 0.0074 Constraint 362 1031 4.8566 6.0708 12.1416 0.0074 Constraint 362 1024 6.2276 7.7845 15.5690 0.0074 Constraint 362 973 5.3537 6.6921 13.3841 0.0074 Constraint 362 852 4.0354 5.0443 10.0885 0.0074 Constraint 362 723 3.9667 4.9584 9.9168 0.0074 Constraint 362 683 5.4474 6.8093 13.6186 0.0074 Constraint 351 723 5.4474 6.8093 13.6185 0.0074 Constraint 343 884 5.2990 6.6238 13.2476 0.0074 Constraint 335 884 6.0379 7.5473 15.0947 0.0074 Constraint 335 871 3.6608 4.5760 9.1521 0.0074 Constraint 402 892 3.5834 4.4792 8.9584 0.0074 Constraint 1124 1288 4.4401 5.5501 11.1002 0.0073 Constraint 951 1124 5.5846 6.9808 13.9616 0.0072 Constraint 132 373 6.3103 7.8879 15.7757 0.0072 Constraint 1235 1421 5.9562 7.4452 14.8905 0.0072 Constraint 1235 1413 4.3039 5.3799 10.7598 0.0072 Constraint 1225 1421 4.8016 6.0020 12.0039 0.0072 Constraint 1225 1413 5.6316 7.0395 14.0791 0.0072 Constraint 1213 1421 5.4947 6.8683 13.7367 0.0072 Constraint 1201 1386 5.8811 7.3514 14.7027 0.0072 Constraint 1201 1381 4.4114 5.5142 11.0284 0.0072 Constraint 1192 1386 4.5604 5.7005 11.4010 0.0072 Constraint 1192 1381 5.6715 7.0894 14.1787 0.0072 Constraint 1186 1373 6.0871 7.6089 15.2177 0.0072 Constraint 1186 1362 4.2898 5.3622 10.7244 0.0072 Constraint 1174 1362 5.9394 7.4243 14.8486 0.0072 Constraint 1168 1373 4.8661 6.0826 12.1652 0.0072 Constraint 1168 1362 4.8246 6.0307 12.0615 0.0072 Constraint 1159 1362 5.1636 6.4545 12.9090 0.0072 Constraint 951 1168 6.0736 7.5919 15.1839 0.0072 Constraint 610 716 5.8408 7.3010 14.6020 0.0072 Constraint 585 1015 6.3449 7.9312 15.8623 0.0072 Constraint 532 973 6.3701 7.9627 15.9254 0.0072 Constraint 408 871 5.6928 7.1161 14.2321 0.0072 Constraint 380 446 3.8446 4.8057 9.6114 0.0072 Constraint 373 446 6.0644 7.5805 15.1610 0.0072 Constraint 275 446 6.1309 7.6637 15.3273 0.0072 Constraint 177 781 6.1129 7.6412 15.2823 0.0072 Constraint 155 773 5.7368 7.1710 14.3420 0.0072 Constraint 155 708 4.9202 6.1503 12.3006 0.0072 Constraint 544 852 3.8727 4.8408 9.6817 0.0070 Constraint 789 1186 5.6398 7.0498 14.0995 0.0070 Constraint 177 624 4.6333 5.7916 11.5831 0.0070 Constraint 624 700 4.9828 6.2285 12.4571 0.0068 Constraint 249 570 5.8736 7.3420 14.6839 0.0068 Constraint 124 297 5.6319 7.0399 14.0797 0.0068 Constraint 115 297 3.8460 4.8075 9.6151 0.0068 Constraint 92 297 5.0909 6.3637 12.7274 0.0068 Constraint 92 291 6.0281 7.5352 15.0703 0.0068 Constraint 649 907 5.7703 7.2129 14.4257 0.0065 Constraint 618 907 5.1621 6.4526 12.9052 0.0065 Constraint 196 728 4.4467 5.5584 11.1167 0.0065 Constraint 924 1208 4.6517 5.8146 11.6291 0.0064 Constraint 900 1208 5.2902 6.6127 13.2254 0.0064 Constraint 700 998 5.9147 7.3934 14.7868 0.0064 Constraint 691 822 5.3260 6.6576 13.3151 0.0064 Constraint 18 291 3.5937 4.4921 8.9843 0.0063 Constraint 822 1192 4.2571 5.3213 10.6426 0.0062 Constraint 499 884 6.0615 7.5769 15.1538 0.0062 Constraint 422 884 6.3124 7.8905 15.7810 0.0062 Constraint 408 900 5.5223 6.9029 13.8058 0.0062 Constraint 1201 1306 4.5037 5.6296 11.2592 0.0061 Constraint 864 990 5.8156 7.2695 14.5391 0.0061 Constraint 596 1095 4.9199 6.1498 12.2997 0.0061 Constraint 596 1106 5.6793 7.0991 14.1983 0.0061 Constraint 1015 1208 4.8948 6.1185 12.2370 0.0060 Constraint 1015 1186 6.3601 7.9501 15.9001 0.0060 Constraint 1015 1174 4.5145 5.6431 11.2863 0.0060 Constraint 833 1264 6.2000 7.7499 15.4999 0.0060 Constraint 814 1225 5.6355 7.0444 14.0887 0.0060 Constraint 814 1213 5.0251 6.2814 12.5628 0.0060 Constraint 585 1256 6.0768 7.5960 15.1919 0.0060 Constraint 570 649 4.3879 5.4849 10.9698 0.0060 Constraint 562 683 6.2598 7.8248 15.6496 0.0060 Constraint 551 683 5.2934 6.6167 13.2335 0.0060 Constraint 510 691 6.2757 7.8446 15.6892 0.0060 Constraint 510 683 4.7121 5.8902 11.7803 0.0060 Constraint 499 1381 3.7823 4.7278 9.4557 0.0060 Constraint 499 1373 4.2398 5.2998 10.5995 0.0060 Constraint 488 1373 6.0774 7.5968 15.1935 0.0060 Constraint 481 1373 6.3755 7.9693 15.9386 0.0060 Constraint 472 1395 4.5344 5.6680 11.3360 0.0060 Constraint 472 1386 6.1716 7.7145 15.4290 0.0060 Constraint 472 1381 5.3875 6.7344 13.4688 0.0060 Constraint 472 1373 5.3693 6.7117 13.4233 0.0060 Constraint 464 1395 4.4881 5.6101 11.2201 0.0060 Constraint 464 1381 4.4493 5.5616 11.1233 0.0060 Constraint 439 1413 5.9440 7.4300 14.8601 0.0060 Constraint 439 1402 5.8803 7.3504 14.7007 0.0060 Constraint 439 1395 2.9863 3.7329 7.4659 0.0060 Constraint 417 1413 6.1531 7.6913 15.3827 0.0060 Constraint 402 1421 6.3369 7.9211 15.8421 0.0060 Constraint 402 1413 4.0538 5.0673 10.1346 0.0060 Constraint 394 1413 5.5892 6.9865 13.9730 0.0060 Constraint 394 1402 6.3079 7.8849 15.7697 0.0060 Constraint 394 1395 5.0296 6.2870 12.5739 0.0060 Constraint 394 585 5.2278 6.5348 13.0696 0.0060 Constraint 386 1430 3.7509 4.6887 9.3773 0.0060 Constraint 386 1421 4.5514 5.6893 11.3785 0.0060 Constraint 386 1413 5.6058 7.0073 14.0146 0.0060 Constraint 386 1402 4.5031 5.6289 11.2577 0.0060 Constraint 386 1395 6.0183 7.5229 15.0458 0.0060 Constraint 380 1402 6.0119 7.5149 15.0299 0.0060 Constraint 380 1395 3.8018 4.7522 9.5044 0.0060 Constraint 380 1386 5.6708 7.0885 14.1770 0.0060 Constraint 380 1381 4.7476 5.9345 11.8689 0.0060 Constraint 373 1402 5.6005 7.0006 14.0013 0.0060 Constraint 373 1395 5.8135 7.2669 14.5338 0.0060 Constraint 373 1386 3.6024 4.5030 9.0059 0.0060 Constraint 373 1381 5.5468 6.9335 13.8670 0.0060 Constraint 373 551 5.2168 6.5210 13.0421 0.0060 Constraint 362 1386 5.1877 6.4847 12.9694 0.0060 Constraint 362 1381 3.2469 4.0587 8.1173 0.0060 Constraint 351 1386 6.2020 7.7525 15.5049 0.0060 Constraint 335 510 6.3280 7.9100 15.8199 0.0060 Constraint 309 1381 5.4441 6.8051 13.6102 0.0060 Constraint 309 1373 5.9776 7.4720 14.9439 0.0060 Constraint 275 1381 4.5289 5.6611 11.3222 0.0060 Constraint 266 789 6.0753 7.5941 15.1883 0.0060 Constraint 257 789 6.3522 7.9403 15.8805 0.0060 Constraint 249 814 4.4412 5.5515 11.1030 0.0060 Constraint 249 805 6.2224 7.7780 15.5560 0.0060 Constraint 249 794 5.2529 6.5661 13.1322 0.0060 Constraint 249 789 5.3783 6.7228 13.4456 0.0060 Constraint 249 464 5.0075 6.2594 12.5188 0.0060 Constraint 237 1244 6.3598 7.9497 15.8994 0.0060 Constraint 222 833 6.0154 7.5193 15.0385 0.0060 Constraint 222 822 5.9478 7.4348 14.8695 0.0060 Constraint 222 814 3.1323 3.9153 7.8307 0.0060 Constraint 205 1256 6.1441 7.6801 15.3603 0.0060 Constraint 196 833 6.3063 7.8829 15.7658 0.0060 Constraint 177 1264 5.9857 7.4821 14.9642 0.0060 Constraint 177 1256 5.4590 6.8238 13.6476 0.0060 Constraint 177 1066 5.8434 7.3043 14.6086 0.0060 Constraint 168 1066 5.9053 7.3816 14.7632 0.0060 Constraint 168 814 5.2065 6.5081 13.0162 0.0060 Constraint 163 852 3.7239 4.6549 9.3098 0.0060 Constraint 163 841 4.5690 5.7113 11.4226 0.0060 Constraint 163 833 5.6738 7.0922 14.1845 0.0060 Constraint 163 822 4.4636 5.5795 11.1590 0.0060 Constraint 163 814 6.1261 7.6577 15.3153 0.0060 Constraint 155 822 6.1030 7.6287 15.2574 0.0060 Constraint 155 814 4.0740 5.0925 10.1850 0.0060 Constraint 155 794 4.6854 5.8568 11.7135 0.0060 Constraint 148 822 5.6071 7.0089 14.0178 0.0060 Constraint 148 814 5.9386 7.4232 14.8465 0.0060 Constraint 148 805 3.6735 4.5918 9.1837 0.0060 Constraint 148 794 5.7213 7.1516 14.3032 0.0060 Constraint 141 805 5.3330 6.6663 13.3326 0.0060 Constraint 141 794 3.5791 4.4738 8.9477 0.0060 Constraint 132 805 6.1288 7.6611 15.3221 0.0060 Constraint 100 229 4.6711 5.8388 11.6776 0.0060 Constraint 92 794 5.5610 6.9512 13.9025 0.0060 Constraint 92 789 5.9616 7.4520 14.9039 0.0060 Constraint 92 249 5.6117 7.0146 14.0292 0.0060 Constraint 92 237 3.5925 4.4907 8.9814 0.0060 Constraint 92 229 5.6099 7.0124 14.0247 0.0060 Constraint 84 237 5.3896 6.7370 13.4739 0.0060 Constraint 84 229 3.6143 4.5178 9.0357 0.0060 Constraint 62 794 4.5477 5.6847 11.3694 0.0060 Constraint 54 944 6.1205 7.6506 15.3012 0.0060 Constraint 54 931 5.2099 6.5124 13.0248 0.0060 Constraint 380 884 5.2881 6.6101 13.2202 0.0059 Constraint 124 362 5.9310 7.4137 14.8274 0.0059 Constraint 115 373 4.0111 5.0138 10.0276 0.0059 Constraint 1201 1421 3.7106 4.6382 9.2765 0.0058 Constraint 1192 1451 5.6175 7.0218 14.0437 0.0058 Constraint 1087 1451 5.3807 6.7258 13.4516 0.0058 Constraint 1087 1168 6.3390 7.9238 15.8476 0.0058 Constraint 1075 1192 4.6818 5.8523 11.7045 0.0058 Constraint 1066 1430 5.6265 7.0332 14.0663 0.0058 Constraint 1066 1421 5.6440 7.0550 14.1099 0.0058 Constraint 1066 1402 3.9487 4.9359 9.8718 0.0058 Constraint 1066 1192 4.7844 5.9805 11.9611 0.0058 Constraint 1066 1186 5.9784 7.4730 14.9461 0.0058 Constraint 1051 1430 3.7133 4.6416 9.2832 0.0058 Constraint 1051 1402 4.6689 5.8361 11.6723 0.0058 Constraint 1031 1402 4.4533 5.5667 11.1334 0.0058 Constraint 1007 1430 5.8045 7.2556 14.5113 0.0058 Constraint 1007 1402 6.3852 7.9814 15.9629 0.0058 Constraint 967 1459 5.7925 7.2407 14.4813 0.0058 Constraint 958 1430 4.9828 6.2285 12.4570 0.0058 Constraint 939 1467 6.3635 7.9544 15.9087 0.0058 Constraint 939 1459 3.8604 4.8255 9.6510 0.0058 Constraint 939 1451 6.0171 7.5214 15.0428 0.0058 Constraint 924 1007 6.3330 7.9162 15.8325 0.0058 Constraint 907 1451 4.8566 6.0708 12.1416 0.0058 Constraint 907 1272 6.3154 7.8943 15.7886 0.0058 Constraint 907 1264 3.8205 4.7756 9.5512 0.0058 Constraint 773 1087 5.8010 7.2512 14.5024 0.0058 Constraint 756 1186 6.2147 7.7684 15.5368 0.0058 Constraint 742 1186 4.6361 5.7952 11.5903 0.0058 Constraint 522 939 5.1928 6.4910 12.9819 0.0058 Constraint 499 939 4.5098 5.6373 11.2746 0.0058 Constraint 488 939 4.0556 5.0695 10.1389 0.0058 Constraint 488 915 4.0404 5.0505 10.1010 0.0058 Constraint 464 939 5.9985 7.4981 14.9963 0.0058 Constraint 422 990 5.1309 6.4137 12.8273 0.0058 Constraint 380 1031 6.1862 7.7328 15.4656 0.0058 Constraint 351 1430 5.9934 7.4917 14.9835 0.0058 Constraint 335 1159 6.0743 7.5928 15.1857 0.0058 Constraint 214 439 5.0684 6.3355 12.6711 0.0058 Constraint 205 499 5.2505 6.5631 13.1262 0.0058 Constraint 177 472 5.3300 6.6625 13.3250 0.0058 Constraint 148 499 6.3606 7.9508 15.9015 0.0058 Constraint 522 789 5.5740 6.9675 13.9351 0.0058 Constraint 522 781 6.2893 7.8616 15.7232 0.0058 Constraint 691 944 6.2872 7.8591 15.7181 0.0056 Constraint 1150 1318 3.8872 4.8590 9.7181 0.0056 Constraint 1150 1306 5.4294 6.7867 13.5734 0.0056 Constraint 1150 1295 4.8167 6.0208 12.0417 0.0056 Constraint 1144 1339 5.1370 6.4213 12.8426 0.0056 Constraint 1144 1318 6.3529 7.9411 15.8821 0.0056 Constraint 1144 1306 4.8523 6.0654 12.1308 0.0056 Constraint 1144 1295 6.3161 7.8951 15.7902 0.0056 Constraint 1133 1306 5.5030 6.8788 13.7575 0.0056 Constraint 1133 1295 3.6521 4.5652 9.1303 0.0056 Constraint 1133 1281 4.9901 6.2376 12.4752 0.0056 Constraint 1124 1362 3.8486 4.8108 9.6215 0.0056 Constraint 1124 1306 5.0164 6.2706 12.5411 0.0056 Constraint 1106 1288 6.0409 7.5512 15.1023 0.0056 Constraint 1106 1272 4.2429 5.3036 10.6073 0.0056 Constraint 1095 1272 6.0645 7.5807 15.1614 0.0056 Constraint 1087 1272 5.5543 6.9428 13.8857 0.0056 Constraint 1051 1272 4.7557 5.9446 11.8891 0.0056 Constraint 579 958 4.9503 6.1879 12.3757 0.0056 Constraint 510 852 5.0189 6.2736 12.5473 0.0056 Constraint 472 814 5.5515 6.9394 13.8788 0.0056 Constraint 386 596 5.3978 6.7473 13.4945 0.0053 Constraint 373 944 5.2479 6.5599 13.1197 0.0053 Constraint 351 683 5.9570 7.4463 14.8925 0.0053 Constraint 1039 1159 5.1221 6.4026 12.8053 0.0051 Constraint 1039 1150 6.3924 7.9905 15.9810 0.0051 Constraint 1031 1150 5.3201 6.6501 13.3002 0.0051 Constraint 998 1256 4.5059 5.6323 11.2647 0.0051 Constraint 683 1106 4.8175 6.0219 12.0438 0.0051 Constraint 683 1095 4.3047 5.3809 10.7618 0.0051 Constraint 674 1095 4.7773 5.9716 11.9432 0.0051 Constraint 632 1106 4.9761 6.2202 12.4404 0.0051 Constraint 632 716 3.4039 4.2549 8.5098 0.0051 Constraint 632 708 6.2751 7.8439 15.6878 0.0051 Constraint 624 998 4.9404 6.1755 12.3510 0.0051 Constraint 618 998 6.0643 7.5804 15.1609 0.0051 Constraint 618 990 4.9535 6.1919 12.3838 0.0051 Constraint 610 973 6.3771 7.9714 15.9428 0.0051 Constraint 602 981 3.1589 3.9487 7.8973 0.0051 Constraint 532 951 4.1233 5.1541 10.3082 0.0051 Constraint 522 967 6.3407 7.9259 15.8518 0.0051 Constraint 499 967 4.9588 6.1985 12.3970 0.0051 Constraint 422 723 4.4708 5.5886 11.1771 0.0051 Constraint 422 716 4.7876 5.9845 11.9689 0.0051 Constraint 417 716 4.0349 5.0436 10.0872 0.0051 Constraint 417 700 6.2726 7.8407 15.6815 0.0051 Constraint 417 624 5.9796 7.4745 14.9490 0.0051 Constraint 402 716 5.2250 6.5312 13.0624 0.0051 Constraint 402 708 5.4918 6.8647 13.7295 0.0051 Constraint 402 691 4.7478 5.9348 11.8696 0.0051 Constraint 394 716 4.3353 5.4191 10.8382 0.0051 Constraint 373 990 6.3881 7.9851 15.9702 0.0051 Constraint 351 973 6.2970 7.8712 15.7425 0.0051 Constraint 214 532 6.3227 7.9034 15.8068 0.0051 Constraint 177 325 4.3549 5.4437 10.8873 0.0051 Constraint 148 455 6.0195 7.5244 15.0487 0.0051 Constraint 990 1201 5.5251 6.9063 13.8127 0.0049 Constraint 990 1192 5.5697 6.9622 13.9244 0.0049 Constraint 990 1168 2.1503 2.6879 5.3759 0.0049 Constraint 981 1244 5.0122 6.2652 12.5304 0.0049 Constraint 981 1201 3.1532 3.9415 7.8829 0.0049 Constraint 939 1007 4.2274 5.2842 10.5684 0.0049 Constraint 907 1087 6.0048 7.5060 15.0120 0.0049 Constraint 907 1031 4.1390 5.1737 10.3474 0.0049 Constraint 892 1051 5.5724 6.9655 13.9310 0.0049 Constraint 822 1225 5.4147 6.7683 13.5367 0.0049 Constraint 822 1213 5.1421 6.4276 12.8551 0.0049 Constraint 822 1144 5.9217 7.4021 14.8042 0.0049 Constraint 822 1133 5.5799 6.9749 13.9497 0.0049 Constraint 814 1201 5.0828 6.3535 12.7069 0.0049 Constraint 814 1192 5.8080 7.2601 14.5201 0.0049 Constraint 814 1144 6.2914 7.8643 15.7286 0.0049 Constraint 814 1133 3.2196 4.0245 8.0490 0.0049 Constraint 805 1225 5.4999 6.8749 13.7498 0.0049 Constraint 805 1213 5.1033 6.3791 12.7583 0.0049 Constraint 805 1186 5.3474 6.6842 13.3685 0.0049 Constraint 805 1168 3.5951 4.4938 8.9877 0.0049 Constraint 805 1124 3.4334 4.2917 8.5835 0.0049 Constraint 805 1007 6.1195 7.6494 15.2988 0.0049 Constraint 794 1174 3.7405 4.6756 9.3513 0.0049 Constraint 794 1124 3.5617 4.4522 8.9043 0.0049 Constraint 794 1106 6.0929 7.6161 15.2321 0.0049 Constraint 794 1095 5.1128 6.3910 12.7820 0.0049 Constraint 789 1192 3.5321 4.4151 8.8303 0.0049 Constraint 789 1174 6.1091 7.6364 15.2728 0.0049 Constraint 789 1144 3.4330 4.2913 8.5826 0.0049 Constraint 789 1133 4.4750 5.5938 11.1876 0.0049 Constraint 781 1192 6.3741 7.9676 15.9353 0.0049 Constraint 781 1159 5.0998 6.3747 12.7495 0.0049 Constraint 781 1133 5.0472 6.3090 12.6180 0.0049 Constraint 773 1174 5.8136 7.2670 14.5339 0.0049 Constraint 773 1133 4.8939 6.1174 12.2348 0.0049 Constraint 762 1168 5.7433 7.1791 14.3582 0.0049 Constraint 756 1174 5.6935 7.1168 14.2336 0.0049 Constraint 756 1168 4.9322 6.1652 12.3305 0.0049 Constraint 266 380 5.4197 6.7746 13.5492 0.0049 Constraint 257 394 3.9497 4.9371 9.8742 0.0049 Constraint 222 632 5.8851 7.3563 14.7127 0.0049 Constraint 222 624 4.1599 5.1999 10.3998 0.0049 Constraint 214 632 4.6212 5.7765 11.5530 0.0049 Constraint 214 624 5.9265 7.4082 14.8164 0.0049 Constraint 205 632 6.3149 7.8936 15.7873 0.0049 Constraint 205 624 4.0381 5.0476 10.0951 0.0049 Constraint 196 624 6.0688 7.5860 15.1720 0.0049 Constraint 185 624 6.2674 7.8342 15.6685 0.0049 Constraint 185 257 5.4651 6.8314 13.6629 0.0049 Constraint 92 579 3.6539 4.5674 9.1347 0.0049 Constraint 84 579 5.3047 6.6308 13.2616 0.0049 Constraint 716 841 4.6596 5.8244 11.6489 0.0048 Constraint 951 1192 4.9463 6.1829 12.3658 0.0047 Constraint 924 1201 4.9642 6.2052 12.4105 0.0047 Constraint 915 1192 6.0358 7.5448 15.0895 0.0047 Constraint 884 1213 6.1114 7.6393 15.2786 0.0047 Constraint 884 1208 6.1894 7.7368 15.4736 0.0047 Constraint 762 884 4.6240 5.7801 11.5601 0.0047 Constraint 762 852 5.5452 6.9315 13.8630 0.0047 Constraint 742 998 5.6421 7.0526 14.1051 0.0047 Constraint 728 1168 5.9974 7.4967 14.9935 0.0047 Constraint 728 1159 2.9326 3.6658 7.3316 0.0047 Constraint 728 1150 2.1037 2.6297 5.2593 0.0047 Constraint 728 1144 4.9465 6.1832 12.3663 0.0047 Constraint 723 1174 6.3010 7.8762 15.7524 0.0047 Constraint 723 1150 4.2077 5.2596 10.5191 0.0047 Constraint 716 1174 3.1218 3.9023 7.8046 0.0047 Constraint 716 1168 4.6198 5.7747 11.5495 0.0047 Constraint 691 1174 6.3359 7.9199 15.8397 0.0047 Constraint 691 1168 6.2887 7.8609 15.7218 0.0047 Constraint 691 1150 4.2021 5.2526 10.5052 0.0047 Constraint 691 1144 4.3162 5.3952 10.7904 0.0047 Constraint 691 852 5.5474 6.9342 13.8684 0.0047 Constraint 691 841 5.6361 7.0451 14.0901 0.0047 Constraint 618 781 5.0617 6.3271 12.6543 0.0047 Constraint 618 773 6.3194 7.8992 15.7984 0.0047 Constraint 618 762 3.9178 4.8973 9.7946 0.0047 Constraint 610 1144 5.0447 6.3059 12.6118 0.0047 Constraint 610 756 5.1922 6.4903 12.9806 0.0047 Constraint 610 723 3.6615 4.5769 9.1539 0.0047 Constraint 602 900 5.9231 7.4038 14.8077 0.0047 Constraint 596 1201 4.6153 5.7691 11.5382 0.0047 Constraint 596 1174 5.9022 7.3778 14.7556 0.0047 Constraint 596 1168 5.8898 7.3622 14.7244 0.0047 Constraint 596 892 5.1989 6.4986 12.9972 0.0047 Constraint 585 981 4.7685 5.9607 11.9213 0.0047 Constraint 585 892 3.0845 3.8556 7.7112 0.0047 Constraint 579 939 6.2277 7.7847 15.5693 0.0047 Constraint 570 1075 6.3942 7.9927 15.9855 0.0047 Constraint 562 981 3.1686 3.9607 7.9215 0.0047 Constraint 562 900 4.8054 6.0067 12.0135 0.0047 Constraint 562 892 5.6048 7.0060 14.0119 0.0047 Constraint 551 1075 4.2757 5.3446 10.6892 0.0047 Constraint 544 1075 6.3967 7.9958 15.9917 0.0047 Constraint 544 981 6.0443 7.5554 15.1107 0.0047 Constraint 532 981 5.3436 6.6794 13.3589 0.0047 Constraint 532 728 5.6986 7.1232 14.2464 0.0047 Constraint 532 723 5.4713 6.8391 13.6782 0.0047 Constraint 522 691 4.7720 5.9650 11.9299 0.0047 Constraint 481 762 5.9950 7.4937 14.9874 0.0047 Constraint 446 762 6.0064 7.5080 15.0159 0.0047 Constraint 439 762 3.9611 4.9514 9.9029 0.0047 Constraint 431 728 6.3575 7.9469 15.8937 0.0047 Constraint 417 551 5.6988 7.1235 14.2470 0.0047 Constraint 402 488 4.4107 5.5134 11.0269 0.0047 Constraint 373 522 6.2532 7.8165 15.6329 0.0047 Constraint 309 446 6.2971 7.8714 15.7428 0.0047 Constraint 309 422 3.0256 3.7820 7.5641 0.0047 Constraint 309 408 6.0197 7.5247 15.0494 0.0047 Constraint 309 402 4.2695 5.3368 10.6737 0.0047 Constraint 237 1066 5.1156 6.3945 12.7890 0.0047 Constraint 237 1051 5.4199 6.7749 13.5498 0.0047 Constraint 222 362 4.0086 5.0108 10.0215 0.0047 Constraint 214 1051 3.1671 3.9589 7.9178 0.0047 Constraint 214 1039 6.1805 7.7256 15.4513 0.0047 Constraint 214 1031 4.9666 6.2083 12.4166 0.0047 Constraint 205 1075 2.0507 2.5634 5.1267 0.0047 Constraint 205 1066 5.1144 6.3930 12.7859 0.0047 Constraint 196 1075 6.1065 7.6331 15.2662 0.0047 Constraint 185 1051 5.8723 7.3404 14.6807 0.0047 Constraint 177 1075 5.1618 6.4522 12.9044 0.0047 Constraint 177 1039 6.1805 7.7256 15.4513 0.0047 Constraint 168 1051 3.3200 4.1499 8.2999 0.0047 Constraint 141 1051 5.8703 7.3379 14.6758 0.0047 Constraint 973 1106 6.2310 7.7887 15.5775 0.0046 Constraint 967 1106 4.5695 5.7119 11.4238 0.0046 Constraint 892 967 5.5859 6.9824 13.9648 0.0046 Constraint 728 981 6.3009 7.8761 15.7522 0.0046 Constraint 728 973 3.9654 4.9568 9.9135 0.0046 Constraint 728 967 6.3150 7.8937 15.7875 0.0046 Constraint 723 973 5.4254 6.7818 13.5636 0.0046 Constraint 723 967 3.6186 4.5233 9.0466 0.0046 Constraint 723 958 5.2271 6.5339 13.0677 0.0046 Constraint 723 951 4.5063 5.6328 11.2657 0.0046 Constraint 716 973 5.6371 7.0464 14.0927 0.0046 Constraint 716 958 4.1674 5.2093 10.4185 0.0046 Constraint 716 951 5.9835 7.4793 14.9587 0.0046 Constraint 700 951 5.4495 6.8119 13.6239 0.0046 Constraint 544 1031 4.9367 6.1708 12.3416 0.0046 Constraint 544 1024 6.1749 7.7187 15.4374 0.0046 Constraint 522 814 3.9565 4.9457 9.8913 0.0046 Constraint 386 669 5.2201 6.5251 13.0502 0.0046 Constraint 297 544 5.0444 6.3055 12.6111 0.0046 Constraint 282 544 5.3221 6.6526 13.3053 0.0046 Constraint 92 205 5.6010 7.0013 14.0025 0.0046 Constraint 69 237 5.5620 6.9526 13.9051 0.0046 Constraint 69 205 5.2873 6.6091 13.2182 0.0046 Constraint 669 773 5.1867 6.4834 12.9668 0.0045 Constraint 177 841 4.5361 5.6701 11.3403 0.0045 Constraint 1225 1306 4.5091 5.6364 11.2728 0.0044 Constraint 1208 1295 6.3792 7.9740 15.9480 0.0044 Constraint 1192 1306 6.2021 7.7526 15.5053 0.0044 Constraint 1192 1295 5.7444 7.1806 14.3611 0.0044 Constraint 1186 1295 2.9660 3.7075 7.4150 0.0044 Constraint 1186 1288 6.0463 7.5579 15.1158 0.0044 Constraint 1174 1295 5.6973 7.1216 14.2432 0.0044 Constraint 1174 1288 5.0577 6.3221 12.6442 0.0044 Constraint 1168 1329 4.7143 5.8929 11.7858 0.0044 Constraint 1168 1306 5.6203 7.0254 14.0508 0.0044 Constraint 1168 1281 3.9598 4.9497 9.8995 0.0044 Constraint 1168 1272 5.6602 7.0753 14.1505 0.0044 Constraint 1159 1354 6.1695 7.7119 15.4238 0.0044 Constraint 1159 1339 5.9794 7.4742 14.9484 0.0044 Constraint 1159 1281 4.3798 5.4748 10.9496 0.0044 Constraint 1159 1272 3.6602 4.5753 9.1506 0.0044 Constraint 1150 1354 5.2825 6.6032 13.2063 0.0044 Constraint 1150 1347 4.4253 5.5316 11.0632 0.0044 Constraint 1150 1339 5.6685 7.0856 14.1712 0.0044 Constraint 1150 1329 3.9435 4.9293 9.8587 0.0044 Constraint 1150 1272 6.0924 7.6155 15.2311 0.0044 Constraint 973 1095 5.5885 6.9856 13.9712 0.0044 Constraint 900 998 6.3522 7.9403 15.8806 0.0044 Constraint 900 990 3.8487 4.8109 9.6218 0.0044 Constraint 892 1066 5.8337 7.2921 14.5842 0.0044 Constraint 884 1051 5.5745 6.9681 13.9362 0.0044 Constraint 864 1373 6.0511 7.5639 15.1278 0.0044 Constraint 852 1373 3.6112 4.5140 9.0281 0.0044 Constraint 852 1362 6.0960 7.6200 15.2400 0.0044 Constraint 841 1373 5.3172 6.6466 13.2931 0.0044 Constraint 833 1373 4.6020 5.7525 11.5050 0.0044 Constraint 814 1159 4.3012 5.3765 10.7530 0.0044 Constraint 756 1066 6.0407 7.5509 15.1018 0.0044 Constraint 742 1087 5.9600 7.4500 14.9001 0.0044 Constraint 742 1066 3.7757 4.7196 9.4392 0.0044 Constraint 728 1066 4.8564 6.0705 12.1410 0.0044 Constraint 674 1159 6.0955 7.6194 15.2388 0.0044 Constraint 632 794 5.3356 6.6695 13.3389 0.0044 Constraint 632 789 4.6876 5.8595 11.7189 0.0044 Constraint 624 1066 3.6695 4.5869 9.1739 0.0044 Constraint 618 1150 4.8866 6.1083 12.2166 0.0044 Constraint 618 1144 3.1340 3.9176 7.8351 0.0044 Constraint 618 1133 4.1374 5.1718 10.3436 0.0044 Constraint 618 1066 5.3436 6.6795 13.3590 0.0044 Constraint 618 789 4.4939 5.6174 11.2349 0.0044 Constraint 602 1075 4.4269 5.5336 11.0672 0.0044 Constraint 602 944 3.0163 3.7704 7.5407 0.0044 Constraint 602 924 3.9497 4.9371 9.8742 0.0044 Constraint 602 915 6.1557 7.6947 15.3893 0.0044 Constraint 585 1362 5.6262 7.0328 14.0656 0.0044 Constraint 585 1087 4.4988 5.6235 11.2469 0.0044 Constraint 585 1075 4.4504 5.5630 11.1261 0.0044 Constraint 585 1031 5.3215 6.6518 13.3036 0.0044 Constraint 585 915 6.0591 7.5739 15.1478 0.0044 Constraint 585 884 5.4775 6.8469 13.6937 0.0044 Constraint 579 1106 6.0059 7.5074 15.0148 0.0044 Constraint 579 915 6.0989 7.6236 15.2472 0.0044 Constraint 570 1133 4.4399 5.5498 11.0996 0.0044 Constraint 570 1106 4.6207 5.7759 11.5518 0.0044 Constraint 570 1095 6.0802 7.6002 15.2005 0.0044 Constraint 562 1133 4.8851 6.1063 12.2126 0.0044 Constraint 562 1124 4.3792 5.4740 10.9479 0.0044 Constraint 562 1106 5.2983 6.6229 13.2458 0.0044 Constraint 562 1095 4.7891 5.9864 11.9728 0.0044 Constraint 562 924 5.4245 6.7806 13.5612 0.0044 Constraint 544 833 4.5344 5.6679 11.3359 0.0044 Constraint 532 1124 4.9851 6.2314 12.4628 0.0044 Constraint 532 841 5.4389 6.7986 13.5972 0.0044 Constraint 532 833 6.3148 7.8934 15.7869 0.0044 Constraint 532 822 5.3623 6.7029 13.4058 0.0044 Constraint 522 841 5.8807 7.3509 14.7018 0.0044 Constraint 522 762 5.3620 6.7025 13.4049 0.0044 Constraint 522 756 4.6414 5.8017 11.6035 0.0044 Constraint 522 742 5.2149 6.5186 13.0371 0.0044 Constraint 522 728 5.5940 6.9925 13.9851 0.0044 Constraint 515 900 6.3344 7.9180 15.8360 0.0044 Constraint 515 814 6.0166 7.5208 15.0415 0.0044 Constraint 515 805 4.7794 5.9742 11.9484 0.0044 Constraint 515 756 4.6293 5.7866 11.5732 0.0044 Constraint 515 742 3.5645 4.4556 8.9112 0.0044 Constraint 510 632 3.9788 4.9735 9.9469 0.0044 Constraint 510 624 5.5790 6.9738 13.9475 0.0044 Constraint 510 618 3.9955 4.9944 9.9888 0.0044 Constraint 488 1124 5.3772 6.7215 13.4430 0.0044 Constraint 488 660 4.0539 5.0674 10.1347 0.0044 Constraint 488 624 5.1438 6.4298 12.8596 0.0044 Constraint 481 660 5.3786 6.7232 13.4465 0.0044 Constraint 481 632 4.8278 6.0347 12.0694 0.0044 Constraint 472 632 4.4806 5.6008 11.2016 0.0044 Constraint 464 1095 4.8397 6.0496 12.0993 0.0044 Constraint 455 691 5.3339 6.6674 13.3348 0.0044 Constraint 455 683 4.7688 5.9610 11.9220 0.0044 Constraint 446 742 6.3257 7.9071 15.8142 0.0044 Constraint 446 683 4.3600 5.4500 10.8999 0.0044 Constraint 394 481 5.6182 7.0228 14.0456 0.0044 Constraint 394 472 3.7385 4.6731 9.3462 0.0044 Constraint 386 481 4.4911 5.6139 11.2278 0.0044 Constraint 373 510 5.0679 6.3349 12.6697 0.0044 Constraint 373 499 5.6711 7.0889 14.1779 0.0044 Constraint 362 481 4.1779 5.2224 10.4449 0.0044 Constraint 335 515 5.5004 6.8755 13.7509 0.0044 Constraint 237 335 5.7351 7.1689 14.3378 0.0044 Constraint 229 373 5.4065 6.7581 13.5163 0.0044 Constraint 229 335 5.2149 6.5186 13.0373 0.0044 Constraint 205 373 3.6665 4.5832 9.1664 0.0044 Constraint 205 335 5.4733 6.8417 13.6834 0.0044 Constraint 196 402 5.9602 7.4503 14.9006 0.0044 Constraint 196 394 5.9124 7.3905 14.7810 0.0044 Constraint 196 373 3.6155 4.5194 9.0388 0.0044 Constraint 177 373 5.9149 7.3937 14.7873 0.0044 Constraint 132 229 6.1324 7.6655 15.3310 0.0044 Constraint 1264 1347 6.3138 7.8922 15.7844 0.0044 Constraint 1256 1339 3.1413 3.9266 7.8532 0.0044 Constraint 1225 1402 5.5330 6.9162 13.8324 0.0044 Constraint 1225 1381 5.6382 7.0478 14.0955 0.0044 Constraint 1213 1402 5.4648 6.8309 13.6619 0.0044 Constraint 1192 1413 5.7500 7.1875 14.3749 0.0044 Constraint 1144 1430 6.3377 7.9221 15.8443 0.0044 Constraint 1087 1421 6.0225 7.5281 15.0562 0.0044 Constraint 1087 1395 4.5940 5.7425 11.4850 0.0044 Constraint 1075 1451 5.5499 6.9374 13.8749 0.0044 Constraint 1075 1421 3.8225 4.7781 9.5562 0.0044 Constraint 1075 1395 6.1221 7.6526 15.3052 0.0044 Constraint 1066 1451 4.8007 6.0008 12.0016 0.0044 Constraint 773 871 6.1300 7.6626 15.3251 0.0044 Constraint 773 852 5.3763 6.7203 13.4406 0.0044 Constraint 691 1347 6.3319 7.9149 15.8298 0.0044 Constraint 691 1339 4.8511 6.0638 12.1276 0.0044 Constraint 691 1318 4.9493 6.1866 12.3732 0.0044 Constraint 691 1288 6.2902 7.8627 15.7255 0.0044 Constraint 691 1281 5.9728 7.4660 14.9321 0.0044 Constraint 691 1272 4.1000 5.1250 10.2500 0.0044 Constraint 691 900 6.3506 7.9382 15.8765 0.0044 Constraint 691 892 5.1091 6.3864 12.7728 0.0044 Constraint 683 1402 5.0238 6.2798 12.5596 0.0044 Constraint 683 1339 3.1413 3.9266 7.8532 0.0044 Constraint 683 1318 4.0411 5.0514 10.1029 0.0044 Constraint 683 892 3.3222 4.1527 8.3055 0.0044 Constraint 674 1281 5.1661 6.4576 12.9153 0.0044 Constraint 669 1281 5.6178 7.0223 14.0446 0.0044 Constraint 669 1272 3.6990 4.6237 9.2475 0.0044 Constraint 660 1402 5.5421 6.9276 13.8553 0.0044 Constraint 660 1381 5.6471 7.0589 14.1179 0.0044 Constraint 660 1339 6.0967 7.6209 15.2417 0.0044 Constraint 660 1272 5.8443 7.3054 14.6107 0.0044 Constraint 649 1402 5.4440 6.8050 13.6100 0.0044 Constraint 649 958 5.7564 7.1955 14.3911 0.0044 Constraint 641 1395 5.7216 7.1520 14.3041 0.0044 Constraint 641 1386 4.2547 5.3184 10.6368 0.0044 Constraint 641 1381 6.3203 7.9003 15.8007 0.0044 Constraint 641 1347 4.7218 5.9022 11.8045 0.0044 Constraint 632 1386 5.4230 6.7787 13.5575 0.0044 Constraint 624 1413 5.9213 7.4017 14.8034 0.0044 Constraint 624 1402 6.3339 7.9173 15.8347 0.0044 Constraint 624 1031 5.8095 7.2619 14.5238 0.0044 Constraint 624 958 6.0180 7.5226 15.0451 0.0044 Constraint 618 1421 4.7285 5.9107 11.8213 0.0044 Constraint 618 1395 3.2532 4.0665 8.1331 0.0044 Constraint 618 1386 3.5928 4.4910 8.9820 0.0044 Constraint 618 1347 5.8084 7.2606 14.5211 0.0044 Constraint 618 1106 6.0942 7.6177 15.2354 0.0044 Constraint 618 1075 5.8547 7.3184 14.6368 0.0044 Constraint 610 1395 4.3542 5.4428 10.8856 0.0044 Constraint 610 1347 5.1306 6.4133 12.8266 0.0044 Constraint 610 1329 5.2827 6.6034 13.2068 0.0044 Constraint 610 1087 4.4988 5.6235 11.2470 0.0044 Constraint 602 1430 5.9972 7.4965 14.9930 0.0044 Constraint 602 1395 4.0821 5.1027 10.2054 0.0044 Constraint 602 1339 5.9145 7.3931 14.7863 0.0044 Constraint 602 1329 5.3212 6.6515 13.3030 0.0044 Constraint 596 1329 2.7798 3.4747 6.9494 0.0044 Constraint 585 1124 3.6958 4.6198 9.2395 0.0044 Constraint 579 1329 5.8657 7.3321 14.6643 0.0044 Constraint 579 1306 4.6324 5.7905 11.5811 0.0044 Constraint 570 1306 6.1444 7.6805 15.3609 0.0044 Constraint 551 1106 3.5235 4.4044 8.8089 0.0044 Constraint 551 1095 5.1849 6.4811 12.9622 0.0044 Constraint 544 1106 5.7924 7.2405 14.4809 0.0044 Constraint 544 1095 4.1184 5.1481 10.2961 0.0044 Constraint 544 1039 5.6024 7.0030 14.0060 0.0044 Constraint 532 1329 5.6175 7.0219 14.0439 0.0044 Constraint 522 1329 5.7301 7.1626 14.3253 0.0044 Constraint 510 1144 5.6318 7.0398 14.0795 0.0044 Constraint 510 1124 2.8772 3.5966 7.1931 0.0044 Constraint 510 1015 5.8374 7.2967 14.5934 0.0044 Constraint 499 1124 4.8440 6.0550 12.1099 0.0044 Constraint 499 1095 5.4416 6.8021 13.6041 0.0044 Constraint 481 1124 6.1554 7.6943 15.3885 0.0044 Constraint 472 1459 4.7618 5.9523 11.9046 0.0044 Constraint 472 1124 4.3625 5.4531 10.9062 0.0044 Constraint 464 1459 5.6047 7.0058 14.0117 0.0044 Constraint 464 1430 4.8209 6.0262 12.0523 0.0044 Constraint 464 1402 6.2623 7.8279 15.6558 0.0044 Constraint 464 958 5.9805 7.4757 14.9514 0.0044 Constraint 455 833 3.7202 4.6502 9.3005 0.0044 Constraint 446 852 5.7752 7.2190 14.4381 0.0044 Constraint 446 841 4.7939 5.9923 11.9847 0.0044 Constraint 446 833 4.6819 5.8524 11.7048 0.0044 Constraint 439 1459 4.9078 6.1347 12.2694 0.0044 Constraint 439 1451 5.2394 6.5493 13.0985 0.0044 Constraint 439 1430 4.4640 5.5799 11.1599 0.0044 Constraint 439 1007 5.3877 6.7347 13.4693 0.0044 Constraint 439 900 4.0778 5.0972 10.1945 0.0044 Constraint 439 884 6.1054 7.6317 15.2635 0.0044 Constraint 439 871 5.5850 6.9813 13.9626 0.0044 Constraint 431 1430 5.7160 7.1449 14.2899 0.0044 Constraint 431 915 5.1328 6.4160 12.8320 0.0044 Constraint 408 1430 6.3951 7.9938 15.9877 0.0044 Constraint 362 1421 5.9989 7.4986 14.9971 0.0044 Constraint 362 1395 4.5891 5.7364 11.4727 0.0044 Constraint 351 864 4.0032 5.0040 10.0079 0.0044 Constraint 351 781 6.1711 7.7138 15.4276 0.0044 Constraint 343 1451 5.5997 6.9996 13.9992 0.0044 Constraint 343 1430 5.6275 7.0344 14.0688 0.0044 Constraint 343 900 5.2145 6.5182 13.0363 0.0044 Constraint 325 981 6.3285 7.9107 15.8213 0.0044 Constraint 282 773 6.3497 7.9371 15.8743 0.0044 Constraint 266 515 6.1810 7.7263 15.4526 0.0044 Constraint 237 570 6.2691 7.8364 15.6728 0.0044 Constraint 237 562 3.4680 4.3350 8.6700 0.0044 Constraint 237 551 5.7515 7.1894 14.3789 0.0044 Constraint 222 756 3.6725 4.5907 9.1813 0.0044 Constraint 214 649 5.7238 7.1547 14.3094 0.0044 Constraint 205 570 5.7684 7.2105 14.4209 0.0044 Constraint 205 562 5.7119 7.1399 14.2799 0.0044 Constraint 196 756 5.5046 6.8808 13.7615 0.0044 Constraint 185 756 5.7654 7.2067 14.4134 0.0044 Constraint 185 691 6.3694 7.9617 15.9234 0.0044 Constraint 669 973 5.9772 7.4715 14.9431 0.0042 Constraint 562 1295 4.1674 5.2092 10.4184 0.0042 Constraint 446 700 5.6279 7.0349 14.0698 0.0042 Constraint 115 618 4.3746 5.4682 10.9365 0.0042 Constraint 41 602 5.6060 7.0075 14.0150 0.0042 Constraint 939 1087 5.4222 6.7778 13.5556 0.0042 Constraint 944 1186 6.2147 7.7683 15.5366 0.0042 Constraint 814 1272 4.3465 5.4331 10.8661 0.0042 Constraint 814 1235 5.0417 6.3021 12.6042 0.0042 Constraint 488 596 5.0544 6.3180 12.6361 0.0042 Constraint 185 570 5.8365 7.2957 14.5913 0.0042 Constraint 132 343 5.8817 7.3521 14.7042 0.0042 Constraint 124 373 5.6380 7.0476 14.0951 0.0042 Constraint 92 481 5.8560 7.3200 14.6401 0.0042 Constraint 92 455 4.2182 5.2728 10.5456 0.0042 Constraint 92 446 5.3895 6.7369 13.4739 0.0042 Constraint 92 422 5.3343 6.6679 13.3358 0.0042 Constraint 84 455 3.8002 4.7502 9.5004 0.0042 Constraint 84 431 5.1857 6.4821 12.9642 0.0042 Constraint 1024 1225 6.3991 7.9989 15.9978 0.0034 Constraint 998 1213 6.3406 7.9257 15.8515 0.0034 Constraint 756 907 4.6276 5.7845 11.5690 0.0034 Constraint 756 892 4.3321 5.4152 10.8303 0.0034 Constraint 742 907 4.8105 6.0131 12.0262 0.0034 Constraint 742 900 4.9653 6.2067 12.4133 0.0034 Constraint 728 1256 5.9894 7.4867 14.9734 0.0034 Constraint 728 1244 5.4986 6.8733 13.7466 0.0034 Constraint 728 892 4.2125 5.2656 10.5311 0.0034 Constraint 683 1075 5.5981 6.9977 13.9953 0.0034 Constraint 641 1256 6.1514 7.6892 15.3785 0.0034 Constraint 641 1244 4.9876 6.2345 12.4690 0.0034 Constraint 641 1213 4.4490 5.5612 11.1224 0.0034 Constraint 641 1095 6.3463 7.9328 15.8657 0.0034 Constraint 641 716 5.1727 6.4658 12.9317 0.0034 Constraint 472 915 4.5616 5.7020 11.4040 0.0034 Constraint 464 892 4.5653 5.7066 11.4132 0.0034 Constraint 417 892 5.4861 6.8576 13.7152 0.0034 Constraint 394 691 5.7402 7.1753 14.3505 0.0034 Constraint 394 683 6.3563 7.9454 15.8907 0.0034 Constraint 386 716 4.3473 5.4341 10.8682 0.0034 Constraint 380 499 6.3345 7.9181 15.8362 0.0034 Constraint 998 1075 4.6687 5.8359 11.6718 0.0030 Constraint 1095 1295 4.9081 6.1351 12.2702 0.0029 Constraint 958 1281 5.1009 6.3762 12.7523 0.0029 Constraint 691 998 4.0508 5.0635 10.1271 0.0029 Constraint 967 1288 5.4607 6.8259 13.6517 0.0023 Constraint 967 1144 3.8280 4.7850 9.5701 0.0023 Constraint 967 1133 5.6090 7.0112 14.0224 0.0023 Constraint 958 1288 4.4158 5.5197 11.0395 0.0023 Constraint 951 1235 6.2311 7.7889 15.5778 0.0023 Constraint 944 1124 5.4224 6.7781 13.5561 0.0023 Constraint 944 1106 5.4341 6.7926 13.5852 0.0023 Constraint 944 1051 4.1996 5.2495 10.4990 0.0023 Constraint 939 1124 5.2160 6.5200 13.0401 0.0023 Constraint 822 958 5.6062 7.0077 14.0155 0.0023 Constraint 822 944 5.2796 6.5995 13.1989 0.0023 Constraint 728 1264 5.6425 7.0532 14.1064 0.0023 Constraint 728 951 4.1598 5.1997 10.3995 0.0023 Constraint 723 939 5.5110 6.8888 13.7776 0.0023 Constraint 579 773 4.3898 5.4872 10.9744 0.0023 Constraint 570 773 5.6520 7.0649 14.1299 0.0023 Constraint 1133 1235 6.3938 7.9922 15.9844 0.0021 Constraint 380 700 5.2374 6.5467 13.0934 0.0021 Constraint 373 700 3.5201 4.4002 8.8003 0.0021 Constraint 362 700 4.9148 6.1435 12.2871 0.0021 Constraint 343 700 5.8620 7.3276 14.6551 0.0021 Constraint 222 742 5.4824 6.8531 13.7061 0.0021 Constraint 222 481 5.1385 6.4231 12.8462 0.0021 Constraint 222 472 4.5642 5.7053 11.4106 0.0021 Constraint 222 464 5.8713 7.3391 14.6782 0.0021 Constraint 222 455 4.3129 5.3912 10.7823 0.0021 Constraint 214 742 5.7990 7.2488 14.4975 0.0021 Constraint 214 728 6.0681 7.5851 15.1702 0.0021 Constraint 205 1095 4.0207 5.0259 10.0519 0.0021 Constraint 205 1087 4.6808 5.8510 11.7020 0.0021 Constraint 205 728 3.9391 4.9239 9.8477 0.0021 Constraint 205 723 4.7528 5.9410 11.8821 0.0021 Constraint 205 716 4.1899 5.2374 10.4749 0.0021 Constraint 196 1106 5.5228 6.9035 13.8071 0.0021 Constraint 196 1095 2.9165 3.6457 7.2913 0.0021 Constraint 196 742 5.5228 6.9035 13.8071 0.0021 Constraint 168 1095 5.7505 7.1881 14.3763 0.0021 Constraint 168 742 5.3624 6.7030 13.4060 0.0021 Constraint 168 728 5.7681 7.2102 14.4203 0.0021 Constraint 155 1144 5.6302 7.0377 14.0754 0.0021 Constraint 155 1106 5.4619 6.8274 13.6548 0.0021 Constraint 155 742 5.4619 6.8274 13.6548 0.0021 Constraint 155 624 5.7937 7.2421 14.4842 0.0021 Constraint 141 1144 5.9969 7.4961 14.9922 0.0021 Constraint 141 781 5.8823 7.3529 14.7058 0.0021 Constraint 124 394 6.3826 7.9783 15.9565 0.0021 Constraint 124 386 6.1977 7.7472 15.4943 0.0021 Constraint 115 742 5.4395 6.7993 13.5987 0.0021 Constraint 115 728 6.2303 7.7878 15.5757 0.0021 Constraint 115 386 6.3768 7.9710 15.9421 0.0021 Constraint 100 814 6.1906 7.7382 15.4765 0.0021 Constraint 100 781 4.3644 5.4555 10.9110 0.0021 Constraint 62 124 5.5068 6.8834 13.7669 0.0021 Constraint 998 1087 5.0771 6.3464 12.6928 0.0019 Constraint 944 1095 3.9198 4.8997 9.7994 0.0019 Constraint 939 1066 3.4671 4.3338 8.6676 0.0019 Constraint 325 446 3.4565 4.3206 8.6413 0.0019 Constraint 1124 1295 5.8464 7.3080 14.6161 0.0017 Constraint 1095 1306 5.9224 7.4030 14.8061 0.0017 Constraint 998 1288 3.6541 4.5676 9.1352 0.0017 Constraint 981 1087 5.7984 7.2480 14.4961 0.0017 Constraint 951 1281 4.3251 5.4063 10.8126 0.0017 Constraint 951 1244 4.3327 5.4158 10.8317 0.0017 Constraint 931 1244 4.5863 5.7328 11.4656 0.0017 Constraint 931 1208 5.7420 7.1775 14.3549 0.0017 Constraint 924 1244 4.7473 5.9342 11.8683 0.0017 Constraint 924 1186 5.2078 6.5098 13.0195 0.0017 Constraint 900 1186 4.4725 5.5906 11.1811 0.0017 Constraint 892 1186 5.6731 7.0914 14.1828 0.0017 Constraint 884 1159 6.2621 7.8277 15.6553 0.0017 Constraint 864 1213 4.5471 5.6839 11.3678 0.0017 Constraint 794 951 5.1285 6.4106 12.8211 0.0017 Constraint 794 944 5.9749 7.4686 14.9372 0.0017 Constraint 794 939 4.2027 5.2533 10.5066 0.0017 Constraint 789 944 4.3211 5.4014 10.8027 0.0017 Constraint 789 939 5.7503 7.1879 14.3757 0.0017 Constraint 781 939 4.6446 5.8058 11.6115 0.0017 Constraint 773 1318 6.0099 7.5124 15.0249 0.0017 Constraint 773 1288 6.1016 7.6270 15.2539 0.0017 Constraint 773 981 5.3916 6.7394 13.4789 0.0017 Constraint 773 939 5.0831 6.3539 12.7079 0.0017 Constraint 742 1039 5.1709 6.4636 12.9272 0.0017 Constraint 728 1288 5.9749 7.4686 14.9373 0.0017 Constraint 728 1281 5.4787 6.8483 13.6967 0.0017 Constraint 728 1039 2.3742 2.9678 5.9356 0.0017 Constraint 728 1031 6.1237 7.6546 15.3091 0.0017 Constraint 723 1075 5.7588 7.1985 14.3970 0.0017 Constraint 723 1039 3.1243 3.9053 7.8107 0.0017 Constraint 723 1031 4.0060 5.0075 10.0150 0.0017 Constraint 716 1039 5.0722 6.3402 12.6804 0.0017 Constraint 716 1031 4.4601 5.5752 11.1504 0.0017 Constraint 716 1024 4.6998 5.8747 11.7494 0.0017 Constraint 708 1039 4.3853 5.4816 10.9632 0.0017 Constraint 708 1031 6.0409 7.5511 15.1021 0.0017 Constraint 708 1015 5.0796 6.3495 12.6990 0.0017 Constraint 700 1024 6.1877 7.7346 15.4692 0.0017 Constraint 700 1015 3.8148 4.7685 9.5370 0.0017 Constraint 700 1007 3.9705 4.9632 9.9264 0.0017 Constraint 691 1024 3.4469 4.3086 8.6172 0.0017 Constraint 691 1015 5.6411 7.0514 14.1027 0.0017 Constraint 691 1007 4.6661 5.8326 11.6652 0.0017 Constraint 691 814 6.1194 7.6492 15.2984 0.0017 Constraint 683 958 5.8517 7.3147 14.6294 0.0017 Constraint 660 1288 6.3342 7.9178 15.8356 0.0017 Constraint 660 1281 5.1868 6.4835 12.9669 0.0017 Constraint 660 1256 4.2611 5.3264 10.6528 0.0017 Constraint 660 1106 6.1086 7.6358 15.2716 0.0017 Constraint 660 1095 5.8920 7.3649 14.7299 0.0017 Constraint 660 1075 5.4908 6.8635 13.7270 0.0017 Constraint 660 1015 5.2929 6.6161 13.2321 0.0017 Constraint 660 998 5.6647 7.0808 14.1617 0.0017 Constraint 660 958 4.7487 5.9359 11.8718 0.0017 Constraint 649 1075 3.9346 4.9183 9.8365 0.0017 Constraint 649 1015 3.8593 4.8241 9.6481 0.0017 Constraint 649 998 6.2368 7.7960 15.5919 0.0017 Constraint 439 789 6.2338 7.7922 15.5844 0.0017 Constraint 394 762 4.4753 5.5942 11.1883 0.0017 Constraint 309 900 5.6774 7.0967 14.1934 0.0017 Constraint 309 871 4.0137 5.0171 10.0341 0.0017 Constraint 297 1007 6.2032 7.7539 15.5079 0.0017 Constraint 291 951 6.1418 7.6773 15.3545 0.0017 Constraint 291 924 4.5736 5.7170 11.4340 0.0017 Constraint 291 683 6.1598 7.6997 15.3994 0.0017 Constraint 275 998 6.1529 7.6911 15.3822 0.0017 Constraint 275 990 4.0499 5.0624 10.1248 0.0017 Constraint 275 951 4.8785 6.0982 12.1963 0.0017 Constraint 275 683 5.0717 6.3397 12.6793 0.0017 Constraint 266 998 3.3313 4.1641 8.3282 0.0017 Constraint 266 990 4.7771 5.9714 11.9428 0.0017 Constraint 266 967 6.2202 7.7753 15.5506 0.0017 Constraint 257 998 5.0943 6.3678 12.7357 0.0017 Constraint 257 990 5.5514 6.9392 13.8784 0.0017 Constraint 249 990 5.2265 6.5332 13.0663 0.0017 Constraint 222 990 4.4081 5.5101 11.0202 0.0017 Constraint 222 981 4.8857 6.1071 12.2143 0.0017 Constraint 222 973 3.6034 4.5043 9.0085 0.0017 Constraint 214 990 5.5561 6.9452 13.8903 0.0017 Constraint 214 973 6.1617 7.7021 15.4043 0.0017 Constraint 214 570 5.4362 6.7952 13.5905 0.0017 Constraint 196 973 4.1094 5.1368 10.2736 0.0017 Constraint 196 944 6.2662 7.8327 15.6655 0.0017 Constraint 196 674 6.2493 7.8116 15.6233 0.0017 Constraint 185 990 4.9100 6.1375 12.2750 0.0017 Constraint 185 973 3.5817 4.4771 8.9542 0.0017 Constraint 185 967 6.2802 7.8503 15.7006 0.0017 Constraint 185 951 4.6972 5.8715 11.7430 0.0017 Constraint 185 944 3.4437 4.3046 8.6092 0.0017 Constraint 163 944 4.6280 5.7850 11.5701 0.0017 Constraint 163 915 5.9264 7.4080 14.8161 0.0017 Constraint 163 674 4.6487 5.8108 11.6217 0.0017 Constraint 163 649 6.1643 7.7054 15.4108 0.0017 Constraint 141 892 6.0524 7.5655 15.1310 0.0017 Constraint 141 618 5.9738 7.4673 14.9346 0.0017 Constraint 124 551 6.1135 7.6419 15.2838 0.0017 Constraint 115 871 4.9002 6.1253 12.2505 0.0017 Constraint 115 794 3.6802 4.6003 9.2005 0.0017 Constraint 115 579 4.8831 6.1039 12.2078 0.0017 Constraint 115 562 5.7976 7.2470 14.4940 0.0017 Constraint 115 551 4.2124 5.2655 10.5311 0.0017 Constraint 100 408 5.3714 6.7143 13.4286 0.0017 Constraint 100 380 6.1010 7.6263 15.2526 0.0017 Constraint 62 998 5.7180 7.1475 14.2950 0.0017 Constraint 46 998 5.7677 7.2097 14.4193 0.0017 Constraint 1213 1318 5.1603 6.4504 12.9009 0.0013 Constraint 841 1208 5.0830 6.3538 12.7076 0.0013 Constraint 841 958 6.0416 7.5519 15.1039 0.0013 Constraint 822 1201 5.9985 7.4981 14.9962 0.0013 Constraint 789 1087 6.2965 7.8706 15.7412 0.0013 Constraint 649 1318 5.7496 7.1870 14.3740 0.0013 Constraint 649 1306 4.6580 5.8225 11.6450 0.0013 Constraint 641 1306 6.0632 7.5790 15.1579 0.0013 Constraint 610 1318 6.0433 7.5541 15.1082 0.0013 Constraint 585 773 5.4365 6.7956 13.5911 0.0013 Constraint 408 884 4.2046 5.2557 10.5115 0.0013 Constraint 394 789 5.2615 6.5769 13.1538 0.0013 Constraint 394 579 6.3560 7.9451 15.8901 0.0013 Constraint 380 1087 5.5615 6.9519 13.9037 0.0013 Constraint 380 892 3.2237 4.0296 8.0591 0.0013 Constraint 380 789 3.8970 4.8712 9.7424 0.0013 Constraint 373 958 5.3890 6.7362 13.4725 0.0013 Constraint 373 892 5.4778 6.8472 13.6944 0.0013 Constraint 351 900 6.3363 7.9204 15.8407 0.0013 Constraint 351 884 4.3026 5.3782 10.7564 0.0013 Constraint 317 1318 5.4910 6.8637 13.7275 0.0013 Constraint 317 1225 6.3222 7.9027 15.8054 0.0013 Constraint 317 1213 3.9061 4.8826 9.7653 0.0013 Constraint 317 1192 4.3252 5.4064 10.8129 0.0013 Constraint 317 1186 5.1954 6.4943 12.9886 0.0013 Constraint 309 1318 6.3171 7.8964 15.7927 0.0013 Constraint 309 649 6.0327 7.5409 15.0819 0.0013 Constraint 297 1318 4.0512 5.0640 10.1280 0.0013 Constraint 297 1306 5.6947 7.1183 14.2366 0.0013 Constraint 297 1295 4.6786 5.8482 11.6965 0.0013 Constraint 297 1256 4.4721 5.5901 11.1801 0.0013 Constraint 297 1213 5.1684 6.4605 12.9210 0.0013 Constraint 291 1318 5.8448 7.3060 14.6121 0.0013 Constraint 291 1306 3.7008 4.6260 9.2519 0.0013 Constraint 291 1295 5.5228 6.9035 13.8070 0.0013 Constraint 282 1306 5.8685 7.3356 14.6713 0.0013 Constraint 282 1295 6.1345 7.6681 15.3361 0.0013 Constraint 275 1295 5.6144 7.0180 14.0360 0.0013 Constraint 275 596 6.2447 7.8059 15.6117 0.0013 Constraint 229 1281 6.3800 7.9751 15.9501 0.0013 Constraint 222 1295 4.7883 5.9854 11.9708 0.0013 Constraint 222 1281 3.7344 4.6680 9.3360 0.0013 Constraint 222 1256 5.8528 7.3160 14.6319 0.0013 Constraint 222 1244 5.5676 6.9596 13.9191 0.0013 Constraint 214 805 4.8414 6.0517 12.1034 0.0013 Constraint 196 1244 4.5786 5.7232 11.4464 0.0013 Constraint 185 1256 5.4949 6.8687 13.7373 0.0013 Constraint 185 1244 3.2547 4.0684 8.1368 0.0013 Constraint 185 1213 3.8159 4.7699 9.5398 0.0013 Constraint 185 1208 5.5725 6.9656 13.9313 0.0013 Constraint 185 805 4.8219 6.0274 12.0548 0.0013 Constraint 177 794 5.6990 7.1237 14.2474 0.0013 Constraint 177 789 4.7335 5.9168 11.8337 0.0013 Constraint 168 789 6.1008 7.6260 15.2521 0.0013 Constraint 163 1244 4.4095 5.5119 11.0238 0.0013 Constraint 163 1235 5.6251 7.0314 14.0627 0.0013 Constraint 163 1213 6.0621 7.5777 15.1553 0.0013 Constraint 163 1208 3.6839 4.6049 9.2098 0.0013 Constraint 155 1244 6.3313 7.9141 15.8282 0.0013 Constraint 155 1213 4.2934 5.3668 10.7336 0.0013 Constraint 155 1208 3.4388 4.2985 8.5969 0.0013 Constraint 155 1186 3.0162 3.7703 7.5406 0.0013 Constraint 155 1174 6.2959 7.8699 15.7398 0.0013 Constraint 148 1186 5.9834 7.4792 14.9584 0.0013 Constraint 141 1208 6.0047 7.5058 15.0117 0.0013 Constraint 132 1208 3.3611 4.2014 8.4028 0.0013 Constraint 132 1201 5.8663 7.3329 14.6657 0.0013 Constraint 132 1186 5.5577 6.9471 13.8941 0.0013 Constraint 132 1174 5.5331 6.9163 13.8326 0.0013 Constraint 124 1186 5.6817 7.1021 14.2042 0.0013 Constraint 124 1174 4.3584 5.4480 10.8959 0.0013 Constraint 115 1186 6.0347 7.5434 15.0867 0.0013 Constraint 115 1174 4.8708 6.0885 12.1770 0.0013 Constraint 62 185 6.0486 7.5607 15.1215 0.0013 Constraint 1213 1329 4.4784 5.5981 11.1961 0.0012 Constraint 1208 1329 6.3643 7.9554 15.9109 0.0012 Constraint 1095 1318 5.6632 7.0790 14.1580 0.0012 Constraint 1087 1339 5.0650 6.3313 12.6625 0.0012 Constraint 1007 1288 5.4827 6.8534 13.7068 0.0012 Constraint 958 1295 5.6729 7.0911 14.1821 0.0012 Constraint 951 1329 5.1939 6.4924 12.9848 0.0012 Constraint 944 1329 4.0621 5.0776 10.1552 0.0012 Constraint 939 1295 5.5744 6.9680 13.9360 0.0012 Constraint 939 1281 4.0914 5.1142 10.2285 0.0012 Constraint 931 1295 4.7009 5.8761 11.7522 0.0012 Constraint 931 1288 6.1721 7.7152 15.4304 0.0012 Constraint 931 1281 4.1429 5.1786 10.3573 0.0012 Constraint 924 1339 6.0352 7.5440 15.0879 0.0012 Constraint 924 1329 4.5997 5.7497 11.4994 0.0012 Constraint 924 1295 4.8388 6.0486 12.0971 0.0012 Constraint 907 1235 5.2029 6.5036 13.0073 0.0012 Constraint 907 1208 5.7808 7.2260 14.4519 0.0012 Constraint 864 1339 6.0869 7.6087 15.2173 0.0012 Constraint 864 1329 6.0959 7.6199 15.2399 0.0012 Constraint 852 1339 3.8940 4.8675 9.7350 0.0012 Constraint 841 1339 5.3421 6.6777 13.3553 0.0012 Constraint 841 1329 3.6675 4.5844 9.1687 0.0012 Constraint 841 1318 5.6632 7.0790 14.1580 0.0012 Constraint 833 1339 5.1985 6.4982 12.9964 0.0012 Constraint 833 1329 6.2850 7.8562 15.7125 0.0012 Constraint 833 1318 4.0814 5.1017 10.2034 0.0012 Constraint 833 1306 4.8229 6.0286 12.0573 0.0012 Constraint 822 1306 4.2923 5.3654 10.7308 0.0012 Constraint 822 1295 4.4548 5.5685 11.1370 0.0012 Constraint 814 1306 3.8687 4.8359 9.6718 0.0012 Constraint 716 1306 5.2688 6.5860 13.1721 0.0012 Constraint 716 1295 4.3860 5.4825 10.9649 0.0012 Constraint 708 1306 6.2519 7.8149 15.6298 0.0012 Constraint 472 1306 5.2027 6.5034 13.0068 0.0012 Constraint 472 1272 5.9696 7.4620 14.9240 0.0012 Constraint 249 335 5.0593 6.3241 12.6482 0.0012 Constraint 924 1075 4.6266 5.7832 11.5664 0.0010 Constraint 924 1066 4.2441 5.3052 10.6104 0.0010 Constraint 756 998 6.2998 7.8747 15.7495 0.0010 Constraint 602 773 5.5130 6.8913 13.7826 0.0010 Constraint 562 773 4.3618 5.4522 10.9044 0.0010 Constraint 1467 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1459 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1459 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1451 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1451 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1451 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1442 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1442 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1442 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1442 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1430 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1430 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1430 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1430 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1430 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1413 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1402 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1395 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1386 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1381 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1373 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1362 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1354 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1347 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1339 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1329 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1306 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1295 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1281 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1264 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1256 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1244 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1225 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1201 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1192 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1186 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1174 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1150 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1144 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1124 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1295 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1124 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1124 0.8000 1.0000 2.0000 0.0000 Constraint 1095 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1124 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1087 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1124 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1124 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1306 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1051 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1095 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1031 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1087 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1024 1031 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1451 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1430 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1402 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1395 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1339 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1225 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1031 0.8000 1.0000 2.0000 0.0000 Constraint 1015 1024 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1476 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1467 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1459 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1442 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1413 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1386 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1381 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1373 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1362 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1354 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1347 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1329 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1281 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1264 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1256 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1244 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1201 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1192 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1186 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1174 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1150 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1031 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1024 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1015 0.8000 1.0000 2.0000 0.0000 Constraint 998 1476 0.8000 1.0000 2.0000 0.0000 Constraint 998 1467 0.8000 1.0000 2.0000 0.0000 Constraint 998 1459 0.8000 1.0000 2.0000 0.0000 Constraint 998 1442 0.8000 1.0000 2.0000 0.0000 Constraint 998 1430 0.8000 1.0000 2.0000 0.0000 Constraint 998 1421 0.8000 1.0000 2.0000 0.0000 Constraint 998 1413 0.8000 1.0000 2.0000 0.0000 Constraint 998 1402 0.8000 1.0000 2.0000 0.0000 Constraint 998 1395 0.8000 1.0000 2.0000 0.0000 Constraint 998 1386 0.8000 1.0000 2.0000 0.0000 Constraint 998 1381 0.8000 1.0000 2.0000 0.0000 Constraint 998 1373 0.8000 1.0000 2.0000 0.0000 Constraint 998 1362 0.8000 1.0000 2.0000 0.0000 Constraint 998 1354 0.8000 1.0000 2.0000 0.0000 Constraint 998 1347 0.8000 1.0000 2.0000 0.0000 Constraint 998 1339 0.8000 1.0000 2.0000 0.0000 Constraint 998 1329 0.8000 1.0000 2.0000 0.0000 Constraint 998 1318 0.8000 1.0000 2.0000 0.0000 Constraint 998 1306 0.8000 1.0000 2.0000 0.0000 Constraint 998 1295 0.8000 1.0000 2.0000 0.0000 Constraint 998 1281 0.8000 1.0000 2.0000 0.0000 Constraint 998 1272 0.8000 1.0000 2.0000 0.0000 Constraint 998 1264 0.8000 1.0000 2.0000 0.0000 Constraint 998 1244 0.8000 1.0000 2.0000 0.0000 Constraint 998 1235 0.8000 1.0000 2.0000 0.0000 Constraint 998 1225 0.8000 1.0000 2.0000 0.0000 Constraint 998 1208 0.8000 1.0000 2.0000 0.0000 Constraint 998 1201 0.8000 1.0000 2.0000 0.0000 Constraint 998 1192 0.8000 1.0000 2.0000 0.0000 Constraint 998 1186 0.8000 1.0000 2.0000 0.0000 Constraint 998 1174 0.8000 1.0000 2.0000 0.0000 Constraint 998 1095 0.8000 1.0000 2.0000 0.0000 Constraint 998 1066 0.8000 1.0000 2.0000 0.0000 Constraint 998 1051 0.8000 1.0000 2.0000 0.0000 Constraint 998 1039 0.8000 1.0000 2.0000 0.0000 Constraint 998 1031 0.8000 1.0000 2.0000 0.0000 Constraint 998 1024 0.8000 1.0000 2.0000 0.0000 Constraint 998 1015 0.8000 1.0000 2.0000 0.0000 Constraint 998 1007 0.8000 1.0000 2.0000 0.0000 Constraint 990 1476 0.8000 1.0000 2.0000 0.0000 Constraint 990 1459 0.8000 1.0000 2.0000 0.0000 Constraint 990 1451 0.8000 1.0000 2.0000 0.0000 Constraint 990 1442 0.8000 1.0000 2.0000 0.0000 Constraint 990 1430 0.8000 1.0000 2.0000 0.0000 Constraint 990 1421 0.8000 1.0000 2.0000 0.0000 Constraint 990 1413 0.8000 1.0000 2.0000 0.0000 Constraint 990 1402 0.8000 1.0000 2.0000 0.0000 Constraint 990 1395 0.8000 1.0000 2.0000 0.0000 Constraint 990 1386 0.8000 1.0000 2.0000 0.0000 Constraint 990 1373 0.8000 1.0000 2.0000 0.0000 Constraint 990 1362 0.8000 1.0000 2.0000 0.0000 Constraint 990 1354 0.8000 1.0000 2.0000 0.0000 Constraint 990 1347 0.8000 1.0000 2.0000 0.0000 Constraint 990 1339 0.8000 1.0000 2.0000 0.0000 Constraint 990 1329 0.8000 1.0000 2.0000 0.0000 Constraint 990 1318 0.8000 1.0000 2.0000 0.0000 Constraint 990 1306 0.8000 1.0000 2.0000 0.0000 Constraint 990 1295 0.8000 1.0000 2.0000 0.0000 Constraint 990 1288 0.8000 1.0000 2.0000 0.0000 Constraint 990 1281 0.8000 1.0000 2.0000 0.0000 Constraint 990 1272 0.8000 1.0000 2.0000 0.0000 Constraint 990 1256 0.8000 1.0000 2.0000 0.0000 Constraint 990 1244 0.8000 1.0000 2.0000 0.0000 Constraint 990 1235 0.8000 1.0000 2.0000 0.0000 Constraint 990 1225 0.8000 1.0000 2.0000 0.0000 Constraint 990 1213 0.8000 1.0000 2.0000 0.0000 Constraint 990 1208 0.8000 1.0000 2.0000 0.0000 Constraint 990 1106 0.8000 1.0000 2.0000 0.0000 Constraint 990 1095 0.8000 1.0000 2.0000 0.0000 Constraint 990 1087 0.8000 1.0000 2.0000 0.0000 Constraint 990 1066 0.8000 1.0000 2.0000 0.0000 Constraint 990 1051 0.8000 1.0000 2.0000 0.0000 Constraint 990 1039 0.8000 1.0000 2.0000 0.0000 Constraint 990 1031 0.8000 1.0000 2.0000 0.0000 Constraint 990 1024 0.8000 1.0000 2.0000 0.0000 Constraint 990 1015 0.8000 1.0000 2.0000 0.0000 Constraint 990 1007 0.8000 1.0000 2.0000 0.0000 Constraint 990 998 0.8000 1.0000 2.0000 0.0000 Constraint 981 1476 0.8000 1.0000 2.0000 0.0000 Constraint 981 1451 0.8000 1.0000 2.0000 0.0000 Constraint 981 1442 0.8000 1.0000 2.0000 0.0000 Constraint 981 1430 0.8000 1.0000 2.0000 0.0000 Constraint 981 1421 0.8000 1.0000 2.0000 0.0000 Constraint 981 1413 0.8000 1.0000 2.0000 0.0000 Constraint 981 1402 0.8000 1.0000 2.0000 0.0000 Constraint 981 1395 0.8000 1.0000 2.0000 0.0000 Constraint 981 1386 0.8000 1.0000 2.0000 0.0000 Constraint 981 1354 0.8000 1.0000 2.0000 0.0000 Constraint 981 1347 0.8000 1.0000 2.0000 0.0000 Constraint 981 1339 0.8000 1.0000 2.0000 0.0000 Constraint 981 1329 0.8000 1.0000 2.0000 0.0000 Constraint 981 1318 0.8000 1.0000 2.0000 0.0000 Constraint 981 1272 0.8000 1.0000 2.0000 0.0000 Constraint 981 1235 0.8000 1.0000 2.0000 0.0000 Constraint 981 1095 0.8000 1.0000 2.0000 0.0000 Constraint 981 1051 0.8000 1.0000 2.0000 0.0000 Constraint 981 1039 0.8000 1.0000 2.0000 0.0000 Constraint 981 1031 0.8000 1.0000 2.0000 0.0000 Constraint 981 1024 0.8000 1.0000 2.0000 0.0000 Constraint 981 1015 0.8000 1.0000 2.0000 0.0000 Constraint 981 1007 0.8000 1.0000 2.0000 0.0000 Constraint 981 998 0.8000 1.0000 2.0000 0.0000 Constraint 981 990 0.8000 1.0000 2.0000 0.0000 Constraint 973 1476 0.8000 1.0000 2.0000 0.0000 Constraint 973 1467 0.8000 1.0000 2.0000 0.0000 Constraint 973 1451 0.8000 1.0000 2.0000 0.0000 Constraint 973 1442 0.8000 1.0000 2.0000 0.0000 Constraint 973 1430 0.8000 1.0000 2.0000 0.0000 Constraint 973 1421 0.8000 1.0000 2.0000 0.0000 Constraint 973 1413 0.8000 1.0000 2.0000 0.0000 Constraint 973 1402 0.8000 1.0000 2.0000 0.0000 Constraint 973 1395 0.8000 1.0000 2.0000 0.0000 Constraint 973 1386 0.8000 1.0000 2.0000 0.0000 Constraint 973 1381 0.8000 1.0000 2.0000 0.0000 Constraint 973 1373 0.8000 1.0000 2.0000 0.0000 Constraint 973 1362 0.8000 1.0000 2.0000 0.0000 Constraint 973 1354 0.8000 1.0000 2.0000 0.0000 Constraint 973 1347 0.8000 1.0000 2.0000 0.0000 Constraint 973 1339 0.8000 1.0000 2.0000 0.0000 Constraint 973 1329 0.8000 1.0000 2.0000 0.0000 Constraint 973 1318 0.8000 1.0000 2.0000 0.0000 Constraint 973 1281 0.8000 1.0000 2.0000 0.0000 Constraint 973 1272 0.8000 1.0000 2.0000 0.0000 Constraint 973 1264 0.8000 1.0000 2.0000 0.0000 Constraint 973 1235 0.8000 1.0000 2.0000 0.0000 Constraint 973 1225 0.8000 1.0000 2.0000 0.0000 Constraint 973 1201 0.8000 1.0000 2.0000 0.0000 Constraint 973 1174 0.8000 1.0000 2.0000 0.0000 Constraint 973 1159 0.8000 1.0000 2.0000 0.0000 Constraint 973 1150 0.8000 1.0000 2.0000 0.0000 Constraint 973 1039 0.8000 1.0000 2.0000 0.0000 Constraint 973 1031 0.8000 1.0000 2.0000 0.0000 Constraint 973 1024 0.8000 1.0000 2.0000 0.0000 Constraint 973 1015 0.8000 1.0000 2.0000 0.0000 Constraint 973 1007 0.8000 1.0000 2.0000 0.0000 Constraint 973 998 0.8000 1.0000 2.0000 0.0000 Constraint 973 990 0.8000 1.0000 2.0000 0.0000 Constraint 973 981 0.8000 1.0000 2.0000 0.0000 Constraint 967 1476 0.8000 1.0000 2.0000 0.0000 Constraint 967 1467 0.8000 1.0000 2.0000 0.0000 Constraint 967 1451 0.8000 1.0000 2.0000 0.0000 Constraint 967 1442 0.8000 1.0000 2.0000 0.0000 Constraint 967 1430 0.8000 1.0000 2.0000 0.0000 Constraint 967 1421 0.8000 1.0000 2.0000 0.0000 Constraint 967 1413 0.8000 1.0000 2.0000 0.0000 Constraint 967 1402 0.8000 1.0000 2.0000 0.0000 Constraint 967 1395 0.8000 1.0000 2.0000 0.0000 Constraint 967 1386 0.8000 1.0000 2.0000 0.0000 Constraint 967 1381 0.8000 1.0000 2.0000 0.0000 Constraint 967 1373 0.8000 1.0000 2.0000 0.0000 Constraint 967 1362 0.8000 1.0000 2.0000 0.0000 Constraint 967 1354 0.8000 1.0000 2.0000 0.0000 Constraint 967 1347 0.8000 1.0000 2.0000 0.0000 Constraint 967 1339 0.8000 1.0000 2.0000 0.0000 Constraint 967 1329 0.8000 1.0000 2.0000 0.0000 Constraint 967 1318 0.8000 1.0000 2.0000 0.0000 Constraint 967 1306 0.8000 1.0000 2.0000 0.0000 Constraint 967 1281 0.8000 1.0000 2.0000 0.0000 Constraint 967 1272 0.8000 1.0000 2.0000 0.0000 Constraint 967 1264 0.8000 1.0000 2.0000 0.0000 Constraint 967 1256 0.8000 1.0000 2.0000 0.0000 Constraint 967 1235 0.8000 1.0000 2.0000 0.0000 Constraint 967 1225 0.8000 1.0000 2.0000 0.0000 Constraint 967 1213 0.8000 1.0000 2.0000 0.0000 Constraint 967 1208 0.8000 1.0000 2.0000 0.0000 Constraint 967 1201 0.8000 1.0000 2.0000 0.0000 Constraint 967 1192 0.8000 1.0000 2.0000 0.0000 Constraint 967 1186 0.8000 1.0000 2.0000 0.0000 Constraint 967 1174 0.8000 1.0000 2.0000 0.0000 Constraint 967 1168 0.8000 1.0000 2.0000 0.0000 Constraint 967 1159 0.8000 1.0000 2.0000 0.0000 Constraint 967 1150 0.8000 1.0000 2.0000 0.0000 Constraint 967 1124 0.8000 1.0000 2.0000 0.0000 Constraint 967 1095 0.8000 1.0000 2.0000 0.0000 Constraint 967 1031 0.8000 1.0000 2.0000 0.0000 Constraint 967 1024 0.8000 1.0000 2.0000 0.0000 Constraint 967 1015 0.8000 1.0000 2.0000 0.0000 Constraint 967 1007 0.8000 1.0000 2.0000 0.0000 Constraint 967 998 0.8000 1.0000 2.0000 0.0000 Constraint 967 990 0.8000 1.0000 2.0000 0.0000 Constraint 967 981 0.8000 1.0000 2.0000 0.0000 Constraint 967 973 0.8000 1.0000 2.0000 0.0000 Constraint 958 1476 0.8000 1.0000 2.0000 0.0000 Constraint 958 1442 0.8000 1.0000 2.0000 0.0000 Constraint 958 1421 0.8000 1.0000 2.0000 0.0000 Constraint 958 1413 0.8000 1.0000 2.0000 0.0000 Constraint 958 1402 0.8000 1.0000 2.0000 0.0000 Constraint 958 1395 0.8000 1.0000 2.0000 0.0000 Constraint 958 1386 0.8000 1.0000 2.0000 0.0000 Constraint 958 1362 0.8000 1.0000 2.0000 0.0000 Constraint 958 1354 0.8000 1.0000 2.0000 0.0000 Constraint 958 1347 0.8000 1.0000 2.0000 0.0000 Constraint 958 1339 0.8000 1.0000 2.0000 0.0000 Constraint 958 1329 0.8000 1.0000 2.0000 0.0000 Constraint 958 1318 0.8000 1.0000 2.0000 0.0000 Constraint 958 1306 0.8000 1.0000 2.0000 0.0000 Constraint 958 1272 0.8000 1.0000 2.0000 0.0000 Constraint 958 1244 0.8000 1.0000 2.0000 0.0000 Constraint 958 1235 0.8000 1.0000 2.0000 0.0000 Constraint 958 1213 0.8000 1.0000 2.0000 0.0000 Constraint 958 1208 0.8000 1.0000 2.0000 0.0000 Constraint 958 1192 0.8000 1.0000 2.0000 0.0000 Constraint 958 1186 0.8000 1.0000 2.0000 0.0000 Constraint 958 1174 0.8000 1.0000 2.0000 0.0000 Constraint 958 1168 0.8000 1.0000 2.0000 0.0000 Constraint 958 1150 0.8000 1.0000 2.0000 0.0000 Constraint 958 1095 0.8000 1.0000 2.0000 0.0000 Constraint 958 1087 0.8000 1.0000 2.0000 0.0000 Constraint 958 1066 0.8000 1.0000 2.0000 0.0000 Constraint 958 1024 0.8000 1.0000 2.0000 0.0000 Constraint 958 1015 0.8000 1.0000 2.0000 0.0000 Constraint 958 1007 0.8000 1.0000 2.0000 0.0000 Constraint 958 998 0.8000 1.0000 2.0000 0.0000 Constraint 958 990 0.8000 1.0000 2.0000 0.0000 Constraint 958 981 0.8000 1.0000 2.0000 0.0000 Constraint 958 973 0.8000 1.0000 2.0000 0.0000 Constraint 958 967 0.8000 1.0000 2.0000 0.0000 Constraint 951 1476 0.8000 1.0000 2.0000 0.0000 Constraint 951 1442 0.8000 1.0000 2.0000 0.0000 Constraint 951 1421 0.8000 1.0000 2.0000 0.0000 Constraint 951 1413 0.8000 1.0000 2.0000 0.0000 Constraint 951 1402 0.8000 1.0000 2.0000 0.0000 Constraint 951 1395 0.8000 1.0000 2.0000 0.0000 Constraint 951 1386 0.8000 1.0000 2.0000 0.0000 Constraint 951 1362 0.8000 1.0000 2.0000 0.0000 Constraint 951 1354 0.8000 1.0000 2.0000 0.0000 Constraint 951 1347 0.8000 1.0000 2.0000 0.0000 Constraint 951 1318 0.8000 1.0000 2.0000 0.0000 Constraint 951 1272 0.8000 1.0000 2.0000 0.0000 Constraint 951 1208 0.8000 1.0000 2.0000 0.0000 Constraint 951 1186 0.8000 1.0000 2.0000 0.0000 Constraint 951 1174 0.8000 1.0000 2.0000 0.0000 Constraint 951 1159 0.8000 1.0000 2.0000 0.0000 Constraint 951 1150 0.8000 1.0000 2.0000 0.0000 Constraint 951 1066 0.8000 1.0000 2.0000 0.0000 Constraint 951 1039 0.8000 1.0000 2.0000 0.0000 Constraint 951 1015 0.8000 1.0000 2.0000 0.0000 Constraint 951 1007 0.8000 1.0000 2.0000 0.0000 Constraint 951 998 0.8000 1.0000 2.0000 0.0000 Constraint 951 990 0.8000 1.0000 2.0000 0.0000 Constraint 951 981 0.8000 1.0000 2.0000 0.0000 Constraint 951 973 0.8000 1.0000 2.0000 0.0000 Constraint 951 967 0.8000 1.0000 2.0000 0.0000 Constraint 951 958 0.8000 1.0000 2.0000 0.0000 Constraint 944 1476 0.8000 1.0000 2.0000 0.0000 Constraint 944 1467 0.8000 1.0000 2.0000 0.0000 Constraint 944 1459 0.8000 1.0000 2.0000 0.0000 Constraint 944 1451 0.8000 1.0000 2.0000 0.0000 Constraint 944 1442 0.8000 1.0000 2.0000 0.0000 Constraint 944 1430 0.8000 1.0000 2.0000 0.0000 Constraint 944 1421 0.8000 1.0000 2.0000 0.0000 Constraint 944 1413 0.8000 1.0000 2.0000 0.0000 Constraint 944 1386 0.8000 1.0000 2.0000 0.0000 Constraint 944 1381 0.8000 1.0000 2.0000 0.0000 Constraint 944 1373 0.8000 1.0000 2.0000 0.0000 Constraint 944 1362 0.8000 1.0000 2.0000 0.0000 Constraint 944 1354 0.8000 1.0000 2.0000 0.0000 Constraint 944 1347 0.8000 1.0000 2.0000 0.0000 Constraint 944 1318 0.8000 1.0000 2.0000 0.0000 Constraint 944 1306 0.8000 1.0000 2.0000 0.0000 Constraint 944 1281 0.8000 1.0000 2.0000 0.0000 Constraint 944 1272 0.8000 1.0000 2.0000 0.0000 Constraint 944 1264 0.8000 1.0000 2.0000 0.0000 Constraint 944 1235 0.8000 1.0000 2.0000 0.0000 Constraint 944 1225 0.8000 1.0000 2.0000 0.0000 Constraint 944 1213 0.8000 1.0000 2.0000 0.0000 Constraint 944 1208 0.8000 1.0000 2.0000 0.0000 Constraint 944 1201 0.8000 1.0000 2.0000 0.0000 Constraint 944 1174 0.8000 1.0000 2.0000 0.0000 Constraint 944 1168 0.8000 1.0000 2.0000 0.0000 Constraint 944 1159 0.8000 1.0000 2.0000 0.0000 Constraint 944 1150 0.8000 1.0000 2.0000 0.0000 Constraint 944 1144 0.8000 1.0000 2.0000 0.0000 Constraint 944 1066 0.8000 1.0000 2.0000 0.0000 Constraint 944 1039 0.8000 1.0000 2.0000 0.0000 Constraint 944 1007 0.8000 1.0000 2.0000 0.0000 Constraint 944 998 0.8000 1.0000 2.0000 0.0000 Constraint 944 990 0.8000 1.0000 2.0000 0.0000 Constraint 944 981 0.8000 1.0000 2.0000 0.0000 Constraint 944 973 0.8000 1.0000 2.0000 0.0000 Constraint 944 967 0.8000 1.0000 2.0000 0.0000 Constraint 944 958 0.8000 1.0000 2.0000 0.0000 Constraint 944 951 0.8000 1.0000 2.0000 0.0000 Constraint 939 1476 0.8000 1.0000 2.0000 0.0000 Constraint 939 1442 0.8000 1.0000 2.0000 0.0000 Constraint 939 1430 0.8000 1.0000 2.0000 0.0000 Constraint 939 1421 0.8000 1.0000 2.0000 0.0000 Constraint 939 1413 0.8000 1.0000 2.0000 0.0000 Constraint 939 1402 0.8000 1.0000 2.0000 0.0000 Constraint 939 1395 0.8000 1.0000 2.0000 0.0000 Constraint 939 1386 0.8000 1.0000 2.0000 0.0000 Constraint 939 1381 0.8000 1.0000 2.0000 0.0000 Constraint 939 1373 0.8000 1.0000 2.0000 0.0000 Constraint 939 1362 0.8000 1.0000 2.0000 0.0000 Constraint 939 1354 0.8000 1.0000 2.0000 0.0000 Constraint 939 1347 0.8000 1.0000 2.0000 0.0000 Constraint 939 1339 0.8000 1.0000 2.0000 0.0000 Constraint 939 1329 0.8000 1.0000 2.0000 0.0000 Constraint 939 1318 0.8000 1.0000 2.0000 0.0000 Constraint 939 1306 0.8000 1.0000 2.0000 0.0000 Constraint 939 1288 0.8000 1.0000 2.0000 0.0000 Constraint 939 1272 0.8000 1.0000 2.0000 0.0000 Constraint 939 1256 0.8000 1.0000 2.0000 0.0000 Constraint 939 1244 0.8000 1.0000 2.0000 0.0000 Constraint 939 1235 0.8000 1.0000 2.0000 0.0000 Constraint 939 1225 0.8000 1.0000 2.0000 0.0000 Constraint 939 1213 0.8000 1.0000 2.0000 0.0000 Constraint 939 1208 0.8000 1.0000 2.0000 0.0000 Constraint 939 1201 0.8000 1.0000 2.0000 0.0000 Constraint 939 1192 0.8000 1.0000 2.0000 0.0000 Constraint 939 1186 0.8000 1.0000 2.0000 0.0000 Constraint 939 1174 0.8000 1.0000 2.0000 0.0000 Constraint 939 1168 0.8000 1.0000 2.0000 0.0000 Constraint 939 1150 0.8000 1.0000 2.0000 0.0000 Constraint 939 1144 0.8000 1.0000 2.0000 0.0000 Constraint 939 1133 0.8000 1.0000 2.0000 0.0000 Constraint 939 1075 0.8000 1.0000 2.0000 0.0000 Constraint 939 1039 0.8000 1.0000 2.0000 0.0000 Constraint 939 998 0.8000 1.0000 2.0000 0.0000 Constraint 939 990 0.8000 1.0000 2.0000 0.0000 Constraint 939 981 0.8000 1.0000 2.0000 0.0000 Constraint 939 973 0.8000 1.0000 2.0000 0.0000 Constraint 939 967 0.8000 1.0000 2.0000 0.0000 Constraint 939 958 0.8000 1.0000 2.0000 0.0000 Constraint 939 951 0.8000 1.0000 2.0000 0.0000 Constraint 939 944 0.8000 1.0000 2.0000 0.0000 Constraint 931 1476 0.8000 1.0000 2.0000 0.0000 Constraint 931 1467 0.8000 1.0000 2.0000 0.0000 Constraint 931 1442 0.8000 1.0000 2.0000 0.0000 Constraint 931 1413 0.8000 1.0000 2.0000 0.0000 Constraint 931 1395 0.8000 1.0000 2.0000 0.0000 Constraint 931 1386 0.8000 1.0000 2.0000 0.0000 Constraint 931 1381 0.8000 1.0000 2.0000 0.0000 Constraint 931 1373 0.8000 1.0000 2.0000 0.0000 Constraint 931 1362 0.8000 1.0000 2.0000 0.0000 Constraint 931 1354 0.8000 1.0000 2.0000 0.0000 Constraint 931 1347 0.8000 1.0000 2.0000 0.0000 Constraint 931 1339 0.8000 1.0000 2.0000 0.0000 Constraint 931 1329 0.8000 1.0000 2.0000 0.0000 Constraint 931 1318 0.8000 1.0000 2.0000 0.0000 Constraint 931 1306 0.8000 1.0000 2.0000 0.0000 Constraint 931 1272 0.8000 1.0000 2.0000 0.0000 Constraint 931 1186 0.8000 1.0000 2.0000 0.0000 Constraint 931 1174 0.8000 1.0000 2.0000 0.0000 Constraint 931 1150 0.8000 1.0000 2.0000 0.0000 Constraint 931 1144 0.8000 1.0000 2.0000 0.0000 Constraint 931 990 0.8000 1.0000 2.0000 0.0000 Constraint 931 981 0.8000 1.0000 2.0000 0.0000 Constraint 931 973 0.8000 1.0000 2.0000 0.0000 Constraint 931 967 0.8000 1.0000 2.0000 0.0000 Constraint 931 958 0.8000 1.0000 2.0000 0.0000 Constraint 931 951 0.8000 1.0000 2.0000 0.0000 Constraint 931 944 0.8000 1.0000 2.0000 0.0000 Constraint 931 939 0.8000 1.0000 2.0000 0.0000 Constraint 924 1476 0.8000 1.0000 2.0000 0.0000 Constraint 924 1467 0.8000 1.0000 2.0000 0.0000 Constraint 924 1451 0.8000 1.0000 2.0000 0.0000 Constraint 924 1442 0.8000 1.0000 2.0000 0.0000 Constraint 924 1413 0.8000 1.0000 2.0000 0.0000 Constraint 924 1386 0.8000 1.0000 2.0000 0.0000 Constraint 924 1381 0.8000 1.0000 2.0000 0.0000 Constraint 924 1373 0.8000 1.0000 2.0000 0.0000 Constraint 924 1362 0.8000 1.0000 2.0000 0.0000 Constraint 924 1354 0.8000 1.0000 2.0000 0.0000 Constraint 924 1347 0.8000 1.0000 2.0000 0.0000 Constraint 924 1318 0.8000 1.0000 2.0000 0.0000 Constraint 924 1306 0.8000 1.0000 2.0000 0.0000 Constraint 924 1281 0.8000 1.0000 2.0000 0.0000 Constraint 924 1264 0.8000 1.0000 2.0000 0.0000 Constraint 924 1235 0.8000 1.0000 2.0000 0.0000 Constraint 924 1192 0.8000 1.0000 2.0000 0.0000 Constraint 924 1174 0.8000 1.0000 2.0000 0.0000 Constraint 924 1144 0.8000 1.0000 2.0000 0.0000 Constraint 924 981 0.8000 1.0000 2.0000 0.0000 Constraint 924 973 0.8000 1.0000 2.0000 0.0000 Constraint 924 967 0.8000 1.0000 2.0000 0.0000 Constraint 924 958 0.8000 1.0000 2.0000 0.0000 Constraint 924 951 0.8000 1.0000 2.0000 0.0000 Constraint 924 944 0.8000 1.0000 2.0000 0.0000 Constraint 924 939 0.8000 1.0000 2.0000 0.0000 Constraint 924 931 0.8000 1.0000 2.0000 0.0000 Constraint 915 1476 0.8000 1.0000 2.0000 0.0000 Constraint 915 1467 0.8000 1.0000 2.0000 0.0000 Constraint 915 1459 0.8000 1.0000 2.0000 0.0000 Constraint 915 1451 0.8000 1.0000 2.0000 0.0000 Constraint 915 1442 0.8000 1.0000 2.0000 0.0000 Constraint 915 1430 0.8000 1.0000 2.0000 0.0000 Constraint 915 1421 0.8000 1.0000 2.0000 0.0000 Constraint 915 1413 0.8000 1.0000 2.0000 0.0000 Constraint 915 1402 0.8000 1.0000 2.0000 0.0000 Constraint 915 1395 0.8000 1.0000 2.0000 0.0000 Constraint 915 1386 0.8000 1.0000 2.0000 0.0000 Constraint 915 1381 0.8000 1.0000 2.0000 0.0000 Constraint 915 1373 0.8000 1.0000 2.0000 0.0000 Constraint 915 1362 0.8000 1.0000 2.0000 0.0000 Constraint 915 1354 0.8000 1.0000 2.0000 0.0000 Constraint 915 1347 0.8000 1.0000 2.0000 0.0000 Constraint 915 1339 0.8000 1.0000 2.0000 0.0000 Constraint 915 1329 0.8000 1.0000 2.0000 0.0000 Constraint 915 1318 0.8000 1.0000 2.0000 0.0000 Constraint 915 1306 0.8000 1.0000 2.0000 0.0000 Constraint 915 1295 0.8000 1.0000 2.0000 0.0000 Constraint 915 1288 0.8000 1.0000 2.0000 0.0000 Constraint 915 1281 0.8000 1.0000 2.0000 0.0000 Constraint 915 1272 0.8000 1.0000 2.0000 0.0000 Constraint 915 1264 0.8000 1.0000 2.0000 0.0000 Constraint 915 1256 0.8000 1.0000 2.0000 0.0000 Constraint 915 1244 0.8000 1.0000 2.0000 0.0000 Constraint 915 1235 0.8000 1.0000 2.0000 0.0000 Constraint 915 1225 0.8000 1.0000 2.0000 0.0000 Constraint 915 1213 0.8000 1.0000 2.0000 0.0000 Constraint 915 1208 0.8000 1.0000 2.0000 0.0000 Constraint 915 1201 0.8000 1.0000 2.0000 0.0000 Constraint 915 1186 0.8000 1.0000 2.0000 0.0000 Constraint 915 1174 0.8000 1.0000 2.0000 0.0000 Constraint 915 1168 0.8000 1.0000 2.0000 0.0000 Constraint 915 1159 0.8000 1.0000 2.0000 0.0000 Constraint 915 1144 0.8000 1.0000 2.0000 0.0000 Constraint 915 1133 0.8000 1.0000 2.0000 0.0000 Constraint 915 1095 0.8000 1.0000 2.0000 0.0000 Constraint 915 1087 0.8000 1.0000 2.0000 0.0000 Constraint 915 1075 0.8000 1.0000 2.0000 0.0000 Constraint 915 1066 0.8000 1.0000 2.0000 0.0000 Constraint 915 1051 0.8000 1.0000 2.0000 0.0000 Constraint 915 1039 0.8000 1.0000 2.0000 0.0000 Constraint 915 1031 0.8000 1.0000 2.0000 0.0000 Constraint 915 973 0.8000 1.0000 2.0000 0.0000 Constraint 915 967 0.8000 1.0000 2.0000 0.0000 Constraint 915 958 0.8000 1.0000 2.0000 0.0000 Constraint 915 951 0.8000 1.0000 2.0000 0.0000 Constraint 915 944 0.8000 1.0000 2.0000 0.0000 Constraint 915 939 0.8000 1.0000 2.0000 0.0000 Constraint 915 931 0.8000 1.0000 2.0000 0.0000 Constraint 915 924 0.8000 1.0000 2.0000 0.0000 Constraint 907 1476 0.8000 1.0000 2.0000 0.0000 Constraint 907 1467 0.8000 1.0000 2.0000 0.0000 Constraint 907 1459 0.8000 1.0000 2.0000 0.0000 Constraint 907 1442 0.8000 1.0000 2.0000 0.0000 Constraint 907 1430 0.8000 1.0000 2.0000 0.0000 Constraint 907 1421 0.8000 1.0000 2.0000 0.0000 Constraint 907 1413 0.8000 1.0000 2.0000 0.0000 Constraint 907 1402 0.8000 1.0000 2.0000 0.0000 Constraint 907 1395 0.8000 1.0000 2.0000 0.0000 Constraint 907 1386 0.8000 1.0000 2.0000 0.0000 Constraint 907 1381 0.8000 1.0000 2.0000 0.0000 Constraint 907 1373 0.8000 1.0000 2.0000 0.0000 Constraint 907 1362 0.8000 1.0000 2.0000 0.0000 Constraint 907 1354 0.8000 1.0000 2.0000 0.0000 Constraint 907 1347 0.8000 1.0000 2.0000 0.0000 Constraint 907 1339 0.8000 1.0000 2.0000 0.0000 Constraint 907 1329 0.8000 1.0000 2.0000 0.0000 Constraint 907 1318 0.8000 1.0000 2.0000 0.0000 Constraint 907 1306 0.8000 1.0000 2.0000 0.0000 Constraint 907 1295 0.8000 1.0000 2.0000 0.0000 Constraint 907 1288 0.8000 1.0000 2.0000 0.0000 Constraint 907 1244 0.8000 1.0000 2.0000 0.0000 Constraint 907 1225 0.8000 1.0000 2.0000 0.0000 Constraint 907 1201 0.8000 1.0000 2.0000 0.0000 Constraint 907 1192 0.8000 1.0000 2.0000 0.0000 Constraint 907 1186 0.8000 1.0000 2.0000 0.0000 Constraint 907 1174 0.8000 1.0000 2.0000 0.0000 Constraint 907 1168 0.8000 1.0000 2.0000 0.0000 Constraint 907 1159 0.8000 1.0000 2.0000 0.0000 Constraint 907 1150 0.8000 1.0000 2.0000 0.0000 Constraint 907 1144 0.8000 1.0000 2.0000 0.0000 Constraint 907 1095 0.8000 1.0000 2.0000 0.0000 Constraint 907 1075 0.8000 1.0000 2.0000 0.0000 Constraint 907 1066 0.8000 1.0000 2.0000 0.0000 Constraint 907 967 0.8000 1.0000 2.0000 0.0000 Constraint 907 958 0.8000 1.0000 2.0000 0.0000 Constraint 907 951 0.8000 1.0000 2.0000 0.0000 Constraint 907 944 0.8000 1.0000 2.0000 0.0000 Constraint 907 939 0.8000 1.0000 2.0000 0.0000 Constraint 907 931 0.8000 1.0000 2.0000 0.0000 Constraint 907 924 0.8000 1.0000 2.0000 0.0000 Constraint 907 915 0.8000 1.0000 2.0000 0.0000 Constraint 900 1476 0.8000 1.0000 2.0000 0.0000 Constraint 900 1467 0.8000 1.0000 2.0000 0.0000 Constraint 900 1459 0.8000 1.0000 2.0000 0.0000 Constraint 900 1442 0.8000 1.0000 2.0000 0.0000 Constraint 900 1413 0.8000 1.0000 2.0000 0.0000 Constraint 900 1402 0.8000 1.0000 2.0000 0.0000 Constraint 900 1395 0.8000 1.0000 2.0000 0.0000 Constraint 900 1381 0.8000 1.0000 2.0000 0.0000 Constraint 900 1373 0.8000 1.0000 2.0000 0.0000 Constraint 900 1362 0.8000 1.0000 2.0000 0.0000 Constraint 900 1354 0.8000 1.0000 2.0000 0.0000 Constraint 900 1347 0.8000 1.0000 2.0000 0.0000 Constraint 900 1339 0.8000 1.0000 2.0000 0.0000 Constraint 900 1329 0.8000 1.0000 2.0000 0.0000 Constraint 900 1318 0.8000 1.0000 2.0000 0.0000 Constraint 900 1306 0.8000 1.0000 2.0000 0.0000 Constraint 900 1295 0.8000 1.0000 2.0000 0.0000 Constraint 900 1288 0.8000 1.0000 2.0000 0.0000 Constraint 900 1281 0.8000 1.0000 2.0000 0.0000 Constraint 900 1272 0.8000 1.0000 2.0000 0.0000 Constraint 900 1264 0.8000 1.0000 2.0000 0.0000 Constraint 900 1244 0.8000 1.0000 2.0000 0.0000 Constraint 900 1235 0.8000 1.0000 2.0000 0.0000 Constraint 900 1225 0.8000 1.0000 2.0000 0.0000 Constraint 900 1174 0.8000 1.0000 2.0000 0.0000 Constraint 900 1168 0.8000 1.0000 2.0000 0.0000 Constraint 900 1095 0.8000 1.0000 2.0000 0.0000 Constraint 900 1075 0.8000 1.0000 2.0000 0.0000 Constraint 900 958 0.8000 1.0000 2.0000 0.0000 Constraint 900 951 0.8000 1.0000 2.0000 0.0000 Constraint 900 944 0.8000 1.0000 2.0000 0.0000 Constraint 900 939 0.8000 1.0000 2.0000 0.0000 Constraint 900 931 0.8000 1.0000 2.0000 0.0000 Constraint 900 924 0.8000 1.0000 2.0000 0.0000 Constraint 900 915 0.8000 1.0000 2.0000 0.0000 Constraint 900 907 0.8000 1.0000 2.0000 0.0000 Constraint 892 1476 0.8000 1.0000 2.0000 0.0000 Constraint 892 1467 0.8000 1.0000 2.0000 0.0000 Constraint 892 1459 0.8000 1.0000 2.0000 0.0000 Constraint 892 1451 0.8000 1.0000 2.0000 0.0000 Constraint 892 1442 0.8000 1.0000 2.0000 0.0000 Constraint 892 1430 0.8000 1.0000 2.0000 0.0000 Constraint 892 1421 0.8000 1.0000 2.0000 0.0000 Constraint 892 1413 0.8000 1.0000 2.0000 0.0000 Constraint 892 1395 0.8000 1.0000 2.0000 0.0000 Constraint 892 1386 0.8000 1.0000 2.0000 0.0000 Constraint 892 1381 0.8000 1.0000 2.0000 0.0000 Constraint 892 1373 0.8000 1.0000 2.0000 0.0000 Constraint 892 1362 0.8000 1.0000 2.0000 0.0000 Constraint 892 1354 0.8000 1.0000 2.0000 0.0000 Constraint 892 1339 0.8000 1.0000 2.0000 0.0000 Constraint 892 1329 0.8000 1.0000 2.0000 0.0000 Constraint 892 1318 0.8000 1.0000 2.0000 0.0000 Constraint 892 1306 0.8000 1.0000 2.0000 0.0000 Constraint 892 1295 0.8000 1.0000 2.0000 0.0000 Constraint 892 1288 0.8000 1.0000 2.0000 0.0000 Constraint 892 1281 0.8000 1.0000 2.0000 0.0000 Constraint 892 1272 0.8000 1.0000 2.0000 0.0000 Constraint 892 1264 0.8000 1.0000 2.0000 0.0000 Constraint 892 1256 0.8000 1.0000 2.0000 0.0000 Constraint 892 1244 0.8000 1.0000 2.0000 0.0000 Constraint 892 1235 0.8000 1.0000 2.0000 0.0000 Constraint 892 1225 0.8000 1.0000 2.0000 0.0000 Constraint 892 1213 0.8000 1.0000 2.0000 0.0000 Constraint 892 1208 0.8000 1.0000 2.0000 0.0000 Constraint 892 1201 0.8000 1.0000 2.0000 0.0000 Constraint 892 1168 0.8000 1.0000 2.0000 0.0000 Constraint 892 1159 0.8000 1.0000 2.0000 0.0000 Constraint 892 1144 0.8000 1.0000 2.0000 0.0000 Constraint 892 1133 0.8000 1.0000 2.0000 0.0000 Constraint 892 1124 0.8000 1.0000 2.0000 0.0000 Constraint 892 1024 0.8000 1.0000 2.0000 0.0000 Constraint 892 1015 0.8000 1.0000 2.0000 0.0000 Constraint 892 1007 0.8000 1.0000 2.0000 0.0000 Constraint 892 990 0.8000 1.0000 2.0000 0.0000 Constraint 892 958 0.8000 1.0000 2.0000 0.0000 Constraint 892 951 0.8000 1.0000 2.0000 0.0000 Constraint 892 944 0.8000 1.0000 2.0000 0.0000 Constraint 892 939 0.8000 1.0000 2.0000 0.0000 Constraint 892 931 0.8000 1.0000 2.0000 0.0000 Constraint 892 924 0.8000 1.0000 2.0000 0.0000 Constraint 892 915 0.8000 1.0000 2.0000 0.0000 Constraint 892 907 0.8000 1.0000 2.0000 0.0000 Constraint 892 900 0.8000 1.0000 2.0000 0.0000 Constraint 884 1476 0.8000 1.0000 2.0000 0.0000 Constraint 884 1467 0.8000 1.0000 2.0000 0.0000 Constraint 884 1459 0.8000 1.0000 2.0000 0.0000 Constraint 884 1451 0.8000 1.0000 2.0000 0.0000 Constraint 884 1442 0.8000 1.0000 2.0000 0.0000 Constraint 884 1430 0.8000 1.0000 2.0000 0.0000 Constraint 884 1421 0.8000 1.0000 2.0000 0.0000 Constraint 884 1413 0.8000 1.0000 2.0000 0.0000 Constraint 884 1402 0.8000 1.0000 2.0000 0.0000 Constraint 884 1381 0.8000 1.0000 2.0000 0.0000 Constraint 884 1373 0.8000 1.0000 2.0000 0.0000 Constraint 884 1362 0.8000 1.0000 2.0000 0.0000 Constraint 884 1354 0.8000 1.0000 2.0000 0.0000 Constraint 884 1347 0.8000 1.0000 2.0000 0.0000 Constraint 884 1329 0.8000 1.0000 2.0000 0.0000 Constraint 884 1306 0.8000 1.0000 2.0000 0.0000 Constraint 884 1295 0.8000 1.0000 2.0000 0.0000 Constraint 884 1288 0.8000 1.0000 2.0000 0.0000 Constraint 884 1281 0.8000 1.0000 2.0000 0.0000 Constraint 884 1272 0.8000 1.0000 2.0000 0.0000 Constraint 884 1264 0.8000 1.0000 2.0000 0.0000 Constraint 884 1256 0.8000 1.0000 2.0000 0.0000 Constraint 884 1235 0.8000 1.0000 2.0000 0.0000 Constraint 884 1225 0.8000 1.0000 2.0000 0.0000 Constraint 884 1144 0.8000 1.0000 2.0000 0.0000 Constraint 884 1124 0.8000 1.0000 2.0000 0.0000 Constraint 884 1007 0.8000 1.0000 2.0000 0.0000 Constraint 884 998 0.8000 1.0000 2.0000 0.0000 Constraint 884 958 0.8000 1.0000 2.0000 0.0000 Constraint 884 944 0.8000 1.0000 2.0000 0.0000 Constraint 884 939 0.8000 1.0000 2.0000 0.0000 Constraint 884 931 0.8000 1.0000 2.0000 0.0000 Constraint 884 924 0.8000 1.0000 2.0000 0.0000 Constraint 884 915 0.8000 1.0000 2.0000 0.0000 Constraint 884 907 0.8000 1.0000 2.0000 0.0000 Constraint 884 900 0.8000 1.0000 2.0000 0.0000 Constraint 884 892 0.8000 1.0000 2.0000 0.0000 Constraint 871 1476 0.8000 1.0000 2.0000 0.0000 Constraint 871 1467 0.8000 1.0000 2.0000 0.0000 Constraint 871 1459 0.8000 1.0000 2.0000 0.0000 Constraint 871 1451 0.8000 1.0000 2.0000 0.0000 Constraint 871 1442 0.8000 1.0000 2.0000 0.0000 Constraint 871 1430 0.8000 1.0000 2.0000 0.0000 Constraint 871 1421 0.8000 1.0000 2.0000 0.0000 Constraint 871 1413 0.8000 1.0000 2.0000 0.0000 Constraint 871 1395 0.8000 1.0000 2.0000 0.0000 Constraint 871 1381 0.8000 1.0000 2.0000 0.0000 Constraint 871 1362 0.8000 1.0000 2.0000 0.0000 Constraint 871 1354 0.8000 1.0000 2.0000 0.0000 Constraint 871 1347 0.8000 1.0000 2.0000 0.0000 Constraint 871 1339 0.8000 1.0000 2.0000 0.0000 Constraint 871 1329 0.8000 1.0000 2.0000 0.0000 Constraint 871 1318 0.8000 1.0000 2.0000 0.0000 Constraint 871 1306 0.8000 1.0000 2.0000 0.0000 Constraint 871 1295 0.8000 1.0000 2.0000 0.0000 Constraint 871 1288 0.8000 1.0000 2.0000 0.0000 Constraint 871 1281 0.8000 1.0000 2.0000 0.0000 Constraint 871 1272 0.8000 1.0000 2.0000 0.0000 Constraint 871 1264 0.8000 1.0000 2.0000 0.0000 Constraint 871 1256 0.8000 1.0000 2.0000 0.0000 Constraint 871 1244 0.8000 1.0000 2.0000 0.0000 Constraint 871 1235 0.8000 1.0000 2.0000 0.0000 Constraint 871 1225 0.8000 1.0000 2.0000 0.0000 Constraint 871 981 0.8000 1.0000 2.0000 0.0000 Constraint 871 939 0.8000 1.0000 2.0000 0.0000 Constraint 871 931 0.8000 1.0000 2.0000 0.0000 Constraint 871 924 0.8000 1.0000 2.0000 0.0000 Constraint 871 915 0.8000 1.0000 2.0000 0.0000 Constraint 871 907 0.8000 1.0000 2.0000 0.0000 Constraint 871 900 0.8000 1.0000 2.0000 0.0000 Constraint 871 892 0.8000 1.0000 2.0000 0.0000 Constraint 871 884 0.8000 1.0000 2.0000 0.0000 Constraint 864 1476 0.8000 1.0000 2.0000 0.0000 Constraint 864 1467 0.8000 1.0000 2.0000 0.0000 Constraint 864 1459 0.8000 1.0000 2.0000 0.0000 Constraint 864 1451 0.8000 1.0000 2.0000 0.0000 Constraint 864 1442 0.8000 1.0000 2.0000 0.0000 Constraint 864 1421 0.8000 1.0000 2.0000 0.0000 Constraint 864 1413 0.8000 1.0000 2.0000 0.0000 Constraint 864 1402 0.8000 1.0000 2.0000 0.0000 Constraint 864 1395 0.8000 1.0000 2.0000 0.0000 Constraint 864 1386 0.8000 1.0000 2.0000 0.0000 Constraint 864 1381 0.8000 1.0000 2.0000 0.0000 Constraint 864 1362 0.8000 1.0000 2.0000 0.0000 Constraint 864 1354 0.8000 1.0000 2.0000 0.0000 Constraint 864 1347 0.8000 1.0000 2.0000 0.0000 Constraint 864 1318 0.8000 1.0000 2.0000 0.0000 Constraint 864 1306 0.8000 1.0000 2.0000 0.0000 Constraint 864 1264 0.8000 1.0000 2.0000 0.0000 Constraint 864 1256 0.8000 1.0000 2.0000 0.0000 Constraint 864 1244 0.8000 1.0000 2.0000 0.0000 Constraint 864 1208 0.8000 1.0000 2.0000 0.0000 Constraint 864 1168 0.8000 1.0000 2.0000 0.0000 Constraint 864 924 0.8000 1.0000 2.0000 0.0000 Constraint 864 915 0.8000 1.0000 2.0000 0.0000 Constraint 864 907 0.8000 1.0000 2.0000 0.0000 Constraint 864 900 0.8000 1.0000 2.0000 0.0000 Constraint 864 892 0.8000 1.0000 2.0000 0.0000 Constraint 864 884 0.8000 1.0000 2.0000 0.0000 Constraint 864 871 0.8000 1.0000 2.0000 0.0000 Constraint 852 1476 0.8000 1.0000 2.0000 0.0000 Constraint 852 1467 0.8000 1.0000 2.0000 0.0000 Constraint 852 1459 0.8000 1.0000 2.0000 0.0000 Constraint 852 1451 0.8000 1.0000 2.0000 0.0000 Constraint 852 1442 0.8000 1.0000 2.0000 0.0000 Constraint 852 1413 0.8000 1.0000 2.0000 0.0000 Constraint 852 1402 0.8000 1.0000 2.0000 0.0000 Constraint 852 1386 0.8000 1.0000 2.0000 0.0000 Constraint 852 1381 0.8000 1.0000 2.0000 0.0000 Constraint 852 1354 0.8000 1.0000 2.0000 0.0000 Constraint 852 1347 0.8000 1.0000 2.0000 0.0000 Constraint 852 1329 0.8000 1.0000 2.0000 0.0000 Constraint 852 1318 0.8000 1.0000 2.0000 0.0000 Constraint 852 1306 0.8000 1.0000 2.0000 0.0000 Constraint 852 1288 0.8000 1.0000 2.0000 0.0000 Constraint 852 1281 0.8000 1.0000 2.0000 0.0000 Constraint 852 1272 0.8000 1.0000 2.0000 0.0000 Constraint 852 1264 0.8000 1.0000 2.0000 0.0000 Constraint 852 1235 0.8000 1.0000 2.0000 0.0000 Constraint 852 1208 0.8000 1.0000 2.0000 0.0000 Constraint 852 1192 0.8000 1.0000 2.0000 0.0000 Constraint 852 981 0.8000 1.0000 2.0000 0.0000 Constraint 852 967 0.8000 1.0000 2.0000 0.0000 Constraint 852 958 0.8000 1.0000 2.0000 0.0000 Constraint 852 939 0.8000 1.0000 2.0000 0.0000 Constraint 852 915 0.8000 1.0000 2.0000 0.0000 Constraint 852 907 0.8000 1.0000 2.0000 0.0000 Constraint 852 900 0.8000 1.0000 2.0000 0.0000 Constraint 852 892 0.8000 1.0000 2.0000 0.0000 Constraint 852 884 0.8000 1.0000 2.0000 0.0000 Constraint 852 871 0.8000 1.0000 2.0000 0.0000 Constraint 852 864 0.8000 1.0000 2.0000 0.0000 Constraint 841 1476 0.8000 1.0000 2.0000 0.0000 Constraint 841 1467 0.8000 1.0000 2.0000 0.0000 Constraint 841 1451 0.8000 1.0000 2.0000 0.0000 Constraint 841 1442 0.8000 1.0000 2.0000 0.0000 Constraint 841 1421 0.8000 1.0000 2.0000 0.0000 Constraint 841 1413 0.8000 1.0000 2.0000 0.0000 Constraint 841 1402 0.8000 1.0000 2.0000 0.0000 Constraint 841 1395 0.8000 1.0000 2.0000 0.0000 Constraint 841 1386 0.8000 1.0000 2.0000 0.0000 Constraint 841 1381 0.8000 1.0000 2.0000 0.0000 Constraint 841 1362 0.8000 1.0000 2.0000 0.0000 Constraint 841 1354 0.8000 1.0000 2.0000 0.0000 Constraint 841 1347 0.8000 1.0000 2.0000 0.0000 Constraint 841 1306 0.8000 1.0000 2.0000 0.0000 Constraint 841 1288 0.8000 1.0000 2.0000 0.0000 Constraint 841 1281 0.8000 1.0000 2.0000 0.0000 Constraint 841 1272 0.8000 1.0000 2.0000 0.0000 Constraint 841 1264 0.8000 1.0000 2.0000 0.0000 Constraint 841 1256 0.8000 1.0000 2.0000 0.0000 Constraint 841 1244 0.8000 1.0000 2.0000 0.0000 Constraint 841 1235 0.8000 1.0000 2.0000 0.0000 Constraint 841 1213 0.8000 1.0000 2.0000 0.0000 Constraint 841 1159 0.8000 1.0000 2.0000 0.0000 Constraint 841 1150 0.8000 1.0000 2.0000 0.0000 Constraint 841 998 0.8000 1.0000 2.0000 0.0000 Constraint 841 939 0.8000 1.0000 2.0000 0.0000 Constraint 841 907 0.8000 1.0000 2.0000 0.0000 Constraint 841 900 0.8000 1.0000 2.0000 0.0000 Constraint 841 892 0.8000 1.0000 2.0000 0.0000 Constraint 841 884 0.8000 1.0000 2.0000 0.0000 Constraint 841 871 0.8000 1.0000 2.0000 0.0000 Constraint 841 864 0.8000 1.0000 2.0000 0.0000 Constraint 841 852 0.8000 1.0000 2.0000 0.0000 Constraint 833 1476 0.8000 1.0000 2.0000 0.0000 Constraint 833 1467 0.8000 1.0000 2.0000 0.0000 Constraint 833 1459 0.8000 1.0000 2.0000 0.0000 Constraint 833 1413 0.8000 1.0000 2.0000 0.0000 Constraint 833 1402 0.8000 1.0000 2.0000 0.0000 Constraint 833 1386 0.8000 1.0000 2.0000 0.0000 Constraint 833 1381 0.8000 1.0000 2.0000 0.0000 Constraint 833 1362 0.8000 1.0000 2.0000 0.0000 Constraint 833 1354 0.8000 1.0000 2.0000 0.0000 Constraint 833 1288 0.8000 1.0000 2.0000 0.0000 Constraint 833 1272 0.8000 1.0000 2.0000 0.0000 Constraint 833 1235 0.8000 1.0000 2.0000 0.0000 Constraint 833 1208 0.8000 1.0000 2.0000 0.0000 Constraint 833 1174 0.8000 1.0000 2.0000 0.0000 Constraint 833 1159 0.8000 1.0000 2.0000 0.0000 Constraint 833 1150 0.8000 1.0000 2.0000 0.0000 Constraint 833 967 0.8000 1.0000 2.0000 0.0000 Constraint 833 939 0.8000 1.0000 2.0000 0.0000 Constraint 833 900 0.8000 1.0000 2.0000 0.0000 Constraint 833 892 0.8000 1.0000 2.0000 0.0000 Constraint 833 884 0.8000 1.0000 2.0000 0.0000 Constraint 833 871 0.8000 1.0000 2.0000 0.0000 Constraint 833 864 0.8000 1.0000 2.0000 0.0000 Constraint 833 852 0.8000 1.0000 2.0000 0.0000 Constraint 833 841 0.8000 1.0000 2.0000 0.0000 Constraint 822 1476 0.8000 1.0000 2.0000 0.0000 Constraint 822 1467 0.8000 1.0000 2.0000 0.0000 Constraint 822 1459 0.8000 1.0000 2.0000 0.0000 Constraint 822 1442 0.8000 1.0000 2.0000 0.0000 Constraint 822 1430 0.8000 1.0000 2.0000 0.0000 Constraint 822 1421 0.8000 1.0000 2.0000 0.0000 Constraint 822 1413 0.8000 1.0000 2.0000 0.0000 Constraint 822 1402 0.8000 1.0000 2.0000 0.0000 Constraint 822 1395 0.8000 1.0000 2.0000 0.0000 Constraint 822 1386 0.8000 1.0000 2.0000 0.0000 Constraint 822 1381 0.8000 1.0000 2.0000 0.0000 Constraint 822 1373 0.8000 1.0000 2.0000 0.0000 Constraint 822 1362 0.8000 1.0000 2.0000 0.0000 Constraint 822 1354 0.8000 1.0000 2.0000 0.0000 Constraint 822 1347 0.8000 1.0000 2.0000 0.0000 Constraint 822 1339 0.8000 1.0000 2.0000 0.0000 Constraint 822 1329 0.8000 1.0000 2.0000 0.0000 Constraint 822 1318 0.8000 1.0000 2.0000 0.0000 Constraint 822 1288 0.8000 1.0000 2.0000 0.0000 Constraint 822 1281 0.8000 1.0000 2.0000 0.0000 Constraint 822 1272 0.8000 1.0000 2.0000 0.0000 Constraint 822 1264 0.8000 1.0000 2.0000 0.0000 Constraint 822 1256 0.8000 1.0000 2.0000 0.0000 Constraint 822 1244 0.8000 1.0000 2.0000 0.0000 Constraint 822 1235 0.8000 1.0000 2.0000 0.0000 Constraint 822 1186 0.8000 1.0000 2.0000 0.0000 Constraint 822 1174 0.8000 1.0000 2.0000 0.0000 Constraint 822 1168 0.8000 1.0000 2.0000 0.0000 Constraint 822 1159 0.8000 1.0000 2.0000 0.0000 Constraint 822 1150 0.8000 1.0000 2.0000 0.0000 Constraint 822 939 0.8000 1.0000 2.0000 0.0000 Constraint 822 931 0.8000 1.0000 2.0000 0.0000 Constraint 822 892 0.8000 1.0000 2.0000 0.0000 Constraint 822 884 0.8000 1.0000 2.0000 0.0000 Constraint 822 871 0.8000 1.0000 2.0000 0.0000 Constraint 822 864 0.8000 1.0000 2.0000 0.0000 Constraint 822 852 0.8000 1.0000 2.0000 0.0000 Constraint 822 841 0.8000 1.0000 2.0000 0.0000 Constraint 822 833 0.8000 1.0000 2.0000 0.0000 Constraint 814 1476 0.8000 1.0000 2.0000 0.0000 Constraint 814 1467 0.8000 1.0000 2.0000 0.0000 Constraint 814 1442 0.8000 1.0000 2.0000 0.0000 Constraint 814 1421 0.8000 1.0000 2.0000 0.0000 Constraint 814 1413 0.8000 1.0000 2.0000 0.0000 Constraint 814 1402 0.8000 1.0000 2.0000 0.0000 Constraint 814 1395 0.8000 1.0000 2.0000 0.0000 Constraint 814 1386 0.8000 1.0000 2.0000 0.0000 Constraint 814 1381 0.8000 1.0000 2.0000 0.0000 Constraint 814 1373 0.8000 1.0000 2.0000 0.0000 Constraint 814 1362 0.8000 1.0000 2.0000 0.0000 Constraint 814 1354 0.8000 1.0000 2.0000 0.0000 Constraint 814 1347 0.8000 1.0000 2.0000 0.0000 Constraint 814 1339 0.8000 1.0000 2.0000 0.0000 Constraint 814 1318 0.8000 1.0000 2.0000 0.0000 Constraint 814 1295 0.8000 1.0000 2.0000 0.0000 Constraint 814 1264 0.8000 1.0000 2.0000 0.0000 Constraint 814 1244 0.8000 1.0000 2.0000 0.0000 Constraint 814 1186 0.8000 1.0000 2.0000 0.0000 Constraint 814 1168 0.8000 1.0000 2.0000 0.0000 Constraint 814 1150 0.8000 1.0000 2.0000 0.0000 Constraint 814 907 0.8000 1.0000 2.0000 0.0000 Constraint 814 892 0.8000 1.0000 2.0000 0.0000 Constraint 814 884 0.8000 1.0000 2.0000 0.0000 Constraint 814 871 0.8000 1.0000 2.0000 0.0000 Constraint 814 864 0.8000 1.0000 2.0000 0.0000 Constraint 814 852 0.8000 1.0000 2.0000 0.0000 Constraint 814 841 0.8000 1.0000 2.0000 0.0000 Constraint 814 833 0.8000 1.0000 2.0000 0.0000 Constraint 814 822 0.8000 1.0000 2.0000 0.0000 Constraint 805 1476 0.8000 1.0000 2.0000 0.0000 Constraint 805 1467 0.8000 1.0000 2.0000 0.0000 Constraint 805 1459 0.8000 1.0000 2.0000 0.0000 Constraint 805 1451 0.8000 1.0000 2.0000 0.0000 Constraint 805 1442 0.8000 1.0000 2.0000 0.0000 Constraint 805 1430 0.8000 1.0000 2.0000 0.0000 Constraint 805 1421 0.8000 1.0000 2.0000 0.0000 Constraint 805 1413 0.8000 1.0000 2.0000 0.0000 Constraint 805 1402 0.8000 1.0000 2.0000 0.0000 Constraint 805 1395 0.8000 1.0000 2.0000 0.0000 Constraint 805 1386 0.8000 1.0000 2.0000 0.0000 Constraint 805 1381 0.8000 1.0000 2.0000 0.0000 Constraint 805 1373 0.8000 1.0000 2.0000 0.0000 Constraint 805 1362 0.8000 1.0000 2.0000 0.0000 Constraint 805 1354 0.8000 1.0000 2.0000 0.0000 Constraint 805 1347 0.8000 1.0000 2.0000 0.0000 Constraint 805 1339 0.8000 1.0000 2.0000 0.0000 Constraint 805 1329 0.8000 1.0000 2.0000 0.0000 Constraint 805 1318 0.8000 1.0000 2.0000 0.0000 Constraint 805 1306 0.8000 1.0000 2.0000 0.0000 Constraint 805 1295 0.8000 1.0000 2.0000 0.0000 Constraint 805 1288 0.8000 1.0000 2.0000 0.0000 Constraint 805 1281 0.8000 1.0000 2.0000 0.0000 Constraint 805 1272 0.8000 1.0000 2.0000 0.0000 Constraint 805 1264 0.8000 1.0000 2.0000 0.0000 Constraint 805 1256 0.8000 1.0000 2.0000 0.0000 Constraint 805 1244 0.8000 1.0000 2.0000 0.0000 Constraint 805 1235 0.8000 1.0000 2.0000 0.0000 Constraint 805 1208 0.8000 1.0000 2.0000 0.0000 Constraint 805 1201 0.8000 1.0000 2.0000 0.0000 Constraint 805 967 0.8000 1.0000 2.0000 0.0000 Constraint 805 958 0.8000 1.0000 2.0000 0.0000 Constraint 805 907 0.8000 1.0000 2.0000 0.0000 Constraint 805 900 0.8000 1.0000 2.0000 0.0000 Constraint 805 892 0.8000 1.0000 2.0000 0.0000 Constraint 805 871 0.8000 1.0000 2.0000 0.0000 Constraint 805 864 0.8000 1.0000 2.0000 0.0000 Constraint 805 852 0.8000 1.0000 2.0000 0.0000 Constraint 805 841 0.8000 1.0000 2.0000 0.0000 Constraint 805 833 0.8000 1.0000 2.0000 0.0000 Constraint 805 822 0.8000 1.0000 2.0000 0.0000 Constraint 805 814 0.8000 1.0000 2.0000 0.0000 Constraint 794 1476 0.8000 1.0000 2.0000 0.0000 Constraint 794 1467 0.8000 1.0000 2.0000 0.0000 Constraint 794 1459 0.8000 1.0000 2.0000 0.0000 Constraint 794 1451 0.8000 1.0000 2.0000 0.0000 Constraint 794 1442 0.8000 1.0000 2.0000 0.0000 Constraint 794 1430 0.8000 1.0000 2.0000 0.0000 Constraint 794 1421 0.8000 1.0000 2.0000 0.0000 Constraint 794 1413 0.8000 1.0000 2.0000 0.0000 Constraint 794 1402 0.8000 1.0000 2.0000 0.0000 Constraint 794 1395 0.8000 1.0000 2.0000 0.0000 Constraint 794 1386 0.8000 1.0000 2.0000 0.0000 Constraint 794 1381 0.8000 1.0000 2.0000 0.0000 Constraint 794 1373 0.8000 1.0000 2.0000 0.0000 Constraint 794 1362 0.8000 1.0000 2.0000 0.0000 Constraint 794 1354 0.8000 1.0000 2.0000 0.0000 Constraint 794 1347 0.8000 1.0000 2.0000 0.0000 Constraint 794 1339 0.8000 1.0000 2.0000 0.0000 Constraint 794 1329 0.8000 1.0000 2.0000 0.0000 Constraint 794 1318 0.8000 1.0000 2.0000 0.0000 Constraint 794 1306 0.8000 1.0000 2.0000 0.0000 Constraint 794 1295 0.8000 1.0000 2.0000 0.0000 Constraint 794 1288 0.8000 1.0000 2.0000 0.0000 Constraint 794 1281 0.8000 1.0000 2.0000 0.0000 Constraint 794 1272 0.8000 1.0000 2.0000 0.0000 Constraint 794 1264 0.8000 1.0000 2.0000 0.0000 Constraint 794 1256 0.8000 1.0000 2.0000 0.0000 Constraint 794 1244 0.8000 1.0000 2.0000 0.0000 Constraint 794 1235 0.8000 1.0000 2.0000 0.0000 Constraint 794 1225 0.8000 1.0000 2.0000 0.0000 Constraint 794 1213 0.8000 1.0000 2.0000 0.0000 Constraint 794 1208 0.8000 1.0000 2.0000 0.0000 Constraint 794 1201 0.8000 1.0000 2.0000 0.0000 Constraint 794 1186 0.8000 1.0000 2.0000 0.0000 Constraint 794 958 0.8000 1.0000 2.0000 0.0000 Constraint 794 931 0.8000 1.0000 2.0000 0.0000 Constraint 794 924 0.8000 1.0000 2.0000 0.0000 Constraint 794 915 0.8000 1.0000 2.0000 0.0000 Constraint 794 907 0.8000 1.0000 2.0000 0.0000 Constraint 794 892 0.8000 1.0000 2.0000 0.0000 Constraint 794 884 0.8000 1.0000 2.0000 0.0000 Constraint 794 871 0.8000 1.0000 2.0000 0.0000 Constraint 794 864 0.8000 1.0000 2.0000 0.0000 Constraint 794 852 0.8000 1.0000 2.0000 0.0000 Constraint 794 841 0.8000 1.0000 2.0000 0.0000 Constraint 794 833 0.8000 1.0000 2.0000 0.0000 Constraint 794 822 0.8000 1.0000 2.0000 0.0000 Constraint 794 814 0.8000 1.0000 2.0000 0.0000 Constraint 794 805 0.8000 1.0000 2.0000 0.0000 Constraint 789 1476 0.8000 1.0000 2.0000 0.0000 Constraint 789 1467 0.8000 1.0000 2.0000 0.0000 Constraint 789 1459 0.8000 1.0000 2.0000 0.0000 Constraint 789 1451 0.8000 1.0000 2.0000 0.0000 Constraint 789 1442 0.8000 1.0000 2.0000 0.0000 Constraint 789 1430 0.8000 1.0000 2.0000 0.0000 Constraint 789 1421 0.8000 1.0000 2.0000 0.0000 Constraint 789 1413 0.8000 1.0000 2.0000 0.0000 Constraint 789 1402 0.8000 1.0000 2.0000 0.0000 Constraint 789 1395 0.8000 1.0000 2.0000 0.0000 Constraint 789 1386 0.8000 1.0000 2.0000 0.0000 Constraint 789 1381 0.8000 1.0000 2.0000 0.0000 Constraint 789 1373 0.8000 1.0000 2.0000 0.0000 Constraint 789 1362 0.8000 1.0000 2.0000 0.0000 Constraint 789 1354 0.8000 1.0000 2.0000 0.0000 Constraint 789 1347 0.8000 1.0000 2.0000 0.0000 Constraint 789 1339 0.8000 1.0000 2.0000 0.0000 Constraint 789 1329 0.8000 1.0000 2.0000 0.0000 Constraint 789 1318 0.8000 1.0000 2.0000 0.0000 Constraint 789 1306 0.8000 1.0000 2.0000 0.0000 Constraint 789 1295 0.8000 1.0000 2.0000 0.0000 Constraint 789 1288 0.8000 1.0000 2.0000 0.0000 Constraint 789 1281 0.8000 1.0000 2.0000 0.0000 Constraint 789 1272 0.8000 1.0000 2.0000 0.0000 Constraint 789 1264 0.8000 1.0000 2.0000 0.0000 Constraint 789 1256 0.8000 1.0000 2.0000 0.0000 Constraint 789 1244 0.8000 1.0000 2.0000 0.0000 Constraint 789 1235 0.8000 1.0000 2.0000 0.0000 Constraint 789 1225 0.8000 1.0000 2.0000 0.0000 Constraint 789 1213 0.8000 1.0000 2.0000 0.0000 Constraint 789 1208 0.8000 1.0000 2.0000 0.0000 Constraint 789 1201 0.8000 1.0000 2.0000 0.0000 Constraint 789 1124 0.8000 1.0000 2.0000 0.0000 Constraint 789 1106 0.8000 1.0000 2.0000 0.0000 Constraint 789 1095 0.8000 1.0000 2.0000 0.0000 Constraint 789 1051 0.8000 1.0000 2.0000 0.0000 Constraint 789 1007 0.8000 1.0000 2.0000 0.0000 Constraint 789 958 0.8000 1.0000 2.0000 0.0000 Constraint 789 931 0.8000 1.0000 2.0000 0.0000 Constraint 789 924 0.8000 1.0000 2.0000 0.0000 Constraint 789 907 0.8000 1.0000 2.0000 0.0000 Constraint 789 892 0.8000 1.0000 2.0000 0.0000 Constraint 789 871 0.8000 1.0000 2.0000 0.0000 Constraint 789 864 0.8000 1.0000 2.0000 0.0000 Constraint 789 852 0.8000 1.0000 2.0000 0.0000 Constraint 789 841 0.8000 1.0000 2.0000 0.0000 Constraint 789 833 0.8000 1.0000 2.0000 0.0000 Constraint 789 822 0.8000 1.0000 2.0000 0.0000 Constraint 789 814 0.8000 1.0000 2.0000 0.0000 Constraint 789 805 0.8000 1.0000 2.0000 0.0000 Constraint 789 794 0.8000 1.0000 2.0000 0.0000 Constraint 781 1476 0.8000 1.0000 2.0000 0.0000 Constraint 781 1467 0.8000 1.0000 2.0000 0.0000 Constraint 781 1459 0.8000 1.0000 2.0000 0.0000 Constraint 781 1451 0.8000 1.0000 2.0000 0.0000 Constraint 781 1442 0.8000 1.0000 2.0000 0.0000 Constraint 781 1430 0.8000 1.0000 2.0000 0.0000 Constraint 781 1421 0.8000 1.0000 2.0000 0.0000 Constraint 781 1413 0.8000 1.0000 2.0000 0.0000 Constraint 781 1402 0.8000 1.0000 2.0000 0.0000 Constraint 781 1395 0.8000 1.0000 2.0000 0.0000 Constraint 781 1386 0.8000 1.0000 2.0000 0.0000 Constraint 781 1381 0.8000 1.0000 2.0000 0.0000 Constraint 781 1373 0.8000 1.0000 2.0000 0.0000 Constraint 781 1362 0.8000 1.0000 2.0000 0.0000 Constraint 781 1354 0.8000 1.0000 2.0000 0.0000 Constraint 781 1347 0.8000 1.0000 2.0000 0.0000 Constraint 781 1339 0.8000 1.0000 2.0000 0.0000 Constraint 781 1329 0.8000 1.0000 2.0000 0.0000 Constraint 781 1318 0.8000 1.0000 2.0000 0.0000 Constraint 781 1306 0.8000 1.0000 2.0000 0.0000 Constraint 781 1295 0.8000 1.0000 2.0000 0.0000 Constraint 781 1288 0.8000 1.0000 2.0000 0.0000 Constraint 781 1281 0.8000 1.0000 2.0000 0.0000 Constraint 781 1272 0.8000 1.0000 2.0000 0.0000 Constraint 781 1264 0.8000 1.0000 2.0000 0.0000 Constraint 781 1256 0.8000 1.0000 2.0000 0.0000 Constraint 781 1244 0.8000 1.0000 2.0000 0.0000 Constraint 781 1235 0.8000 1.0000 2.0000 0.0000 Constraint 781 1225 0.8000 1.0000 2.0000 0.0000 Constraint 781 1213 0.8000 1.0000 2.0000 0.0000 Constraint 781 1208 0.8000 1.0000 2.0000 0.0000 Constraint 781 1201 0.8000 1.0000 2.0000 0.0000 Constraint 781 1186 0.8000 1.0000 2.0000 0.0000 Constraint 781 1174 0.8000 1.0000 2.0000 0.0000 Constraint 781 1124 0.8000 1.0000 2.0000 0.0000 Constraint 781 1106 0.8000 1.0000 2.0000 0.0000 Constraint 781 1095 0.8000 1.0000 2.0000 0.0000 Constraint 781 1087 0.8000 1.0000 2.0000 0.0000 Constraint 781 1075 0.8000 1.0000 2.0000 0.0000 Constraint 781 1051 0.8000 1.0000 2.0000 0.0000 Constraint 781 1015 0.8000 1.0000 2.0000 0.0000 Constraint 781 1007 0.8000 1.0000 2.0000 0.0000 Constraint 781 931 0.8000 1.0000 2.0000 0.0000 Constraint 781 924 0.8000 1.0000 2.0000 0.0000 Constraint 781 915 0.8000 1.0000 2.0000 0.0000 Constraint 781 907 0.8000 1.0000 2.0000 0.0000 Constraint 781 900 0.8000 1.0000 2.0000 0.0000 Constraint 781 892 0.8000 1.0000 2.0000 0.0000 Constraint 781 884 0.8000 1.0000 2.0000 0.0000 Constraint 781 871 0.8000 1.0000 2.0000 0.0000 Constraint 781 852 0.8000 1.0000 2.0000 0.0000 Constraint 781 841 0.8000 1.0000 2.0000 0.0000 Constraint 781 833 0.8000 1.0000 2.0000 0.0000 Constraint 781 822 0.8000 1.0000 2.0000 0.0000 Constraint 781 814 0.8000 1.0000 2.0000 0.0000 Constraint 781 805 0.8000 1.0000 2.0000 0.0000 Constraint 781 794 0.8000 1.0000 2.0000 0.0000 Constraint 781 789 0.8000 1.0000 2.0000 0.0000 Constraint 773 1476 0.8000 1.0000 2.0000 0.0000 Constraint 773 1467 0.8000 1.0000 2.0000 0.0000 Constraint 773 1459 0.8000 1.0000 2.0000 0.0000 Constraint 773 1451 0.8000 1.0000 2.0000 0.0000 Constraint 773 1442 0.8000 1.0000 2.0000 0.0000 Constraint 773 1430 0.8000 1.0000 2.0000 0.0000 Constraint 773 1421 0.8000 1.0000 2.0000 0.0000 Constraint 773 1413 0.8000 1.0000 2.0000 0.0000 Constraint 773 1402 0.8000 1.0000 2.0000 0.0000 Constraint 773 1395 0.8000 1.0000 2.0000 0.0000 Constraint 773 1386 0.8000 1.0000 2.0000 0.0000 Constraint 773 1381 0.8000 1.0000 2.0000 0.0000 Constraint 773 1373 0.8000 1.0000 2.0000 0.0000 Constraint 773 1362 0.8000 1.0000 2.0000 0.0000 Constraint 773 1354 0.8000 1.0000 2.0000 0.0000 Constraint 773 1347 0.8000 1.0000 2.0000 0.0000 Constraint 773 1339 0.8000 1.0000 2.0000 0.0000 Constraint 773 1329 0.8000 1.0000 2.0000 0.0000 Constraint 773 1306 0.8000 1.0000 2.0000 0.0000 Constraint 773 1295 0.8000 1.0000 2.0000 0.0000 Constraint 773 1281 0.8000 1.0000 2.0000 0.0000 Constraint 773 1272 0.8000 1.0000 2.0000 0.0000 Constraint 773 1264 0.8000 1.0000 2.0000 0.0000 Constraint 773 1256 0.8000 1.0000 2.0000 0.0000 Constraint 773 1244 0.8000 1.0000 2.0000 0.0000 Constraint 773 1235 0.8000 1.0000 2.0000 0.0000 Constraint 773 1225 0.8000 1.0000 2.0000 0.0000 Constraint 773 1213 0.8000 1.0000 2.0000 0.0000 Constraint 773 1208 0.8000 1.0000 2.0000 0.0000 Constraint 773 1201 0.8000 1.0000 2.0000 0.0000 Constraint 773 1192 0.8000 1.0000 2.0000 0.0000 Constraint 773 1186 0.8000 1.0000 2.0000 0.0000 Constraint 773 1124 0.8000 1.0000 2.0000 0.0000 Constraint 773 1106 0.8000 1.0000 2.0000 0.0000 Constraint 773 1095 0.8000 1.0000 2.0000 0.0000 Constraint 773 1051 0.8000 1.0000 2.0000 0.0000 Constraint 773 1039 0.8000 1.0000 2.0000 0.0000 Constraint 773 1031 0.8000 1.0000 2.0000 0.0000 Constraint 773 1015 0.8000 1.0000 2.0000 0.0000 Constraint 773 1007 0.8000 1.0000 2.0000 0.0000 Constraint 773 990 0.8000 1.0000 2.0000 0.0000 Constraint 773 944 0.8000 1.0000 2.0000 0.0000 Constraint 773 924 0.8000 1.0000 2.0000 0.0000 Constraint 773 915 0.8000 1.0000 2.0000 0.0000 Constraint 773 907 0.8000 1.0000 2.0000 0.0000 Constraint 773 900 0.8000 1.0000 2.0000 0.0000 Constraint 773 892 0.8000 1.0000 2.0000 0.0000 Constraint 773 884 0.8000 1.0000 2.0000 0.0000 Constraint 773 841 0.8000 1.0000 2.0000 0.0000 Constraint 773 833 0.8000 1.0000 2.0000 0.0000 Constraint 773 822 0.8000 1.0000 2.0000 0.0000 Constraint 773 814 0.8000 1.0000 2.0000 0.0000 Constraint 773 805 0.8000 1.0000 2.0000 0.0000 Constraint 773 794 0.8000 1.0000 2.0000 0.0000 Constraint 773 789 0.8000 1.0000 2.0000 0.0000 Constraint 773 781 0.8000 1.0000 2.0000 0.0000 Constraint 762 1476 0.8000 1.0000 2.0000 0.0000 Constraint 762 1467 0.8000 1.0000 2.0000 0.0000 Constraint 762 1459 0.8000 1.0000 2.0000 0.0000 Constraint 762 1451 0.8000 1.0000 2.0000 0.0000 Constraint 762 1442 0.8000 1.0000 2.0000 0.0000 Constraint 762 1430 0.8000 1.0000 2.0000 0.0000 Constraint 762 1421 0.8000 1.0000 2.0000 0.0000 Constraint 762 1413 0.8000 1.0000 2.0000 0.0000 Constraint 762 1402 0.8000 1.0000 2.0000 0.0000 Constraint 762 1395 0.8000 1.0000 2.0000 0.0000 Constraint 762 1386 0.8000 1.0000 2.0000 0.0000 Constraint 762 1381 0.8000 1.0000 2.0000 0.0000 Constraint 762 1373 0.8000 1.0000 2.0000 0.0000 Constraint 762 1362 0.8000 1.0000 2.0000 0.0000 Constraint 762 1354 0.8000 1.0000 2.0000 0.0000 Constraint 762 1347 0.8000 1.0000 2.0000 0.0000 Constraint 762 1339 0.8000 1.0000 2.0000 0.0000 Constraint 762 1329 0.8000 1.0000 2.0000 0.0000 Constraint 762 1318 0.8000 1.0000 2.0000 0.0000 Constraint 762 1306 0.8000 1.0000 2.0000 0.0000 Constraint 762 1295 0.8000 1.0000 2.0000 0.0000 Constraint 762 1288 0.8000 1.0000 2.0000 0.0000 Constraint 762 1281 0.8000 1.0000 2.0000 0.0000 Constraint 762 1272 0.8000 1.0000 2.0000 0.0000 Constraint 762 1264 0.8000 1.0000 2.0000 0.0000 Constraint 762 1256 0.8000 1.0000 2.0000 0.0000 Constraint 762 1244 0.8000 1.0000 2.0000 0.0000 Constraint 762 1235 0.8000 1.0000 2.0000 0.0000 Constraint 762 1225 0.8000 1.0000 2.0000 0.0000 Constraint 762 1213 0.8000 1.0000 2.0000 0.0000 Constraint 762 1208 0.8000 1.0000 2.0000 0.0000 Constraint 762 1201 0.8000 1.0000 2.0000 0.0000 Constraint 762 1192 0.8000 1.0000 2.0000 0.0000 Constraint 762 1186 0.8000 1.0000 2.0000 0.0000 Constraint 762 1174 0.8000 1.0000 2.0000 0.0000 Constraint 762 1133 0.8000 1.0000 2.0000 0.0000 Constraint 762 1124 0.8000 1.0000 2.0000 0.0000 Constraint 762 1106 0.8000 1.0000 2.0000 0.0000 Constraint 762 1095 0.8000 1.0000 2.0000 0.0000 Constraint 762 1031 0.8000 1.0000 2.0000 0.0000 Constraint 762 1015 0.8000 1.0000 2.0000 0.0000 Constraint 762 1007 0.8000 1.0000 2.0000 0.0000 Constraint 762 998 0.8000 1.0000 2.0000 0.0000 Constraint 762 951 0.8000 1.0000 2.0000 0.0000 Constraint 762 924 0.8000 1.0000 2.0000 0.0000 Constraint 762 892 0.8000 1.0000 2.0000 0.0000 Constraint 762 871 0.8000 1.0000 2.0000 0.0000 Constraint 762 833 0.8000 1.0000 2.0000 0.0000 Constraint 762 822 0.8000 1.0000 2.0000 0.0000 Constraint 762 814 0.8000 1.0000 2.0000 0.0000 Constraint 762 805 0.8000 1.0000 2.0000 0.0000 Constraint 762 794 0.8000 1.0000 2.0000 0.0000 Constraint 762 789 0.8000 1.0000 2.0000 0.0000 Constraint 762 781 0.8000 1.0000 2.0000 0.0000 Constraint 762 773 0.8000 1.0000 2.0000 0.0000 Constraint 756 1476 0.8000 1.0000 2.0000 0.0000 Constraint 756 1467 0.8000 1.0000 2.0000 0.0000 Constraint 756 1459 0.8000 1.0000 2.0000 0.0000 Constraint 756 1451 0.8000 1.0000 2.0000 0.0000 Constraint 756 1442 0.8000 1.0000 2.0000 0.0000 Constraint 756 1430 0.8000 1.0000 2.0000 0.0000 Constraint 756 1421 0.8000 1.0000 2.0000 0.0000 Constraint 756 1413 0.8000 1.0000 2.0000 0.0000 Constraint 756 1402 0.8000 1.0000 2.0000 0.0000 Constraint 756 1395 0.8000 1.0000 2.0000 0.0000 Constraint 756 1386 0.8000 1.0000 2.0000 0.0000 Constraint 756 1381 0.8000 1.0000 2.0000 0.0000 Constraint 756 1373 0.8000 1.0000 2.0000 0.0000 Constraint 756 1362 0.8000 1.0000 2.0000 0.0000 Constraint 756 1354 0.8000 1.0000 2.0000 0.0000 Constraint 756 1347 0.8000 1.0000 2.0000 0.0000 Constraint 756 1339 0.8000 1.0000 2.0000 0.0000 Constraint 756 1329 0.8000 1.0000 2.0000 0.0000 Constraint 756 1318 0.8000 1.0000 2.0000 0.0000 Constraint 756 1306 0.8000 1.0000 2.0000 0.0000 Constraint 756 1295 0.8000 1.0000 2.0000 0.0000 Constraint 756 1288 0.8000 1.0000 2.0000 0.0000 Constraint 756 1281 0.8000 1.0000 2.0000 0.0000 Constraint 756 1272 0.8000 1.0000 2.0000 0.0000 Constraint 756 1264 0.8000 1.0000 2.0000 0.0000 Constraint 756 1256 0.8000 1.0000 2.0000 0.0000 Constraint 756 1244 0.8000 1.0000 2.0000 0.0000 Constraint 756 1235 0.8000 1.0000 2.0000 0.0000 Constraint 756 1225 0.8000 1.0000 2.0000 0.0000 Constraint 756 1213 0.8000 1.0000 2.0000 0.0000 Constraint 756 1208 0.8000 1.0000 2.0000 0.0000 Constraint 756 1201 0.8000 1.0000 2.0000 0.0000 Constraint 756 1192 0.8000 1.0000 2.0000 0.0000 Constraint 756 1150 0.8000 1.0000 2.0000 0.0000 Constraint 756 1144 0.8000 1.0000 2.0000 0.0000 Constraint 756 1133 0.8000 1.0000 2.0000 0.0000 Constraint 756 1124 0.8000 1.0000 2.0000 0.0000 Constraint 756 1106 0.8000 1.0000 2.0000 0.0000 Constraint 756 1095 0.8000 1.0000 2.0000 0.0000 Constraint 756 1087 0.8000 1.0000 2.0000 0.0000 Constraint 756 1075 0.8000 1.0000 2.0000 0.0000 Constraint 756 1051 0.8000 1.0000 2.0000 0.0000 Constraint 756 1031 0.8000 1.0000 2.0000 0.0000 Constraint 756 1024 0.8000 1.0000 2.0000 0.0000 Constraint 756 1015 0.8000 1.0000 2.0000 0.0000 Constraint 756 1007 0.8000 1.0000 2.0000 0.0000 Constraint 756 973 0.8000 1.0000 2.0000 0.0000 Constraint 756 958 0.8000 1.0000 2.0000 0.0000 Constraint 756 951 0.8000 1.0000 2.0000 0.0000 Constraint 756 871 0.8000 1.0000 2.0000 0.0000 Constraint 756 864 0.8000 1.0000 2.0000 0.0000 Constraint 756 852 0.8000 1.0000 2.0000 0.0000 Constraint 756 822 0.8000 1.0000 2.0000 0.0000 Constraint 756 814 0.8000 1.0000 2.0000 0.0000 Constraint 756 805 0.8000 1.0000 2.0000 0.0000 Constraint 756 794 0.8000 1.0000 2.0000 0.0000 Constraint 756 789 0.8000 1.0000 2.0000 0.0000 Constraint 756 781 0.8000 1.0000 2.0000 0.0000 Constraint 756 773 0.8000 1.0000 2.0000 0.0000 Constraint 756 762 0.8000 1.0000 2.0000 0.0000 Constraint 742 1476 0.8000 1.0000 2.0000 0.0000 Constraint 742 1467 0.8000 1.0000 2.0000 0.0000 Constraint 742 1459 0.8000 1.0000 2.0000 0.0000 Constraint 742 1451 0.8000 1.0000 2.0000 0.0000 Constraint 742 1442 0.8000 1.0000 2.0000 0.0000 Constraint 742 1430 0.8000 1.0000 2.0000 0.0000 Constraint 742 1421 0.8000 1.0000 2.0000 0.0000 Constraint 742 1413 0.8000 1.0000 2.0000 0.0000 Constraint 742 1402 0.8000 1.0000 2.0000 0.0000 Constraint 742 1395 0.8000 1.0000 2.0000 0.0000 Constraint 742 1386 0.8000 1.0000 2.0000 0.0000 Constraint 742 1381 0.8000 1.0000 2.0000 0.0000 Constraint 742 1373 0.8000 1.0000 2.0000 0.0000 Constraint 742 1362 0.8000 1.0000 2.0000 0.0000 Constraint 742 1354 0.8000 1.0000 2.0000 0.0000 Constraint 742 1347 0.8000 1.0000 2.0000 0.0000 Constraint 742 1339 0.8000 1.0000 2.0000 0.0000 Constraint 742 1329 0.8000 1.0000 2.0000 0.0000 Constraint 742 1318 0.8000 1.0000 2.0000 0.0000 Constraint 742 1306 0.8000 1.0000 2.0000 0.0000 Constraint 742 1295 0.8000 1.0000 2.0000 0.0000 Constraint 742 1288 0.8000 1.0000 2.0000 0.0000 Constraint 742 1281 0.8000 1.0000 2.0000 0.0000 Constraint 742 1272 0.8000 1.0000 2.0000 0.0000 Constraint 742 1264 0.8000 1.0000 2.0000 0.0000 Constraint 742 1256 0.8000 1.0000 2.0000 0.0000 Constraint 742 1244 0.8000 1.0000 2.0000 0.0000 Constraint 742 1235 0.8000 1.0000 2.0000 0.0000 Constraint 742 1225 0.8000 1.0000 2.0000 0.0000 Constraint 742 1213 0.8000 1.0000 2.0000 0.0000 Constraint 742 1208 0.8000 1.0000 2.0000 0.0000 Constraint 742 1201 0.8000 1.0000 2.0000 0.0000 Constraint 742 1192 0.8000 1.0000 2.0000 0.0000 Constraint 742 1168 0.8000 1.0000 2.0000 0.0000 Constraint 742 1150 0.8000 1.0000 2.0000 0.0000 Constraint 742 1144 0.8000 1.0000 2.0000 0.0000 Constraint 742 1133 0.8000 1.0000 2.0000 0.0000 Constraint 742 1106 0.8000 1.0000 2.0000 0.0000 Constraint 742 1051 0.8000 1.0000 2.0000 0.0000 Constraint 742 1031 0.8000 1.0000 2.0000 0.0000 Constraint 742 1024 0.8000 1.0000 2.0000 0.0000 Constraint 742 1015 0.8000 1.0000 2.0000 0.0000 Constraint 742 1007 0.8000 1.0000 2.0000 0.0000 Constraint 742 958 0.8000 1.0000 2.0000 0.0000 Constraint 742 951 0.8000 1.0000 2.0000 0.0000 Constraint 742 884 0.8000 1.0000 2.0000 0.0000 Constraint 742 871 0.8000 1.0000 2.0000 0.0000 Constraint 742 814 0.8000 1.0000 2.0000 0.0000 Constraint 742 805 0.8000 1.0000 2.0000 0.0000 Constraint 742 794 0.8000 1.0000 2.0000 0.0000 Constraint 742 789 0.8000 1.0000 2.0000 0.0000 Constraint 742 781 0.8000 1.0000 2.0000 0.0000 Constraint 742 773 0.8000 1.0000 2.0000 0.0000 Constraint 742 762 0.8000 1.0000 2.0000 0.0000 Constraint 742 756 0.8000 1.0000 2.0000 0.0000 Constraint 728 1476 0.8000 1.0000 2.0000 0.0000 Constraint 728 1467 0.8000 1.0000 2.0000 0.0000 Constraint 728 1459 0.8000 1.0000 2.0000 0.0000 Constraint 728 1451 0.8000 1.0000 2.0000 0.0000 Constraint 728 1442 0.8000 1.0000 2.0000 0.0000 Constraint 728 1430 0.8000 1.0000 2.0000 0.0000 Constraint 728 1421 0.8000 1.0000 2.0000 0.0000 Constraint 728 1413 0.8000 1.0000 2.0000 0.0000 Constraint 728 1402 0.8000 1.0000 2.0000 0.0000 Constraint 728 1395 0.8000 1.0000 2.0000 0.0000 Constraint 728 1386 0.8000 1.0000 2.0000 0.0000 Constraint 728 1381 0.8000 1.0000 2.0000 0.0000 Constraint 728 1373 0.8000 1.0000 2.0000 0.0000 Constraint 728 1362 0.8000 1.0000 2.0000 0.0000 Constraint 728 1354 0.8000 1.0000 2.0000 0.0000 Constraint 728 1347 0.8000 1.0000 2.0000 0.0000 Constraint 728 1339 0.8000 1.0000 2.0000 0.0000 Constraint 728 1329 0.8000 1.0000 2.0000 0.0000 Constraint 728 1318 0.8000 1.0000 2.0000 0.0000 Constraint 728 1306 0.8000 1.0000 2.0000 0.0000 Constraint 728 1295 0.8000 1.0000 2.0000 0.0000 Constraint 728 1272 0.8000 1.0000 2.0000 0.0000 Constraint 728 1235 0.8000 1.0000 2.0000 0.0000 Constraint 728 1225 0.8000 1.0000 2.0000 0.0000 Constraint 728 1213 0.8000 1.0000 2.0000 0.0000 Constraint 728 1208 0.8000 1.0000 2.0000 0.0000 Constraint 728 1201 0.8000 1.0000 2.0000 0.0000 Constraint 728 1192 0.8000 1.0000 2.0000 0.0000 Constraint 728 1186 0.8000 1.0000 2.0000 0.0000 Constraint 728 1133 0.8000 1.0000 2.0000 0.0000 Constraint 728 1124 0.8000 1.0000 2.0000 0.0000 Constraint 728 1106 0.8000 1.0000 2.0000 0.0000 Constraint 728 1024 0.8000 1.0000 2.0000 0.0000 Constraint 728 1007 0.8000 1.0000 2.0000 0.0000 Constraint 728 958 0.8000 1.0000 2.0000 0.0000 Constraint 728 907 0.8000 1.0000 2.0000 0.0000 Constraint 728 884 0.8000 1.0000 2.0000 0.0000 Constraint 728 805 0.8000 1.0000 2.0000 0.0000 Constraint 728 794 0.8000 1.0000 2.0000 0.0000 Constraint 728 789 0.8000 1.0000 2.0000 0.0000 Constraint 728 781 0.8000 1.0000 2.0000 0.0000 Constraint 728 773 0.8000 1.0000 2.0000 0.0000 Constraint 728 762 0.8000 1.0000 2.0000 0.0000 Constraint 728 756 0.8000 1.0000 2.0000 0.0000 Constraint 728 742 0.8000 1.0000 2.0000 0.0000 Constraint 723 1476 0.8000 1.0000 2.0000 0.0000 Constraint 723 1467 0.8000 1.0000 2.0000 0.0000 Constraint 723 1459 0.8000 1.0000 2.0000 0.0000 Constraint 723 1451 0.8000 1.0000 2.0000 0.0000 Constraint 723 1442 0.8000 1.0000 2.0000 0.0000 Constraint 723 1430 0.8000 1.0000 2.0000 0.0000 Constraint 723 1421 0.8000 1.0000 2.0000 0.0000 Constraint 723 1413 0.8000 1.0000 2.0000 0.0000 Constraint 723 1402 0.8000 1.0000 2.0000 0.0000 Constraint 723 1395 0.8000 1.0000 2.0000 0.0000 Constraint 723 1386 0.8000 1.0000 2.0000 0.0000 Constraint 723 1381 0.8000 1.0000 2.0000 0.0000 Constraint 723 1373 0.8000 1.0000 2.0000 0.0000 Constraint 723 1362 0.8000 1.0000 2.0000 0.0000 Constraint 723 1354 0.8000 1.0000 2.0000 0.0000 Constraint 723 1347 0.8000 1.0000 2.0000 0.0000 Constraint 723 1339 0.8000 1.0000 2.0000 0.0000 Constraint 723 1329 0.8000 1.0000 2.0000 0.0000 Constraint 723 1318 0.8000 1.0000 2.0000 0.0000 Constraint 723 1306 0.8000 1.0000 2.0000 0.0000 Constraint 723 1295 0.8000 1.0000 2.0000 0.0000 Constraint 723 1288 0.8000 1.0000 2.0000 0.0000 Constraint 723 1281 0.8000 1.0000 2.0000 0.0000 Constraint 723 1272 0.8000 1.0000 2.0000 0.0000 Constraint 723 1264 0.8000 1.0000 2.0000 0.0000 Constraint 723 1256 0.8000 1.0000 2.0000 0.0000 Constraint 723 1244 0.8000 1.0000 2.0000 0.0000 Constraint 723 1235 0.8000 1.0000 2.0000 0.0000 Constraint 723 1225 0.8000 1.0000 2.0000 0.0000 Constraint 723 1213 0.8000 1.0000 2.0000 0.0000 Constraint 723 1208 0.8000 1.0000 2.0000 0.0000 Constraint 723 1201 0.8000 1.0000 2.0000 0.0000 Constraint 723 1192 0.8000 1.0000 2.0000 0.0000 Constraint 723 1186 0.8000 1.0000 2.0000 0.0000 Constraint 723 1168 0.8000 1.0000 2.0000 0.0000 Constraint 723 1159 0.8000 1.0000 2.0000 0.0000 Constraint 723 1144 0.8000 1.0000 2.0000 0.0000 Constraint 723 1133 0.8000 1.0000 2.0000 0.0000 Constraint 723 1124 0.8000 1.0000 2.0000 0.0000 Constraint 723 1106 0.8000 1.0000 2.0000 0.0000 Constraint 723 1087 0.8000 1.0000 2.0000 0.0000 Constraint 723 1066 0.8000 1.0000 2.0000 0.0000 Constraint 723 1024 0.8000 1.0000 2.0000 0.0000 Constraint 723 1015 0.8000 1.0000 2.0000 0.0000 Constraint 723 990 0.8000 1.0000 2.0000 0.0000 Constraint 723 981 0.8000 1.0000 2.0000 0.0000 Constraint 723 794 0.8000 1.0000 2.0000 0.0000 Constraint 723 789 0.8000 1.0000 2.0000 0.0000 Constraint 723 781 0.8000 1.0000 2.0000 0.0000 Constraint 723 773 0.8000 1.0000 2.0000 0.0000 Constraint 723 762 0.8000 1.0000 2.0000 0.0000 Constraint 723 756 0.8000 1.0000 2.0000 0.0000 Constraint 723 742 0.8000 1.0000 2.0000 0.0000 Constraint 723 728 0.8000 1.0000 2.0000 0.0000 Constraint 716 1476 0.8000 1.0000 2.0000 0.0000 Constraint 716 1467 0.8000 1.0000 2.0000 0.0000 Constraint 716 1459 0.8000 1.0000 2.0000 0.0000 Constraint 716 1451 0.8000 1.0000 2.0000 0.0000 Constraint 716 1442 0.8000 1.0000 2.0000 0.0000 Constraint 716 1430 0.8000 1.0000 2.0000 0.0000 Constraint 716 1421 0.8000 1.0000 2.0000 0.0000 Constraint 716 1413 0.8000 1.0000 2.0000 0.0000 Constraint 716 1402 0.8000 1.0000 2.0000 0.0000 Constraint 716 1395 0.8000 1.0000 2.0000 0.0000 Constraint 716 1386 0.8000 1.0000 2.0000 0.0000 Constraint 716 1381 0.8000 1.0000 2.0000 0.0000 Constraint 716 1373 0.8000 1.0000 2.0000 0.0000 Constraint 716 1362 0.8000 1.0000 2.0000 0.0000 Constraint 716 1354 0.8000 1.0000 2.0000 0.0000 Constraint 716 1347 0.8000 1.0000 2.0000 0.0000 Constraint 716 1339 0.8000 1.0000 2.0000 0.0000 Constraint 716 1329 0.8000 1.0000 2.0000 0.0000 Constraint 716 1318 0.8000 1.0000 2.0000 0.0000 Constraint 716 1288 0.8000 1.0000 2.0000 0.0000 Constraint 716 1281 0.8000 1.0000 2.0000 0.0000 Constraint 716 1272 0.8000 1.0000 2.0000 0.0000 Constraint 716 1264 0.8000 1.0000 2.0000 0.0000 Constraint 716 1256 0.8000 1.0000 2.0000 0.0000 Constraint 716 1244 0.8000 1.0000 2.0000 0.0000 Constraint 716 1235 0.8000 1.0000 2.0000 0.0000 Constraint 716 1225 0.8000 1.0000 2.0000 0.0000 Constraint 716 1213 0.8000 1.0000 2.0000 0.0000 Constraint 716 1208 0.8000 1.0000 2.0000 0.0000 Constraint 716 1201 0.8000 1.0000 2.0000 0.0000 Constraint 716 1192 0.8000 1.0000 2.0000 0.0000 Constraint 716 1186 0.8000 1.0000 2.0000 0.0000 Constraint 716 1144 0.8000 1.0000 2.0000 0.0000 Constraint 716 1133 0.8000 1.0000 2.0000 0.0000 Constraint 716 1124 0.8000 1.0000 2.0000 0.0000 Constraint 716 1106 0.8000 1.0000 2.0000 0.0000 Constraint 716 1095 0.8000 1.0000 2.0000 0.0000 Constraint 716 1087 0.8000 1.0000 2.0000 0.0000 Constraint 716 1075 0.8000 1.0000 2.0000 0.0000 Constraint 716 1015 0.8000 1.0000 2.0000 0.0000 Constraint 716 981 0.8000 1.0000 2.0000 0.0000 Constraint 716 967 0.8000 1.0000 2.0000 0.0000 Constraint 716 944 0.8000 1.0000 2.0000 0.0000 Constraint 716 789 0.8000 1.0000 2.0000 0.0000 Constraint 716 781 0.8000 1.0000 2.0000 0.0000 Constraint 716 773 0.8000 1.0000 2.0000 0.0000 Constraint 716 762 0.8000 1.0000 2.0000 0.0000 Constraint 716 756 0.8000 1.0000 2.0000 0.0000 Constraint 716 742 0.8000 1.0000 2.0000 0.0000 Constraint 716 728 0.8000 1.0000 2.0000 0.0000 Constraint 716 723 0.8000 1.0000 2.0000 0.0000 Constraint 708 1476 0.8000 1.0000 2.0000 0.0000 Constraint 708 1467 0.8000 1.0000 2.0000 0.0000 Constraint 708 1459 0.8000 1.0000 2.0000 0.0000 Constraint 708 1451 0.8000 1.0000 2.0000 0.0000 Constraint 708 1442 0.8000 1.0000 2.0000 0.0000 Constraint 708 1430 0.8000 1.0000 2.0000 0.0000 Constraint 708 1421 0.8000 1.0000 2.0000 0.0000 Constraint 708 1413 0.8000 1.0000 2.0000 0.0000 Constraint 708 1402 0.8000 1.0000 2.0000 0.0000 Constraint 708 1395 0.8000 1.0000 2.0000 0.0000 Constraint 708 1386 0.8000 1.0000 2.0000 0.0000 Constraint 708 1381 0.8000 1.0000 2.0000 0.0000 Constraint 708 1373 0.8000 1.0000 2.0000 0.0000 Constraint 708 1362 0.8000 1.0000 2.0000 0.0000 Constraint 708 1354 0.8000 1.0000 2.0000 0.0000 Constraint 708 1347 0.8000 1.0000 2.0000 0.0000 Constraint 708 1339 0.8000 1.0000 2.0000 0.0000 Constraint 708 1329 0.8000 1.0000 2.0000 0.0000 Constraint 708 1318 0.8000 1.0000 2.0000 0.0000 Constraint 708 1295 0.8000 1.0000 2.0000 0.0000 Constraint 708 1288 0.8000 1.0000 2.0000 0.0000 Constraint 708 1281 0.8000 1.0000 2.0000 0.0000 Constraint 708 1272 0.8000 1.0000 2.0000 0.0000 Constraint 708 1264 0.8000 1.0000 2.0000 0.0000 Constraint 708 1256 0.8000 1.0000 2.0000 0.0000 Constraint 708 1244 0.8000 1.0000 2.0000 0.0000 Constraint 708 1235 0.8000 1.0000 2.0000 0.0000 Constraint 708 1225 0.8000 1.0000 2.0000 0.0000 Constraint 708 1213 0.8000 1.0000 2.0000 0.0000 Constraint 708 1208 0.8000 1.0000 2.0000 0.0000 Constraint 708 1201 0.8000 1.0000 2.0000 0.0000 Constraint 708 1192 0.8000 1.0000 2.0000 0.0000 Constraint 708 1186 0.8000 1.0000 2.0000 0.0000 Constraint 708 1174 0.8000 1.0000 2.0000 0.0000 Constraint 708 1144 0.8000 1.0000 2.0000 0.0000 Constraint 708 1124 0.8000 1.0000 2.0000 0.0000 Constraint 708 1106 0.8000 1.0000 2.0000 0.0000 Constraint 708 1095 0.8000 1.0000 2.0000 0.0000 Constraint 708 1087 0.8000 1.0000 2.0000 0.0000 Constraint 708 1075 0.8000 1.0000 2.0000 0.0000 Constraint 708 1066 0.8000 1.0000 2.0000 0.0000 Constraint 708 1051 0.8000 1.0000 2.0000 0.0000 Constraint 708 1024 0.8000 1.0000 2.0000 0.0000 Constraint 708 1007 0.8000 1.0000 2.0000 0.0000 Constraint 708 981 0.8000 1.0000 2.0000 0.0000 Constraint 708 973 0.8000 1.0000 2.0000 0.0000 Constraint 708 967 0.8000 1.0000 2.0000 0.0000 Constraint 708 939 0.8000 1.0000 2.0000 0.0000 Constraint 708 931 0.8000 1.0000 2.0000 0.0000 Constraint 708 871 0.8000 1.0000 2.0000 0.0000 Constraint 708 864 0.8000 1.0000 2.0000 0.0000 Constraint 708 781 0.8000 1.0000 2.0000 0.0000 Constraint 708 773 0.8000 1.0000 2.0000 0.0000 Constraint 708 762 0.8000 1.0000 2.0000 0.0000 Constraint 708 756 0.8000 1.0000 2.0000 0.0000 Constraint 708 742 0.8000 1.0000 2.0000 0.0000 Constraint 708 728 0.8000 1.0000 2.0000 0.0000 Constraint 708 723 0.8000 1.0000 2.0000 0.0000 Constraint 708 716 0.8000 1.0000 2.0000 0.0000 Constraint 700 1476 0.8000 1.0000 2.0000 0.0000 Constraint 700 1467 0.8000 1.0000 2.0000 0.0000 Constraint 700 1459 0.8000 1.0000 2.0000 0.0000 Constraint 700 1451 0.8000 1.0000 2.0000 0.0000 Constraint 700 1442 0.8000 1.0000 2.0000 0.0000 Constraint 700 1430 0.8000 1.0000 2.0000 0.0000 Constraint 700 1421 0.8000 1.0000 2.0000 0.0000 Constraint 700 1413 0.8000 1.0000 2.0000 0.0000 Constraint 700 1402 0.8000 1.0000 2.0000 0.0000 Constraint 700 1395 0.8000 1.0000 2.0000 0.0000 Constraint 700 1386 0.8000 1.0000 2.0000 0.0000 Constraint 700 1381 0.8000 1.0000 2.0000 0.0000 Constraint 700 1373 0.8000 1.0000 2.0000 0.0000 Constraint 700 1362 0.8000 1.0000 2.0000 0.0000 Constraint 700 1354 0.8000 1.0000 2.0000 0.0000 Constraint 700 1347 0.8000 1.0000 2.0000 0.0000 Constraint 700 1339 0.8000 1.0000 2.0000 0.0000 Constraint 700 1329 0.8000 1.0000 2.0000 0.0000 Constraint 700 1318 0.8000 1.0000 2.0000 0.0000 Constraint 700 1306 0.8000 1.0000 2.0000 0.0000 Constraint 700 1295 0.8000 1.0000 2.0000 0.0000 Constraint 700 1288 0.8000 1.0000 2.0000 0.0000 Constraint 700 1281 0.8000 1.0000 2.0000 0.0000 Constraint 700 1272 0.8000 1.0000 2.0000 0.0000 Constraint 700 1264 0.8000 1.0000 2.0000 0.0000 Constraint 700 1256 0.8000 1.0000 2.0000 0.0000 Constraint 700 1244 0.8000 1.0000 2.0000 0.0000 Constraint 700 1235 0.8000 1.0000 2.0000 0.0000 Constraint 700 1225 0.8000 1.0000 2.0000 0.0000 Constraint 700 1213 0.8000 1.0000 2.0000 0.0000 Constraint 700 1208 0.8000 1.0000 2.0000 0.0000 Constraint 700 1201 0.8000 1.0000 2.0000 0.0000 Constraint 700 1192 0.8000 1.0000 2.0000 0.0000 Constraint 700 1186 0.8000 1.0000 2.0000 0.0000 Constraint 700 1124 0.8000 1.0000 2.0000 0.0000 Constraint 700 1106 0.8000 1.0000 2.0000 0.0000 Constraint 700 1095 0.8000 1.0000 2.0000 0.0000 Constraint 700 1087 0.8000 1.0000 2.0000 0.0000 Constraint 700 1075 0.8000 1.0000 2.0000 0.0000 Constraint 700 1066 0.8000 1.0000 2.0000 0.0000 Constraint 700 1051 0.8000 1.0000 2.0000 0.0000 Constraint 700 1039 0.8000 1.0000 2.0000 0.0000 Constraint 700 1031 0.8000 1.0000 2.0000 0.0000 Constraint 700 981 0.8000 1.0000 2.0000 0.0000 Constraint 700 973 0.8000 1.0000 2.0000 0.0000 Constraint 700 967 0.8000 1.0000 2.0000 0.0000 Constraint 700 958 0.8000 1.0000 2.0000 0.0000 Constraint 700 931 0.8000 1.0000 2.0000 0.0000 Constraint 700 852 0.8000 1.0000 2.0000 0.0000 Constraint 700 841 0.8000 1.0000 2.0000 0.0000 Constraint 700 833 0.8000 1.0000 2.0000 0.0000 Constraint 700 822 0.8000 1.0000 2.0000 0.0000 Constraint 700 773 0.8000 1.0000 2.0000 0.0000 Constraint 700 762 0.8000 1.0000 2.0000 0.0000 Constraint 700 756 0.8000 1.0000 2.0000 0.0000 Constraint 700 742 0.8000 1.0000 2.0000 0.0000 Constraint 700 728 0.8000 1.0000 2.0000 0.0000 Constraint 700 723 0.8000 1.0000 2.0000 0.0000 Constraint 700 716 0.8000 1.0000 2.0000 0.0000 Constraint 700 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 1476 0.8000 1.0000 2.0000 0.0000 Constraint 691 1467 0.8000 1.0000 2.0000 0.0000 Constraint 691 1459 0.8000 1.0000 2.0000 0.0000 Constraint 691 1451 0.8000 1.0000 2.0000 0.0000 Constraint 691 1442 0.8000 1.0000 2.0000 0.0000 Constraint 691 1430 0.8000 1.0000 2.0000 0.0000 Constraint 691 1421 0.8000 1.0000 2.0000 0.0000 Constraint 691 1413 0.8000 1.0000 2.0000 0.0000 Constraint 691 1402 0.8000 1.0000 2.0000 0.0000 Constraint 691 1395 0.8000 1.0000 2.0000 0.0000 Constraint 691 1386 0.8000 1.0000 2.0000 0.0000 Constraint 691 1381 0.8000 1.0000 2.0000 0.0000 Constraint 691 1373 0.8000 1.0000 2.0000 0.0000 Constraint 691 1362 0.8000 1.0000 2.0000 0.0000 Constraint 691 1354 0.8000 1.0000 2.0000 0.0000 Constraint 691 1329 0.8000 1.0000 2.0000 0.0000 Constraint 691 1306 0.8000 1.0000 2.0000 0.0000 Constraint 691 1295 0.8000 1.0000 2.0000 0.0000 Constraint 691 1264 0.8000 1.0000 2.0000 0.0000 Constraint 691 1256 0.8000 1.0000 2.0000 0.0000 Constraint 691 1244 0.8000 1.0000 2.0000 0.0000 Constraint 691 1235 0.8000 1.0000 2.0000 0.0000 Constraint 691 1225 0.8000 1.0000 2.0000 0.0000 Constraint 691 1213 0.8000 1.0000 2.0000 0.0000 Constraint 691 1208 0.8000 1.0000 2.0000 0.0000 Constraint 691 1201 0.8000 1.0000 2.0000 0.0000 Constraint 691 1192 0.8000 1.0000 2.0000 0.0000 Constraint 691 1186 0.8000 1.0000 2.0000 0.0000 Constraint 691 1159 0.8000 1.0000 2.0000 0.0000 Constraint 691 1133 0.8000 1.0000 2.0000 0.0000 Constraint 691 1124 0.8000 1.0000 2.0000 0.0000 Constraint 691 1106 0.8000 1.0000 2.0000 0.0000 Constraint 691 1095 0.8000 1.0000 2.0000 0.0000 Constraint 691 1087 0.8000 1.0000 2.0000 0.0000 Constraint 691 1075 0.8000 1.0000 2.0000 0.0000 Constraint 691 1066 0.8000 1.0000 2.0000 0.0000 Constraint 691 1039 0.8000 1.0000 2.0000 0.0000 Constraint 691 1031 0.8000 1.0000 2.0000 0.0000 Constraint 691 958 0.8000 1.0000 2.0000 0.0000 Constraint 691 939 0.8000 1.0000 2.0000 0.0000 Constraint 691 924 0.8000 1.0000 2.0000 0.0000 Constraint 691 915 0.8000 1.0000 2.0000 0.0000 Constraint 691 907 0.8000 1.0000 2.0000 0.0000 Constraint 691 833 0.8000 1.0000 2.0000 0.0000 Constraint 691 762 0.8000 1.0000 2.0000 0.0000 Constraint 691 756 0.8000 1.0000 2.0000 0.0000 Constraint 691 742 0.8000 1.0000 2.0000 0.0000 Constraint 691 728 0.8000 1.0000 2.0000 0.0000 Constraint 691 723 0.8000 1.0000 2.0000 0.0000 Constraint 691 716 0.8000 1.0000 2.0000 0.0000 Constraint 691 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 700 0.8000 1.0000 2.0000 0.0000 Constraint 683 1476 0.8000 1.0000 2.0000 0.0000 Constraint 683 1467 0.8000 1.0000 2.0000 0.0000 Constraint 683 1459 0.8000 1.0000 2.0000 0.0000 Constraint 683 1451 0.8000 1.0000 2.0000 0.0000 Constraint 683 1442 0.8000 1.0000 2.0000 0.0000 Constraint 683 1430 0.8000 1.0000 2.0000 0.0000 Constraint 683 1421 0.8000 1.0000 2.0000 0.0000 Constraint 683 1413 0.8000 1.0000 2.0000 0.0000 Constraint 683 1395 0.8000 1.0000 2.0000 0.0000 Constraint 683 1386 0.8000 1.0000 2.0000 0.0000 Constraint 683 1381 0.8000 1.0000 2.0000 0.0000 Constraint 683 1373 0.8000 1.0000 2.0000 0.0000 Constraint 683 1362 0.8000 1.0000 2.0000 0.0000 Constraint 683 1354 0.8000 1.0000 2.0000 0.0000 Constraint 683 1347 0.8000 1.0000 2.0000 0.0000 Constraint 683 1329 0.8000 1.0000 2.0000 0.0000 Constraint 683 1306 0.8000 1.0000 2.0000 0.0000 Constraint 683 1295 0.8000 1.0000 2.0000 0.0000 Constraint 683 1288 0.8000 1.0000 2.0000 0.0000 Constraint 683 1281 0.8000 1.0000 2.0000 0.0000 Constraint 683 1272 0.8000 1.0000 2.0000 0.0000 Constraint 683 1264 0.8000 1.0000 2.0000 0.0000 Constraint 683 1256 0.8000 1.0000 2.0000 0.0000 Constraint 683 1244 0.8000 1.0000 2.0000 0.0000 Constraint 683 1235 0.8000 1.0000 2.0000 0.0000 Constraint 683 1225 0.8000 1.0000 2.0000 0.0000 Constraint 683 1213 0.8000 1.0000 2.0000 0.0000 Constraint 683 1208 0.8000 1.0000 2.0000 0.0000 Constraint 683 1201 0.8000 1.0000 2.0000 0.0000 Constraint 683 1192 0.8000 1.0000 2.0000 0.0000 Constraint 683 1186 0.8000 1.0000 2.0000 0.0000 Constraint 683 1174 0.8000 1.0000 2.0000 0.0000 Constraint 683 1168 0.8000 1.0000 2.0000 0.0000 Constraint 683 1159 0.8000 1.0000 2.0000 0.0000 Constraint 683 1150 0.8000 1.0000 2.0000 0.0000 Constraint 683 1144 0.8000 1.0000 2.0000 0.0000 Constraint 683 1133 0.8000 1.0000 2.0000 0.0000 Constraint 683 1124 0.8000 1.0000 2.0000 0.0000 Constraint 683 1087 0.8000 1.0000 2.0000 0.0000 Constraint 683 1039 0.8000 1.0000 2.0000 0.0000 Constraint 683 1031 0.8000 1.0000 2.0000 0.0000 Constraint 683 939 0.8000 1.0000 2.0000 0.0000 Constraint 683 915 0.8000 1.0000 2.0000 0.0000 Constraint 683 907 0.8000 1.0000 2.0000 0.0000 Constraint 683 864 0.8000 1.0000 2.0000 0.0000 Constraint 683 756 0.8000 1.0000 2.0000 0.0000 Constraint 683 742 0.8000 1.0000 2.0000 0.0000 Constraint 683 728 0.8000 1.0000 2.0000 0.0000 Constraint 683 723 0.8000 1.0000 2.0000 0.0000 Constraint 683 716 0.8000 1.0000 2.0000 0.0000 Constraint 683 708 0.8000 1.0000 2.0000 0.0000 Constraint 683 700 0.8000 1.0000 2.0000 0.0000 Constraint 683 691 0.8000 1.0000 2.0000 0.0000 Constraint 674 1476 0.8000 1.0000 2.0000 0.0000 Constraint 674 1467 0.8000 1.0000 2.0000 0.0000 Constraint 674 1459 0.8000 1.0000 2.0000 0.0000 Constraint 674 1451 0.8000 1.0000 2.0000 0.0000 Constraint 674 1442 0.8000 1.0000 2.0000 0.0000 Constraint 674 1430 0.8000 1.0000 2.0000 0.0000 Constraint 674 1421 0.8000 1.0000 2.0000 0.0000 Constraint 674 1413 0.8000 1.0000 2.0000 0.0000 Constraint 674 1402 0.8000 1.0000 2.0000 0.0000 Constraint 674 1395 0.8000 1.0000 2.0000 0.0000 Constraint 674 1386 0.8000 1.0000 2.0000 0.0000 Constraint 674 1381 0.8000 1.0000 2.0000 0.0000 Constraint 674 1373 0.8000 1.0000 2.0000 0.0000 Constraint 674 1362 0.8000 1.0000 2.0000 0.0000 Constraint 674 1354 0.8000 1.0000 2.0000 0.0000 Constraint 674 1347 0.8000 1.0000 2.0000 0.0000 Constraint 674 1339 0.8000 1.0000 2.0000 0.0000 Constraint 674 1329 0.8000 1.0000 2.0000 0.0000 Constraint 674 1318 0.8000 1.0000 2.0000 0.0000 Constraint 674 1306 0.8000 1.0000 2.0000 0.0000 Constraint 674 1295 0.8000 1.0000 2.0000 0.0000 Constraint 674 1288 0.8000 1.0000 2.0000 0.0000 Constraint 674 1272 0.8000 1.0000 2.0000 0.0000 Constraint 674 1264 0.8000 1.0000 2.0000 0.0000 Constraint 674 1256 0.8000 1.0000 2.0000 0.0000 Constraint 674 1244 0.8000 1.0000 2.0000 0.0000 Constraint 674 1235 0.8000 1.0000 2.0000 0.0000 Constraint 674 1225 0.8000 1.0000 2.0000 0.0000 Constraint 674 1213 0.8000 1.0000 2.0000 0.0000 Constraint 674 1208 0.8000 1.0000 2.0000 0.0000 Constraint 674 1201 0.8000 1.0000 2.0000 0.0000 Constraint 674 1192 0.8000 1.0000 2.0000 0.0000 Constraint 674 1186 0.8000 1.0000 2.0000 0.0000 Constraint 674 1150 0.8000 1.0000 2.0000 0.0000 Constraint 674 1144 0.8000 1.0000 2.0000 0.0000 Constraint 674 1124 0.8000 1.0000 2.0000 0.0000 Constraint 674 1106 0.8000 1.0000 2.0000 0.0000 Constraint 674 1087 0.8000 1.0000 2.0000 0.0000 Constraint 674 1075 0.8000 1.0000 2.0000 0.0000 Constraint 674 1066 0.8000 1.0000 2.0000 0.0000 Constraint 674 1051 0.8000 1.0000 2.0000 0.0000 Constraint 674 1039 0.8000 1.0000 2.0000 0.0000 Constraint 674 1031 0.8000 1.0000 2.0000 0.0000 Constraint 674 1024 0.8000 1.0000 2.0000 0.0000 Constraint 674 1015 0.8000 1.0000 2.0000 0.0000 Constraint 674 1007 0.8000 1.0000 2.0000 0.0000 Constraint 674 998 0.8000 1.0000 2.0000 0.0000 Constraint 674 990 0.8000 1.0000 2.0000 0.0000 Constraint 674 958 0.8000 1.0000 2.0000 0.0000 Constraint 674 944 0.8000 1.0000 2.0000 0.0000 Constraint 674 939 0.8000 1.0000 2.0000 0.0000 Constraint 674 924 0.8000 1.0000 2.0000 0.0000 Constraint 674 915 0.8000 1.0000 2.0000 0.0000 Constraint 674 907 0.8000 1.0000 2.0000 0.0000 Constraint 674 900 0.8000 1.0000 2.0000 0.0000 Constraint 674 892 0.8000 1.0000 2.0000 0.0000 Constraint 674 884 0.8000 1.0000 2.0000 0.0000 Constraint 674 742 0.8000 1.0000 2.0000 0.0000 Constraint 674 728 0.8000 1.0000 2.0000 0.0000 Constraint 674 723 0.8000 1.0000 2.0000 0.0000 Constraint 674 716 0.8000 1.0000 2.0000 0.0000 Constraint 674 708 0.8000 1.0000 2.0000 0.0000 Constraint 674 700 0.8000 1.0000 2.0000 0.0000 Constraint 674 691 0.8000 1.0000 2.0000 0.0000 Constraint 674 683 0.8000 1.0000 2.0000 0.0000 Constraint 669 1476 0.8000 1.0000 2.0000 0.0000 Constraint 669 1467 0.8000 1.0000 2.0000 0.0000 Constraint 669 1459 0.8000 1.0000 2.0000 0.0000 Constraint 669 1451 0.8000 1.0000 2.0000 0.0000 Constraint 669 1442 0.8000 1.0000 2.0000 0.0000 Constraint 669 1430 0.8000 1.0000 2.0000 0.0000 Constraint 669 1421 0.8000 1.0000 2.0000 0.0000 Constraint 669 1413 0.8000 1.0000 2.0000 0.0000 Constraint 669 1402 0.8000 1.0000 2.0000 0.0000 Constraint 669 1395 0.8000 1.0000 2.0000 0.0000 Constraint 669 1386 0.8000 1.0000 2.0000 0.0000 Constraint 669 1381 0.8000 1.0000 2.0000 0.0000 Constraint 669 1373 0.8000 1.0000 2.0000 0.0000 Constraint 669 1362 0.8000 1.0000 2.0000 0.0000 Constraint 669 1354 0.8000 1.0000 2.0000 0.0000 Constraint 669 1347 0.8000 1.0000 2.0000 0.0000 Constraint 669 1339 0.8000 1.0000 2.0000 0.0000 Constraint 669 1329 0.8000 1.0000 2.0000 0.0000 Constraint 669 1318 0.8000 1.0000 2.0000 0.0000 Constraint 669 1306 0.8000 1.0000 2.0000 0.0000 Constraint 669 1295 0.8000 1.0000 2.0000 0.0000 Constraint 669 1288 0.8000 1.0000 2.0000 0.0000 Constraint 669 1264 0.8000 1.0000 2.0000 0.0000 Constraint 669 1256 0.8000 1.0000 2.0000 0.0000 Constraint 669 1244 0.8000 1.0000 2.0000 0.0000 Constraint 669 1235 0.8000 1.0000 2.0000 0.0000 Constraint 669 1225 0.8000 1.0000 2.0000 0.0000 Constraint 669 1213 0.8000 1.0000 2.0000 0.0000 Constraint 669 1208 0.8000 1.0000 2.0000 0.0000 Constraint 669 1201 0.8000 1.0000 2.0000 0.0000 Constraint 669 1192 0.8000 1.0000 2.0000 0.0000 Constraint 669 1186 0.8000 1.0000 2.0000 0.0000 Constraint 669 1174 0.8000 1.0000 2.0000 0.0000 Constraint 669 1168 0.8000 1.0000 2.0000 0.0000 Constraint 669 1159 0.8000 1.0000 2.0000 0.0000 Constraint 669 1150 0.8000 1.0000 2.0000 0.0000 Constraint 669 1144 0.8000 1.0000 2.0000 0.0000 Constraint 669 1133 0.8000 1.0000 2.0000 0.0000 Constraint 669 1124 0.8000 1.0000 2.0000 0.0000 Constraint 669 1106 0.8000 1.0000 2.0000 0.0000 Constraint 669 1095 0.8000 1.0000 2.0000 0.0000 Constraint 669 1087 0.8000 1.0000 2.0000 0.0000 Constraint 669 1075 0.8000 1.0000 2.0000 0.0000 Constraint 669 1066 0.8000 1.0000 2.0000 0.0000 Constraint 669 1051 0.8000 1.0000 2.0000 0.0000 Constraint 669 1039 0.8000 1.0000 2.0000 0.0000 Constraint 669 1031 0.8000 1.0000 2.0000 0.0000 Constraint 669 1007 0.8000 1.0000 2.0000 0.0000 Constraint 669 998 0.8000 1.0000 2.0000 0.0000 Constraint 669 990 0.8000 1.0000 2.0000 0.0000 Constraint 669 967 0.8000 1.0000 2.0000 0.0000 Constraint 669 958 0.8000 1.0000 2.0000 0.0000 Constraint 669 951 0.8000 1.0000 2.0000 0.0000 Constraint 669 944 0.8000 1.0000 2.0000 0.0000 Constraint 669 939 0.8000 1.0000 2.0000 0.0000 Constraint 669 931 0.8000 1.0000 2.0000 0.0000 Constraint 669 924 0.8000 1.0000 2.0000 0.0000 Constraint 669 915 0.8000 1.0000 2.0000 0.0000 Constraint 669 907 0.8000 1.0000 2.0000 0.0000 Constraint 669 900 0.8000 1.0000 2.0000 0.0000 Constraint 669 892 0.8000 1.0000 2.0000 0.0000 Constraint 669 884 0.8000 1.0000 2.0000 0.0000 Constraint 669 864 0.8000 1.0000 2.0000 0.0000 Constraint 669 833 0.8000 1.0000 2.0000 0.0000 Constraint 669 814 0.8000 1.0000 2.0000 0.0000 Constraint 669 789 0.8000 1.0000 2.0000 0.0000 Constraint 669 728 0.8000 1.0000 2.0000 0.0000 Constraint 669 723 0.8000 1.0000 2.0000 0.0000 Constraint 669 716 0.8000 1.0000 2.0000 0.0000 Constraint 669 708 0.8000 1.0000 2.0000 0.0000 Constraint 669 700 0.8000 1.0000 2.0000 0.0000 Constraint 669 691 0.8000 1.0000 2.0000 0.0000 Constraint 669 683 0.8000 1.0000 2.0000 0.0000 Constraint 669 674 0.8000 1.0000 2.0000 0.0000 Constraint 660 1476 0.8000 1.0000 2.0000 0.0000 Constraint 660 1467 0.8000 1.0000 2.0000 0.0000 Constraint 660 1459 0.8000 1.0000 2.0000 0.0000 Constraint 660 1451 0.8000 1.0000 2.0000 0.0000 Constraint 660 1442 0.8000 1.0000 2.0000 0.0000 Constraint 660 1430 0.8000 1.0000 2.0000 0.0000 Constraint 660 1421 0.8000 1.0000 2.0000 0.0000 Constraint 660 1413 0.8000 1.0000 2.0000 0.0000 Constraint 660 1395 0.8000 1.0000 2.0000 0.0000 Constraint 660 1386 0.8000 1.0000 2.0000 0.0000 Constraint 660 1373 0.8000 1.0000 2.0000 0.0000 Constraint 660 1362 0.8000 1.0000 2.0000 0.0000 Constraint 660 1354 0.8000 1.0000 2.0000 0.0000 Constraint 660 1347 0.8000 1.0000 2.0000 0.0000 Constraint 660 1329 0.8000 1.0000 2.0000 0.0000 Constraint 660 1318 0.8000 1.0000 2.0000 0.0000 Constraint 660 1306 0.8000 1.0000 2.0000 0.0000 Constraint 660 1295 0.8000 1.0000 2.0000 0.0000 Constraint 660 1264 0.8000 1.0000 2.0000 0.0000 Constraint 660 1244 0.8000 1.0000 2.0000 0.0000 Constraint 660 1235 0.8000 1.0000 2.0000 0.0000 Constraint 660 1225 0.8000 1.0000 2.0000 0.0000 Constraint 660 1213 0.8000 1.0000 2.0000 0.0000 Constraint 660 1208 0.8000 1.0000 2.0000 0.0000 Constraint 660 1201 0.8000 1.0000 2.0000 0.0000 Constraint 660 1192 0.8000 1.0000 2.0000 0.0000 Constraint 660 1186 0.8000 1.0000 2.0000 0.0000 Constraint 660 1174 0.8000 1.0000 2.0000 0.0000 Constraint 660 1168 0.8000 1.0000 2.0000 0.0000 Constraint 660 1159 0.8000 1.0000 2.0000 0.0000 Constraint 660 1150 0.8000 1.0000 2.0000 0.0000 Constraint 660 1144 0.8000 1.0000 2.0000 0.0000 Constraint 660 1133 0.8000 1.0000 2.0000 0.0000 Constraint 660 1124 0.8000 1.0000 2.0000 0.0000 Constraint 660 1087 0.8000 1.0000 2.0000 0.0000 Constraint 660 1066 0.8000 1.0000 2.0000 0.0000 Constraint 660 1039 0.8000 1.0000 2.0000 0.0000 Constraint 660 1031 0.8000 1.0000 2.0000 0.0000 Constraint 660 1024 0.8000 1.0000 2.0000 0.0000 Constraint 660 1007 0.8000 1.0000 2.0000 0.0000 Constraint 660 939 0.8000 1.0000 2.0000 0.0000 Constraint 660 915 0.8000 1.0000 2.0000 0.0000 Constraint 660 884 0.8000 1.0000 2.0000 0.0000 Constraint 660 871 0.8000 1.0000 2.0000 0.0000 Constraint 660 723 0.8000 1.0000 2.0000 0.0000 Constraint 660 716 0.8000 1.0000 2.0000 0.0000 Constraint 660 708 0.8000 1.0000 2.0000 0.0000 Constraint 660 700 0.8000 1.0000 2.0000 0.0000 Constraint 660 691 0.8000 1.0000 2.0000 0.0000 Constraint 660 683 0.8000 1.0000 2.0000 0.0000 Constraint 660 674 0.8000 1.0000 2.0000 0.0000 Constraint 660 669 0.8000 1.0000 2.0000 0.0000 Constraint 649 1476 0.8000 1.0000 2.0000 0.0000 Constraint 649 1467 0.8000 1.0000 2.0000 0.0000 Constraint 649 1459 0.8000 1.0000 2.0000 0.0000 Constraint 649 1451 0.8000 1.0000 2.0000 0.0000 Constraint 649 1442 0.8000 1.0000 2.0000 0.0000 Constraint 649 1430 0.8000 1.0000 2.0000 0.0000 Constraint 649 1421 0.8000 1.0000 2.0000 0.0000 Constraint 649 1413 0.8000 1.0000 2.0000 0.0000 Constraint 649 1395 0.8000 1.0000 2.0000 0.0000 Constraint 649 1386 0.8000 1.0000 2.0000 0.0000 Constraint 649 1381 0.8000 1.0000 2.0000 0.0000 Constraint 649 1373 0.8000 1.0000 2.0000 0.0000 Constraint 649 1362 0.8000 1.0000 2.0000 0.0000 Constraint 649 1354 0.8000 1.0000 2.0000 0.0000 Constraint 649 1347 0.8000 1.0000 2.0000 0.0000 Constraint 649 1339 0.8000 1.0000 2.0000 0.0000 Constraint 649 1329 0.8000 1.0000 2.0000 0.0000 Constraint 649 1295 0.8000 1.0000 2.0000 0.0000 Constraint 649 1288 0.8000 1.0000 2.0000 0.0000 Constraint 649 1281 0.8000 1.0000 2.0000 0.0000 Constraint 649 1272 0.8000 1.0000 2.0000 0.0000 Constraint 649 1264 0.8000 1.0000 2.0000 0.0000 Constraint 649 1256 0.8000 1.0000 2.0000 0.0000 Constraint 649 1244 0.8000 1.0000 2.0000 0.0000 Constraint 649 1235 0.8000 1.0000 2.0000 0.0000 Constraint 649 1225 0.8000 1.0000 2.0000 0.0000 Constraint 649 1213 0.8000 1.0000 2.0000 0.0000 Constraint 649 1208 0.8000 1.0000 2.0000 0.0000 Constraint 649 1201 0.8000 1.0000 2.0000 0.0000 Constraint 649 1192 0.8000 1.0000 2.0000 0.0000 Constraint 649 1186 0.8000 1.0000 2.0000 0.0000 Constraint 649 1174 0.8000 1.0000 2.0000 0.0000 Constraint 649 1168 0.8000 1.0000 2.0000 0.0000 Constraint 649 1159 0.8000 1.0000 2.0000 0.0000 Constraint 649 1150 0.8000 1.0000 2.0000 0.0000 Constraint 649 1144 0.8000 1.0000 2.0000 0.0000 Constraint 649 1133 0.8000 1.0000 2.0000 0.0000 Constraint 649 1124 0.8000 1.0000 2.0000 0.0000 Constraint 649 1066 0.8000 1.0000 2.0000 0.0000 Constraint 649 1039 0.8000 1.0000 2.0000 0.0000 Constraint 649 1031 0.8000 1.0000 2.0000 0.0000 Constraint 649 1024 0.8000 1.0000 2.0000 0.0000 Constraint 649 1007 0.8000 1.0000 2.0000 0.0000 Constraint 649 939 0.8000 1.0000 2.0000 0.0000 Constraint 649 716 0.8000 1.0000 2.0000 0.0000 Constraint 649 708 0.8000 1.0000 2.0000 0.0000 Constraint 649 700 0.8000 1.0000 2.0000 0.0000 Constraint 649 691 0.8000 1.0000 2.0000 0.0000 Constraint 649 683 0.8000 1.0000 2.0000 0.0000 Constraint 649 674 0.8000 1.0000 2.0000 0.0000 Constraint 649 669 0.8000 1.0000 2.0000 0.0000 Constraint 649 660 0.8000 1.0000 2.0000 0.0000 Constraint 641 1476 0.8000 1.0000 2.0000 0.0000 Constraint 641 1467 0.8000 1.0000 2.0000 0.0000 Constraint 641 1459 0.8000 1.0000 2.0000 0.0000 Constraint 641 1451 0.8000 1.0000 2.0000 0.0000 Constraint 641 1442 0.8000 1.0000 2.0000 0.0000 Constraint 641 1430 0.8000 1.0000 2.0000 0.0000 Constraint 641 1421 0.8000 1.0000 2.0000 0.0000 Constraint 641 1413 0.8000 1.0000 2.0000 0.0000 Constraint 641 1402 0.8000 1.0000 2.0000 0.0000 Constraint 641 1373 0.8000 1.0000 2.0000 0.0000 Constraint 641 1362 0.8000 1.0000 2.0000 0.0000 Constraint 641 1354 0.8000 1.0000 2.0000 0.0000 Constraint 641 1339 0.8000 1.0000 2.0000 0.0000 Constraint 641 1329 0.8000 1.0000 2.0000 0.0000 Constraint 641 1318 0.8000 1.0000 2.0000 0.0000 Constraint 641 1295 0.8000 1.0000 2.0000 0.0000 Constraint 641 1288 0.8000 1.0000 2.0000 0.0000 Constraint 641 1281 0.8000 1.0000 2.0000 0.0000 Constraint 641 1272 0.8000 1.0000 2.0000 0.0000 Constraint 641 1264 0.8000 1.0000 2.0000 0.0000 Constraint 641 1235 0.8000 1.0000 2.0000 0.0000 Constraint 641 1225 0.8000 1.0000 2.0000 0.0000 Constraint 641 1208 0.8000 1.0000 2.0000 0.0000 Constraint 641 1201 0.8000 1.0000 2.0000 0.0000 Constraint 641 1192 0.8000 1.0000 2.0000 0.0000 Constraint 641 1186 0.8000 1.0000 2.0000 0.0000 Constraint 641 1174 0.8000 1.0000 2.0000 0.0000 Constraint 641 1168 0.8000 1.0000 2.0000 0.0000 Constraint 641 1159 0.8000 1.0000 2.0000 0.0000 Constraint 641 1150 0.8000 1.0000 2.0000 0.0000 Constraint 641 1144 0.8000 1.0000 2.0000 0.0000 Constraint 641 1133 0.8000 1.0000 2.0000 0.0000 Constraint 641 1124 0.8000 1.0000 2.0000 0.0000 Constraint 641 1106 0.8000 1.0000 2.0000 0.0000 Constraint 641 1087 0.8000 1.0000 2.0000 0.0000 Constraint 641 1075 0.8000 1.0000 2.0000 0.0000 Constraint 641 1066 0.8000 1.0000 2.0000 0.0000 Constraint 641 1051 0.8000 1.0000 2.0000 0.0000 Constraint 641 1039 0.8000 1.0000 2.0000 0.0000 Constraint 641 1031 0.8000 1.0000 2.0000 0.0000 Constraint 641 1024 0.8000 1.0000 2.0000 0.0000 Constraint 641 1015 0.8000 1.0000 2.0000 0.0000 Constraint 641 1007 0.8000 1.0000 2.0000 0.0000 Constraint 641 998 0.8000 1.0000 2.0000 0.0000 Constraint 641 990 0.8000 1.0000 2.0000 0.0000 Constraint 641 981 0.8000 1.0000 2.0000 0.0000 Constraint 641 973 0.8000 1.0000 2.0000 0.0000 Constraint 641 967 0.8000 1.0000 2.0000 0.0000 Constraint 641 958 0.8000 1.0000 2.0000 0.0000 Constraint 641 951 0.8000 1.0000 2.0000 0.0000 Constraint 641 944 0.8000 1.0000 2.0000 0.0000 Constraint 641 939 0.8000 1.0000 2.0000 0.0000 Constraint 641 931 0.8000 1.0000 2.0000 0.0000 Constraint 641 924 0.8000 1.0000 2.0000 0.0000 Constraint 641 915 0.8000 1.0000 2.0000 0.0000 Constraint 641 907 0.8000 1.0000 2.0000 0.0000 Constraint 641 884 0.8000 1.0000 2.0000 0.0000 Constraint 641 871 0.8000 1.0000 2.0000 0.0000 Constraint 641 852 0.8000 1.0000 2.0000 0.0000 Constraint 641 833 0.8000 1.0000 2.0000 0.0000 Constraint 641 822 0.8000 1.0000 2.0000 0.0000 Constraint 641 814 0.8000 1.0000 2.0000 0.0000 Constraint 641 805 0.8000 1.0000 2.0000 0.0000 Constraint 641 762 0.8000 1.0000 2.0000 0.0000 Constraint 641 742 0.8000 1.0000 2.0000 0.0000 Constraint 641 723 0.8000 1.0000 2.0000 0.0000 Constraint 641 708 0.8000 1.0000 2.0000 0.0000 Constraint 641 700 0.8000 1.0000 2.0000 0.0000 Constraint 641 691 0.8000 1.0000 2.0000 0.0000 Constraint 641 683 0.8000 1.0000 2.0000 0.0000 Constraint 641 674 0.8000 1.0000 2.0000 0.0000 Constraint 641 669 0.8000 1.0000 2.0000 0.0000 Constraint 641 660 0.8000 1.0000 2.0000 0.0000 Constraint 641 649 0.8000 1.0000 2.0000 0.0000 Constraint 632 1476 0.8000 1.0000 2.0000 0.0000 Constraint 632 1467 0.8000 1.0000 2.0000 0.0000 Constraint 632 1459 0.8000 1.0000 2.0000 0.0000 Constraint 632 1451 0.8000 1.0000 2.0000 0.0000 Constraint 632 1442 0.8000 1.0000 2.0000 0.0000 Constraint 632 1430 0.8000 1.0000 2.0000 0.0000 Constraint 632 1421 0.8000 1.0000 2.0000 0.0000 Constraint 632 1413 0.8000 1.0000 2.0000 0.0000 Constraint 632 1402 0.8000 1.0000 2.0000 0.0000 Constraint 632 1395 0.8000 1.0000 2.0000 0.0000 Constraint 632 1381 0.8000 1.0000 2.0000 0.0000 Constraint 632 1362 0.8000 1.0000 2.0000 0.0000 Constraint 632 1354 0.8000 1.0000 2.0000 0.0000 Constraint 632 1347 0.8000 1.0000 2.0000 0.0000 Constraint 632 1339 0.8000 1.0000 2.0000 0.0000 Constraint 632 1329 0.8000 1.0000 2.0000 0.0000 Constraint 632 1318 0.8000 1.0000 2.0000 0.0000 Constraint 632 1306 0.8000 1.0000 2.0000 0.0000 Constraint 632 1295 0.8000 1.0000 2.0000 0.0000 Constraint 632 1288 0.8000 1.0000 2.0000 0.0000 Constraint 632 1281 0.8000 1.0000 2.0000 0.0000 Constraint 632 1272 0.8000 1.0000 2.0000 0.0000 Constraint 632 1264 0.8000 1.0000 2.0000 0.0000 Constraint 632 1256 0.8000 1.0000 2.0000 0.0000 Constraint 632 1244 0.8000 1.0000 2.0000 0.0000 Constraint 632 1235 0.8000 1.0000 2.0000 0.0000 Constraint 632 1225 0.8000 1.0000 2.0000 0.0000 Constraint 632 1213 0.8000 1.0000 2.0000 0.0000 Constraint 632 1208 0.8000 1.0000 2.0000 0.0000 Constraint 632 1201 0.8000 1.0000 2.0000 0.0000 Constraint 632 1192 0.8000 1.0000 2.0000 0.0000 Constraint 632 1159 0.8000 1.0000 2.0000 0.0000 Constraint 632 1150 0.8000 1.0000 2.0000 0.0000 Constraint 632 1144 0.8000 1.0000 2.0000 0.0000 Constraint 632 1133 0.8000 1.0000 2.0000 0.0000 Constraint 632 1124 0.8000 1.0000 2.0000 0.0000 Constraint 632 1095 0.8000 1.0000 2.0000 0.0000 Constraint 632 1075 0.8000 1.0000 2.0000 0.0000 Constraint 632 1066 0.8000 1.0000 2.0000 0.0000 Constraint 632 1051 0.8000 1.0000 2.0000 0.0000 Constraint 632 1039 0.8000 1.0000 2.0000 0.0000 Constraint 632 1031 0.8000 1.0000 2.0000 0.0000 Constraint 632 1024 0.8000 1.0000 2.0000 0.0000 Constraint 632 1015 0.8000 1.0000 2.0000 0.0000 Constraint 632 1007 0.8000 1.0000 2.0000 0.0000 Constraint 632 998 0.8000 1.0000 2.0000 0.0000 Constraint 632 990 0.8000 1.0000 2.0000 0.0000 Constraint 632 981 0.8000 1.0000 2.0000 0.0000 Constraint 632 958 0.8000 1.0000 2.0000 0.0000 Constraint 632 951 0.8000 1.0000 2.0000 0.0000 Constraint 632 939 0.8000 1.0000 2.0000 0.0000 Constraint 632 931 0.8000 1.0000 2.0000 0.0000 Constraint 632 915 0.8000 1.0000 2.0000 0.0000 Constraint 632 871 0.8000 1.0000 2.0000 0.0000 Constraint 632 864 0.8000 1.0000 2.0000 0.0000 Constraint 632 852 0.8000 1.0000 2.0000 0.0000 Constraint 632 841 0.8000 1.0000 2.0000 0.0000 Constraint 632 833 0.8000 1.0000 2.0000 0.0000 Constraint 632 822 0.8000 1.0000 2.0000 0.0000 Constraint 632 814 0.8000 1.0000 2.0000 0.0000 Constraint 632 723 0.8000 1.0000 2.0000 0.0000 Constraint 632 700 0.8000 1.0000 2.0000 0.0000 Constraint 632 691 0.8000 1.0000 2.0000 0.0000 Constraint 632 683 0.8000 1.0000 2.0000 0.0000 Constraint 632 674 0.8000 1.0000 2.0000 0.0000 Constraint 632 669 0.8000 1.0000 2.0000 0.0000 Constraint 632 660 0.8000 1.0000 2.0000 0.0000 Constraint 632 649 0.8000 1.0000 2.0000 0.0000 Constraint 632 641 0.8000 1.0000 2.0000 0.0000 Constraint 624 1476 0.8000 1.0000 2.0000 0.0000 Constraint 624 1467 0.8000 1.0000 2.0000 0.0000 Constraint 624 1459 0.8000 1.0000 2.0000 0.0000 Constraint 624 1451 0.8000 1.0000 2.0000 0.0000 Constraint 624 1442 0.8000 1.0000 2.0000 0.0000 Constraint 624 1430 0.8000 1.0000 2.0000 0.0000 Constraint 624 1421 0.8000 1.0000 2.0000 0.0000 Constraint 624 1395 0.8000 1.0000 2.0000 0.0000 Constraint 624 1386 0.8000 1.0000 2.0000 0.0000 Constraint 624 1381 0.8000 1.0000 2.0000 0.0000 Constraint 624 1373 0.8000 1.0000 2.0000 0.0000 Constraint 624 1362 0.8000 1.0000 2.0000 0.0000 Constraint 624 1354 0.8000 1.0000 2.0000 0.0000 Constraint 624 1347 0.8000 1.0000 2.0000 0.0000 Constraint 624 1339 0.8000 1.0000 2.0000 0.0000 Constraint 624 1329 0.8000 1.0000 2.0000 0.0000 Constraint 624 1318 0.8000 1.0000 2.0000 0.0000 Constraint 624 1306 0.8000 1.0000 2.0000 0.0000 Constraint 624 1295 0.8000 1.0000 2.0000 0.0000 Constraint 624 1288 0.8000 1.0000 2.0000 0.0000 Constraint 624 1281 0.8000 1.0000 2.0000 0.0000 Constraint 624 1272 0.8000 1.0000 2.0000 0.0000 Constraint 624 1264 0.8000 1.0000 2.0000 0.0000 Constraint 624 1256 0.8000 1.0000 2.0000 0.0000 Constraint 624 1244 0.8000 1.0000 2.0000 0.0000 Constraint 624 1235 0.8000 1.0000 2.0000 0.0000 Constraint 624 1225 0.8000 1.0000 2.0000 0.0000 Constraint 624 1213 0.8000 1.0000 2.0000 0.0000 Constraint 624 1208 0.8000 1.0000 2.0000 0.0000 Constraint 624 1201 0.8000 1.0000 2.0000 0.0000 Constraint 624 1192 0.8000 1.0000 2.0000 0.0000 Constraint 624 1186 0.8000 1.0000 2.0000 0.0000 Constraint 624 1174 0.8000 1.0000 2.0000 0.0000 Constraint 624 1168 0.8000 1.0000 2.0000 0.0000 Constraint 624 1159 0.8000 1.0000 2.0000 0.0000 Constraint 624 1150 0.8000 1.0000 2.0000 0.0000 Constraint 624 1144 0.8000 1.0000 2.0000 0.0000 Constraint 624 1133 0.8000 1.0000 2.0000 0.0000 Constraint 624 1124 0.8000 1.0000 2.0000 0.0000 Constraint 624 1075 0.8000 1.0000 2.0000 0.0000 Constraint 624 1051 0.8000 1.0000 2.0000 0.0000 Constraint 624 1039 0.8000 1.0000 2.0000 0.0000 Constraint 624 1015 0.8000 1.0000 2.0000 0.0000 Constraint 624 1007 0.8000 1.0000 2.0000 0.0000 Constraint 624 691 0.8000 1.0000 2.0000 0.0000 Constraint 624 683 0.8000 1.0000 2.0000 0.0000 Constraint 624 674 0.8000 1.0000 2.0000 0.0000 Constraint 624 669 0.8000 1.0000 2.0000 0.0000 Constraint 624 660 0.8000 1.0000 2.0000 0.0000 Constraint 624 649 0.8000 1.0000 2.0000 0.0000 Constraint 624 641 0.8000 1.0000 2.0000 0.0000 Constraint 624 632 0.8000 1.0000 2.0000 0.0000 Constraint 618 1476 0.8000 1.0000 2.0000 0.0000 Constraint 618 1467 0.8000 1.0000 2.0000 0.0000 Constraint 618 1459 0.8000 1.0000 2.0000 0.0000 Constraint 618 1451 0.8000 1.0000 2.0000 0.0000 Constraint 618 1442 0.8000 1.0000 2.0000 0.0000 Constraint 618 1430 0.8000 1.0000 2.0000 0.0000 Constraint 618 1413 0.8000 1.0000 2.0000 0.0000 Constraint 618 1402 0.8000 1.0000 2.0000 0.0000 Constraint 618 1381 0.8000 1.0000 2.0000 0.0000 Constraint 618 1354 0.8000 1.0000 2.0000 0.0000 Constraint 618 1339 0.8000 1.0000 2.0000 0.0000 Constraint 618 1329 0.8000 1.0000 2.0000 0.0000 Constraint 618 1318 0.8000 1.0000 2.0000 0.0000 Constraint 618 1306 0.8000 1.0000 2.0000 0.0000 Constraint 618 1295 0.8000 1.0000 2.0000 0.0000 Constraint 618 1288 0.8000 1.0000 2.0000 0.0000 Constraint 618 1281 0.8000 1.0000 2.0000 0.0000 Constraint 618 1272 0.8000 1.0000 2.0000 0.0000 Constraint 618 1264 0.8000 1.0000 2.0000 0.0000 Constraint 618 1256 0.8000 1.0000 2.0000 0.0000 Constraint 618 1244 0.8000 1.0000 2.0000 0.0000 Constraint 618 1235 0.8000 1.0000 2.0000 0.0000 Constraint 618 1225 0.8000 1.0000 2.0000 0.0000 Constraint 618 1213 0.8000 1.0000 2.0000 0.0000 Constraint 618 1208 0.8000 1.0000 2.0000 0.0000 Constraint 618 1201 0.8000 1.0000 2.0000 0.0000 Constraint 618 1186 0.8000 1.0000 2.0000 0.0000 Constraint 618 1168 0.8000 1.0000 2.0000 0.0000 Constraint 618 1124 0.8000 1.0000 2.0000 0.0000 Constraint 618 1051 0.8000 1.0000 2.0000 0.0000 Constraint 618 1039 0.8000 1.0000 2.0000 0.0000 Constraint 618 1031 0.8000 1.0000 2.0000 0.0000 Constraint 618 1024 0.8000 1.0000 2.0000 0.0000 Constraint 618 1015 0.8000 1.0000 2.0000 0.0000 Constraint 618 1007 0.8000 1.0000 2.0000 0.0000 Constraint 618 981 0.8000 1.0000 2.0000 0.0000 Constraint 618 973 0.8000 1.0000 2.0000 0.0000 Constraint 618 967 0.8000 1.0000 2.0000 0.0000 Constraint 618 958 0.8000 1.0000 2.0000 0.0000 Constraint 618 951 0.8000 1.0000 2.0000 0.0000 Constraint 618 944 0.8000 1.0000 2.0000 0.0000 Constraint 618 939 0.8000 1.0000 2.0000 0.0000 Constraint 618 931 0.8000 1.0000 2.0000 0.0000 Constraint 618 915 0.8000 1.0000 2.0000 0.0000 Constraint 618 716 0.8000 1.0000 2.0000 0.0000 Constraint 618 683 0.8000 1.0000 2.0000 0.0000 Constraint 618 674 0.8000 1.0000 2.0000 0.0000 Constraint 618 669 0.8000 1.0000 2.0000 0.0000 Constraint 618 660 0.8000 1.0000 2.0000 0.0000 Constraint 618 649 0.8000 1.0000 2.0000 0.0000 Constraint 618 641 0.8000 1.0000 2.0000 0.0000 Constraint 618 632 0.8000 1.0000 2.0000 0.0000 Constraint 618 624 0.8000 1.0000 2.0000 0.0000 Constraint 610 1476 0.8000 1.0000 2.0000 0.0000 Constraint 610 1467 0.8000 1.0000 2.0000 0.0000 Constraint 610 1459 0.8000 1.0000 2.0000 0.0000 Constraint 610 1451 0.8000 1.0000 2.0000 0.0000 Constraint 610 1442 0.8000 1.0000 2.0000 0.0000 Constraint 610 1430 0.8000 1.0000 2.0000 0.0000 Constraint 610 1421 0.8000 1.0000 2.0000 0.0000 Constraint 610 1413 0.8000 1.0000 2.0000 0.0000 Constraint 610 1402 0.8000 1.0000 2.0000 0.0000 Constraint 610 1386 0.8000 1.0000 2.0000 0.0000 Constraint 610 1381 0.8000 1.0000 2.0000 0.0000 Constraint 610 1373 0.8000 1.0000 2.0000 0.0000 Constraint 610 1362 0.8000 1.0000 2.0000 0.0000 Constraint 610 1354 0.8000 1.0000 2.0000 0.0000 Constraint 610 1339 0.8000 1.0000 2.0000 0.0000 Constraint 610 1306 0.8000 1.0000 2.0000 0.0000 Constraint 610 1295 0.8000 1.0000 2.0000 0.0000 Constraint 610 1288 0.8000 1.0000 2.0000 0.0000 Constraint 610 1281 0.8000 1.0000 2.0000 0.0000 Constraint 610 1272 0.8000 1.0000 2.0000 0.0000 Constraint 610 1264 0.8000 1.0000 2.0000 0.0000 Constraint 610 1256 0.8000 1.0000 2.0000 0.0000 Constraint 610 1244 0.8000 1.0000 2.0000 0.0000 Constraint 610 1235 0.8000 1.0000 2.0000 0.0000 Constraint 610 1208 0.8000 1.0000 2.0000 0.0000 Constraint 610 1124 0.8000 1.0000 2.0000 0.0000 Constraint 610 1066 0.8000 1.0000 2.0000 0.0000 Constraint 610 1051 0.8000 1.0000 2.0000 0.0000 Constraint 610 1039 0.8000 1.0000 2.0000 0.0000 Constraint 610 1031 0.8000 1.0000 2.0000 0.0000 Constraint 610 1024 0.8000 1.0000 2.0000 0.0000 Constraint 610 1015 0.8000 1.0000 2.0000 0.0000 Constraint 610 1007 0.8000 1.0000 2.0000 0.0000 Constraint 610 981 0.8000 1.0000 2.0000 0.0000 Constraint 610 958 0.8000 1.0000 2.0000 0.0000 Constraint 610 939 0.8000 1.0000 2.0000 0.0000 Constraint 610 674 0.8000 1.0000 2.0000 0.0000 Constraint 610 669 0.8000 1.0000 2.0000 0.0000 Constraint 610 660 0.8000 1.0000 2.0000 0.0000 Constraint 610 649 0.8000 1.0000 2.0000 0.0000 Constraint 610 641 0.8000 1.0000 2.0000 0.0000 Constraint 610 632 0.8000 1.0000 2.0000 0.0000 Constraint 610 624 0.8000 1.0000 2.0000 0.0000 Constraint 610 618 0.8000 1.0000 2.0000 0.0000 Constraint 602 1476 0.8000 1.0000 2.0000 0.0000 Constraint 602 1467 0.8000 1.0000 2.0000 0.0000 Constraint 602 1459 0.8000 1.0000 2.0000 0.0000 Constraint 602 1451 0.8000 1.0000 2.0000 0.0000 Constraint 602 1442 0.8000 1.0000 2.0000 0.0000 Constraint 602 1421 0.8000 1.0000 2.0000 0.0000 Constraint 602 1413 0.8000 1.0000 2.0000 0.0000 Constraint 602 1402 0.8000 1.0000 2.0000 0.0000 Constraint 602 1386 0.8000 1.0000 2.0000 0.0000 Constraint 602 1381 0.8000 1.0000 2.0000 0.0000 Constraint 602 1373 0.8000 1.0000 2.0000 0.0000 Constraint 602 1362 0.8000 1.0000 2.0000 0.0000 Constraint 602 1354 0.8000 1.0000 2.0000 0.0000 Constraint 602 1347 0.8000 1.0000 2.0000 0.0000 Constraint 602 1318 0.8000 1.0000 2.0000 0.0000 Constraint 602 1306 0.8000 1.0000 2.0000 0.0000 Constraint 602 1295 0.8000 1.0000 2.0000 0.0000 Constraint 602 1288 0.8000 1.0000 2.0000 0.0000 Constraint 602 1281 0.8000 1.0000 2.0000 0.0000 Constraint 602 1272 0.8000 1.0000 2.0000 0.0000 Constraint 602 1264 0.8000 1.0000 2.0000 0.0000 Constraint 602 1256 0.8000 1.0000 2.0000 0.0000 Constraint 602 1244 0.8000 1.0000 2.0000 0.0000 Constraint 602 1235 0.8000 1.0000 2.0000 0.0000 Constraint 602 1225 0.8000 1.0000 2.0000 0.0000 Constraint 602 1213 0.8000 1.0000 2.0000 0.0000 Constraint 602 1208 0.8000 1.0000 2.0000 0.0000 Constraint 602 1192 0.8000 1.0000 2.0000 0.0000 Constraint 602 1168 0.8000 1.0000 2.0000 0.0000 Constraint 602 1150 0.8000 1.0000 2.0000 0.0000 Constraint 602 1066 0.8000 1.0000 2.0000 0.0000 Constraint 602 1051 0.8000 1.0000 2.0000 0.0000 Constraint 602 1039 0.8000 1.0000 2.0000 0.0000 Constraint 602 1031 0.8000 1.0000 2.0000 0.0000 Constraint 602 1024 0.8000 1.0000 2.0000 0.0000 Constraint 602 1015 0.8000 1.0000 2.0000 0.0000 Constraint 602 998 0.8000 1.0000 2.0000 0.0000 Constraint 602 958 0.8000 1.0000 2.0000 0.0000 Constraint 602 939 0.8000 1.0000 2.0000 0.0000 Constraint 602 669 0.8000 1.0000 2.0000 0.0000 Constraint 602 660 0.8000 1.0000 2.0000 0.0000 Constraint 602 649 0.8000 1.0000 2.0000 0.0000 Constraint 602 641 0.8000 1.0000 2.0000 0.0000 Constraint 602 632 0.8000 1.0000 2.0000 0.0000 Constraint 602 624 0.8000 1.0000 2.0000 0.0000 Constraint 602 618 0.8000 1.0000 2.0000 0.0000 Constraint 602 610 0.8000 1.0000 2.0000 0.0000 Constraint 596 1476 0.8000 1.0000 2.0000 0.0000 Constraint 596 1467 0.8000 1.0000 2.0000 0.0000 Constraint 596 1442 0.8000 1.0000 2.0000 0.0000 Constraint 596 1421 0.8000 1.0000 2.0000 0.0000 Constraint 596 1413 0.8000 1.0000 2.0000 0.0000 Constraint 596 1402 0.8000 1.0000 2.0000 0.0000 Constraint 596 1386 0.8000 1.0000 2.0000 0.0000 Constraint 596 1381 0.8000 1.0000 2.0000 0.0000 Constraint 596 1373 0.8000 1.0000 2.0000 0.0000 Constraint 596 1362 0.8000 1.0000 2.0000 0.0000 Constraint 596 1354 0.8000 1.0000 2.0000 0.0000 Constraint 596 1347 0.8000 1.0000 2.0000 0.0000 Constraint 596 1339 0.8000 1.0000 2.0000 0.0000 Constraint 596 1318 0.8000 1.0000 2.0000 0.0000 Constraint 596 1306 0.8000 1.0000 2.0000 0.0000 Constraint 596 1295 0.8000 1.0000 2.0000 0.0000 Constraint 596 1288 0.8000 1.0000 2.0000 0.0000 Constraint 596 1281 0.8000 1.0000 2.0000 0.0000 Constraint 596 1272 0.8000 1.0000 2.0000 0.0000 Constraint 596 1264 0.8000 1.0000 2.0000 0.0000 Constraint 596 1244 0.8000 1.0000 2.0000 0.0000 Constraint 596 1235 0.8000 1.0000 2.0000 0.0000 Constraint 596 1225 0.8000 1.0000 2.0000 0.0000 Constraint 596 1208 0.8000 1.0000 2.0000 0.0000 Constraint 596 1192 0.8000 1.0000 2.0000 0.0000 Constraint 596 1186 0.8000 1.0000 2.0000 0.0000 Constraint 596 1159 0.8000 1.0000 2.0000 0.0000 Constraint 596 1150 0.8000 1.0000 2.0000 0.0000 Constraint 596 1144 0.8000 1.0000 2.0000 0.0000 Constraint 596 1124 0.8000 1.0000 2.0000 0.0000 Constraint 596 1075 0.8000 1.0000 2.0000 0.0000 Constraint 596 1066 0.8000 1.0000 2.0000 0.0000 Constraint 596 1051 0.8000 1.0000 2.0000 0.0000 Constraint 596 1039 0.8000 1.0000 2.0000 0.0000 Constraint 596 1031 0.8000 1.0000 2.0000 0.0000 Constraint 596 1024 0.8000 1.0000 2.0000 0.0000 Constraint 596 1007 0.8000 1.0000 2.0000 0.0000 Constraint 596 998 0.8000 1.0000 2.0000 0.0000 Constraint 596 958 0.8000 1.0000 2.0000 0.0000 Constraint 596 915 0.8000 1.0000 2.0000 0.0000 Constraint 596 907 0.8000 1.0000 2.0000 0.0000 Constraint 596 716 0.8000 1.0000 2.0000 0.0000 Constraint 596 700 0.8000 1.0000 2.0000 0.0000 Constraint 596 669 0.8000 1.0000 2.0000 0.0000 Constraint 596 660 0.8000 1.0000 2.0000 0.0000 Constraint 596 649 0.8000 1.0000 2.0000 0.0000 Constraint 596 641 0.8000 1.0000 2.0000 0.0000 Constraint 596 632 0.8000 1.0000 2.0000 0.0000 Constraint 596 624 0.8000 1.0000 2.0000 0.0000 Constraint 596 618 0.8000 1.0000 2.0000 0.0000 Constraint 596 610 0.8000 1.0000 2.0000 0.0000 Constraint 596 602 0.8000 1.0000 2.0000 0.0000 Constraint 585 1476 0.8000 1.0000 2.0000 0.0000 Constraint 585 1467 0.8000 1.0000 2.0000 0.0000 Constraint 585 1459 0.8000 1.0000 2.0000 0.0000 Constraint 585 1451 0.8000 1.0000 2.0000 0.0000 Constraint 585 1442 0.8000 1.0000 2.0000 0.0000 Constraint 585 1430 0.8000 1.0000 2.0000 0.0000 Constraint 585 1421 0.8000 1.0000 2.0000 0.0000 Constraint 585 1413 0.8000 1.0000 2.0000 0.0000 Constraint 585 1402 0.8000 1.0000 2.0000 0.0000 Constraint 585 1395 0.8000 1.0000 2.0000 0.0000 Constraint 585 1386 0.8000 1.0000 2.0000 0.0000 Constraint 585 1381 0.8000 1.0000 2.0000 0.0000 Constraint 585 1373 0.8000 1.0000 2.0000 0.0000 Constraint 585 1354 0.8000 1.0000 2.0000 0.0000 Constraint 585 1347 0.8000 1.0000 2.0000 0.0000 Constraint 585 1339 0.8000 1.0000 2.0000 0.0000 Constraint 585 1318 0.8000 1.0000 2.0000 0.0000 Constraint 585 1306 0.8000 1.0000 2.0000 0.0000 Constraint 585 1295 0.8000 1.0000 2.0000 0.0000 Constraint 585 1288 0.8000 1.0000 2.0000 0.0000 Constraint 585 1281 0.8000 1.0000 2.0000 0.0000 Constraint 585 1272 0.8000 1.0000 2.0000 0.0000 Constraint 585 1264 0.8000 1.0000 2.0000 0.0000 Constraint 585 1244 0.8000 1.0000 2.0000 0.0000 Constraint 585 1235 0.8000 1.0000 2.0000 0.0000 Constraint 585 1225 0.8000 1.0000 2.0000 0.0000 Constraint 585 1208 0.8000 1.0000 2.0000 0.0000 Constraint 585 1192 0.8000 1.0000 2.0000 0.0000 Constraint 585 1174 0.8000 1.0000 2.0000 0.0000 Constraint 585 1168 0.8000 1.0000 2.0000 0.0000 Constraint 585 1159 0.8000 1.0000 2.0000 0.0000 Constraint 585 1150 0.8000 1.0000 2.0000 0.0000 Constraint 585 1066 0.8000 1.0000 2.0000 0.0000 Constraint 585 1051 0.8000 1.0000 2.0000 0.0000 Constraint 585 1039 0.8000 1.0000 2.0000 0.0000 Constraint 585 1024 0.8000 1.0000 2.0000 0.0000 Constraint 585 1007 0.8000 1.0000 2.0000 0.0000 Constraint 585 998 0.8000 1.0000 2.0000 0.0000 Constraint 585 990 0.8000 1.0000 2.0000 0.0000 Constraint 585 958 0.8000 1.0000 2.0000 0.0000 Constraint 585 939 0.8000 1.0000 2.0000 0.0000 Constraint 585 931 0.8000 1.0000 2.0000 0.0000 Constraint 585 907 0.8000 1.0000 2.0000 0.0000 Constraint 585 691 0.8000 1.0000 2.0000 0.0000 Constraint 585 669 0.8000 1.0000 2.0000 0.0000 Constraint 585 660 0.8000 1.0000 2.0000 0.0000 Constraint 585 649 0.8000 1.0000 2.0000 0.0000 Constraint 585 641 0.8000 1.0000 2.0000 0.0000 Constraint 585 632 0.8000 1.0000 2.0000 0.0000 Constraint 585 624 0.8000 1.0000 2.0000 0.0000 Constraint 585 618 0.8000 1.0000 2.0000 0.0000 Constraint 585 610 0.8000 1.0000 2.0000 0.0000 Constraint 585 602 0.8000 1.0000 2.0000 0.0000 Constraint 585 596 0.8000 1.0000 2.0000 0.0000 Constraint 579 1476 0.8000 1.0000 2.0000 0.0000 Constraint 579 1467 0.8000 1.0000 2.0000 0.0000 Constraint 579 1442 0.8000 1.0000 2.0000 0.0000 Constraint 579 1421 0.8000 1.0000 2.0000 0.0000 Constraint 579 1413 0.8000 1.0000 2.0000 0.0000 Constraint 579 1402 0.8000 1.0000 2.0000 0.0000 Constraint 579 1395 0.8000 1.0000 2.0000 0.0000 Constraint 579 1386 0.8000 1.0000 2.0000 0.0000 Constraint 579 1381 0.8000 1.0000 2.0000 0.0000 Constraint 579 1373 0.8000 1.0000 2.0000 0.0000 Constraint 579 1362 0.8000 1.0000 2.0000 0.0000 Constraint 579 1354 0.8000 1.0000 2.0000 0.0000 Constraint 579 1347 0.8000 1.0000 2.0000 0.0000 Constraint 579 1339 0.8000 1.0000 2.0000 0.0000 Constraint 579 1318 0.8000 1.0000 2.0000 0.0000 Constraint 579 1295 0.8000 1.0000 2.0000 0.0000 Constraint 579 1288 0.8000 1.0000 2.0000 0.0000 Constraint 579 1281 0.8000 1.0000 2.0000 0.0000 Constraint 579 1272 0.8000 1.0000 2.0000 0.0000 Constraint 579 1264 0.8000 1.0000 2.0000 0.0000 Constraint 579 1244 0.8000 1.0000 2.0000 0.0000 Constraint 579 1235 0.8000 1.0000 2.0000 0.0000 Constraint 579 1225 0.8000 1.0000 2.0000 0.0000 Constraint 579 1208 0.8000 1.0000 2.0000 0.0000 Constraint 579 1192 0.8000 1.0000 2.0000 0.0000 Constraint 579 1186 0.8000 1.0000 2.0000 0.0000 Constraint 579 1174 0.8000 1.0000 2.0000 0.0000 Constraint 579 1168 0.8000 1.0000 2.0000 0.0000 Constraint 579 1159 0.8000 1.0000 2.0000 0.0000 Constraint 579 1150 0.8000 1.0000 2.0000 0.0000 Constraint 579 1144 0.8000 1.0000 2.0000 0.0000 Constraint 579 1124 0.8000 1.0000 2.0000 0.0000 Constraint 579 1066 0.8000 1.0000 2.0000 0.0000 Constraint 579 1051 0.8000 1.0000 2.0000 0.0000 Constraint 579 1039 0.8000 1.0000 2.0000 0.0000 Constraint 579 1031 0.8000 1.0000 2.0000 0.0000 Constraint 579 1024 0.8000 1.0000 2.0000 0.0000 Constraint 579 1007 0.8000 1.0000 2.0000 0.0000 Constraint 579 998 0.8000 1.0000 2.0000 0.0000 Constraint 579 907 0.8000 1.0000 2.0000 0.0000 Constraint 579 900 0.8000 1.0000 2.0000 0.0000 Constraint 579 892 0.8000 1.0000 2.0000 0.0000 Constraint 579 700 0.8000 1.0000 2.0000 0.0000 Constraint 579 691 0.8000 1.0000 2.0000 0.0000 Constraint 579 669 0.8000 1.0000 2.0000 0.0000 Constraint 579 660 0.8000 1.0000 2.0000 0.0000 Constraint 579 641 0.8000 1.0000 2.0000 0.0000 Constraint 579 632 0.8000 1.0000 2.0000 0.0000 Constraint 579 624 0.8000 1.0000 2.0000 0.0000 Constraint 579 618 0.8000 1.0000 2.0000 0.0000 Constraint 579 610 0.8000 1.0000 2.0000 0.0000 Constraint 579 602 0.8000 1.0000 2.0000 0.0000 Constraint 579 596 0.8000 1.0000 2.0000 0.0000 Constraint 579 585 0.8000 1.0000 2.0000 0.0000 Constraint 570 1476 0.8000 1.0000 2.0000 0.0000 Constraint 570 1467 0.8000 1.0000 2.0000 0.0000 Constraint 570 1459 0.8000 1.0000 2.0000 0.0000 Constraint 570 1451 0.8000 1.0000 2.0000 0.0000 Constraint 570 1442 0.8000 1.0000 2.0000 0.0000 Constraint 570 1430 0.8000 1.0000 2.0000 0.0000 Constraint 570 1421 0.8000 1.0000 2.0000 0.0000 Constraint 570 1413 0.8000 1.0000 2.0000 0.0000 Constraint 570 1402 0.8000 1.0000 2.0000 0.0000 Constraint 570 1395 0.8000 1.0000 2.0000 0.0000 Constraint 570 1386 0.8000 1.0000 2.0000 0.0000 Constraint 570 1381 0.8000 1.0000 2.0000 0.0000 Constraint 570 1373 0.8000 1.0000 2.0000 0.0000 Constraint 570 1362 0.8000 1.0000 2.0000 0.0000 Constraint 570 1354 0.8000 1.0000 2.0000 0.0000 Constraint 570 1347 0.8000 1.0000 2.0000 0.0000 Constraint 570 1339 0.8000 1.0000 2.0000 0.0000 Constraint 570 1329 0.8000 1.0000 2.0000 0.0000 Constraint 570 1318 0.8000 1.0000 2.0000 0.0000 Constraint 570 1295 0.8000 1.0000 2.0000 0.0000 Constraint 570 1272 0.8000 1.0000 2.0000 0.0000 Constraint 570 1264 0.8000 1.0000 2.0000 0.0000 Constraint 570 1244 0.8000 1.0000 2.0000 0.0000 Constraint 570 1235 0.8000 1.0000 2.0000 0.0000 Constraint 570 1225 0.8000 1.0000 2.0000 0.0000 Constraint 570 1213 0.8000 1.0000 2.0000 0.0000 Constraint 570 1208 0.8000 1.0000 2.0000 0.0000 Constraint 570 1201 0.8000 1.0000 2.0000 0.0000 Constraint 570 1192 0.8000 1.0000 2.0000 0.0000 Constraint 570 1186 0.8000 1.0000 2.0000 0.0000 Constraint 570 1174 0.8000 1.0000 2.0000 0.0000 Constraint 570 1168 0.8000 1.0000 2.0000 0.0000 Constraint 570 1159 0.8000 1.0000 2.0000 0.0000 Constraint 570 1150 0.8000 1.0000 2.0000 0.0000 Constraint 570 1144 0.8000 1.0000 2.0000 0.0000 Constraint 570 1124 0.8000 1.0000 2.0000 0.0000 Constraint 570 1087 0.8000 1.0000 2.0000 0.0000 Constraint 570 1066 0.8000 1.0000 2.0000 0.0000 Constraint 570 1051 0.8000 1.0000 2.0000 0.0000 Constraint 570 1031 0.8000 1.0000 2.0000 0.0000 Constraint 570 1024 0.8000 1.0000 2.0000 0.0000 Constraint 570 1015 0.8000 1.0000 2.0000 0.0000 Constraint 570 1007 0.8000 1.0000 2.0000 0.0000 Constraint 570 998 0.8000 1.0000 2.0000 0.0000 Constraint 570 958 0.8000 1.0000 2.0000 0.0000 Constraint 570 944 0.8000 1.0000 2.0000 0.0000 Constraint 570 939 0.8000 1.0000 2.0000 0.0000 Constraint 570 931 0.8000 1.0000 2.0000 0.0000 Constraint 570 907 0.8000 1.0000 2.0000 0.0000 Constraint 570 742 0.8000 1.0000 2.0000 0.0000 Constraint 570 700 0.8000 1.0000 2.0000 0.0000 Constraint 570 683 0.8000 1.0000 2.0000 0.0000 Constraint 570 669 0.8000 1.0000 2.0000 0.0000 Constraint 570 660 0.8000 1.0000 2.0000 0.0000 Constraint 570 632 0.8000 1.0000 2.0000 0.0000 Constraint 570 624 0.8000 1.0000 2.0000 0.0000 Constraint 570 618 0.8000 1.0000 2.0000 0.0000 Constraint 570 610 0.8000 1.0000 2.0000 0.0000 Constraint 570 602 0.8000 1.0000 2.0000 0.0000 Constraint 570 596 0.8000 1.0000 2.0000 0.0000 Constraint 570 585 0.8000 1.0000 2.0000 0.0000 Constraint 570 579 0.8000 1.0000 2.0000 0.0000 Constraint 562 1476 0.8000 1.0000 2.0000 0.0000 Constraint 562 1467 0.8000 1.0000 2.0000 0.0000 Constraint 562 1459 0.8000 1.0000 2.0000 0.0000 Constraint 562 1451 0.8000 1.0000 2.0000 0.0000 Constraint 562 1442 0.8000 1.0000 2.0000 0.0000 Constraint 562 1430 0.8000 1.0000 2.0000 0.0000 Constraint 562 1421 0.8000 1.0000 2.0000 0.0000 Constraint 562 1413 0.8000 1.0000 2.0000 0.0000 Constraint 562 1402 0.8000 1.0000 2.0000 0.0000 Constraint 562 1395 0.8000 1.0000 2.0000 0.0000 Constraint 562 1386 0.8000 1.0000 2.0000 0.0000 Constraint 562 1381 0.8000 1.0000 2.0000 0.0000 Constraint 562 1373 0.8000 1.0000 2.0000 0.0000 Constraint 562 1362 0.8000 1.0000 2.0000 0.0000 Constraint 562 1354 0.8000 1.0000 2.0000 0.0000 Constraint 562 1347 0.8000 1.0000 2.0000 0.0000 Constraint 562 1339 0.8000 1.0000 2.0000 0.0000 Constraint 562 1329 0.8000 1.0000 2.0000 0.0000 Constraint 562 1318 0.8000 1.0000 2.0000 0.0000 Constraint 562 1306 0.8000 1.0000 2.0000 0.0000 Constraint 562 1281 0.8000 1.0000 2.0000 0.0000 Constraint 562 1272 0.8000 1.0000 2.0000 0.0000 Constraint 562 1264 0.8000 1.0000 2.0000 0.0000 Constraint 562 1256 0.8000 1.0000 2.0000 0.0000 Constraint 562 1244 0.8000 1.0000 2.0000 0.0000 Constraint 562 1235 0.8000 1.0000 2.0000 0.0000 Constraint 562 1225 0.8000 1.0000 2.0000 0.0000 Constraint 562 1213 0.8000 1.0000 2.0000 0.0000 Constraint 562 1208 0.8000 1.0000 2.0000 0.0000 Constraint 562 1201 0.8000 1.0000 2.0000 0.0000 Constraint 562 1192 0.8000 1.0000 2.0000 0.0000 Constraint 562 1186 0.8000 1.0000 2.0000 0.0000 Constraint 562 1174 0.8000 1.0000 2.0000 0.0000 Constraint 562 1168 0.8000 1.0000 2.0000 0.0000 Constraint 562 1159 0.8000 1.0000 2.0000 0.0000 Constraint 562 1150 0.8000 1.0000 2.0000 0.0000 Constraint 562 1087 0.8000 1.0000 2.0000 0.0000 Constraint 562 1075 0.8000 1.0000 2.0000 0.0000 Constraint 562 1066 0.8000 1.0000 2.0000 0.0000 Constraint 562 1051 0.8000 1.0000 2.0000 0.0000 Constraint 562 1039 0.8000 1.0000 2.0000 0.0000 Constraint 562 1031 0.8000 1.0000 2.0000 0.0000 Constraint 562 1024 0.8000 1.0000 2.0000 0.0000 Constraint 562 1015 0.8000 1.0000 2.0000 0.0000 Constraint 562 1007 0.8000 1.0000 2.0000 0.0000 Constraint 562 998 0.8000 1.0000 2.0000 0.0000 Constraint 562 990 0.8000 1.0000 2.0000 0.0000 Constraint 562 967 0.8000 1.0000 2.0000 0.0000 Constraint 562 958 0.8000 1.0000 2.0000 0.0000 Constraint 562 951 0.8000 1.0000 2.0000 0.0000 Constraint 562 944 0.8000 1.0000 2.0000 0.0000 Constraint 562 939 0.8000 1.0000 2.0000 0.0000 Constraint 562 931 0.8000 1.0000 2.0000 0.0000 Constraint 562 915 0.8000 1.0000 2.0000 0.0000 Constraint 562 907 0.8000 1.0000 2.0000 0.0000 Constraint 562 762 0.8000 1.0000 2.0000 0.0000 Constraint 562 700 0.8000 1.0000 2.0000 0.0000 Constraint 562 669 0.8000 1.0000 2.0000 0.0000 Constraint 562 632 0.8000 1.0000 2.0000 0.0000 Constraint 562 624 0.8000 1.0000 2.0000 0.0000 Constraint 562 618 0.8000 1.0000 2.0000 0.0000 Constraint 562 610 0.8000 1.0000 2.0000 0.0000 Constraint 562 602 0.8000 1.0000 2.0000 0.0000 Constraint 562 596 0.8000 1.0000 2.0000 0.0000 Constraint 562 585 0.8000 1.0000 2.0000 0.0000 Constraint 562 579 0.8000 1.0000 2.0000 0.0000 Constraint 562 570 0.8000 1.0000 2.0000 0.0000 Constraint 551 1476 0.8000 1.0000 2.0000 0.0000 Constraint 551 1467 0.8000 1.0000 2.0000 0.0000 Constraint 551 1459 0.8000 1.0000 2.0000 0.0000 Constraint 551 1451 0.8000 1.0000 2.0000 0.0000 Constraint 551 1442 0.8000 1.0000 2.0000 0.0000 Constraint 551 1430 0.8000 1.0000 2.0000 0.0000 Constraint 551 1421 0.8000 1.0000 2.0000 0.0000 Constraint 551 1413 0.8000 1.0000 2.0000 0.0000 Constraint 551 1402 0.8000 1.0000 2.0000 0.0000 Constraint 551 1395 0.8000 1.0000 2.0000 0.0000 Constraint 551 1386 0.8000 1.0000 2.0000 0.0000 Constraint 551 1381 0.8000 1.0000 2.0000 0.0000 Constraint 551 1373 0.8000 1.0000 2.0000 0.0000 Constraint 551 1362 0.8000 1.0000 2.0000 0.0000 Constraint 551 1354 0.8000 1.0000 2.0000 0.0000 Constraint 551 1347 0.8000 1.0000 2.0000 0.0000 Constraint 551 1339 0.8000 1.0000 2.0000 0.0000 Constraint 551 1329 0.8000 1.0000 2.0000 0.0000 Constraint 551 1318 0.8000 1.0000 2.0000 0.0000 Constraint 551 1306 0.8000 1.0000 2.0000 0.0000 Constraint 551 1295 0.8000 1.0000 2.0000 0.0000 Constraint 551 1288 0.8000 1.0000 2.0000 0.0000 Constraint 551 1281 0.8000 1.0000 2.0000 0.0000 Constraint 551 1272 0.8000 1.0000 2.0000 0.0000 Constraint 551 1264 0.8000 1.0000 2.0000 0.0000 Constraint 551 1256 0.8000 1.0000 2.0000 0.0000 Constraint 551 1244 0.8000 1.0000 2.0000 0.0000 Constraint 551 1235 0.8000 1.0000 2.0000 0.0000 Constraint 551 1225 0.8000 1.0000 2.0000 0.0000 Constraint 551 1213 0.8000 1.0000 2.0000 0.0000 Constraint 551 1208 0.8000 1.0000 2.0000 0.0000 Constraint 551 1201 0.8000 1.0000 2.0000 0.0000 Constraint 551 1192 0.8000 1.0000 2.0000 0.0000 Constraint 551 1186 0.8000 1.0000 2.0000 0.0000 Constraint 551 1174 0.8000 1.0000 2.0000 0.0000 Constraint 551 1168 0.8000 1.0000 2.0000 0.0000 Constraint 551 1159 0.8000 1.0000 2.0000 0.0000 Constraint 551 1150 0.8000 1.0000 2.0000 0.0000 Constraint 551 1144 0.8000 1.0000 2.0000 0.0000 Constraint 551 1133 0.8000 1.0000 2.0000 0.0000 Constraint 551 1124 0.8000 1.0000 2.0000 0.0000 Constraint 551 1066 0.8000 1.0000 2.0000 0.0000 Constraint 551 1051 0.8000 1.0000 2.0000 0.0000 Constraint 551 1039 0.8000 1.0000 2.0000 0.0000 Constraint 551 1031 0.8000 1.0000 2.0000 0.0000 Constraint 551 1024 0.8000 1.0000 2.0000 0.0000 Constraint 551 1007 0.8000 1.0000 2.0000 0.0000 Constraint 551 998 0.8000 1.0000 2.0000 0.0000 Constraint 551 990 0.8000 1.0000 2.0000 0.0000 Constraint 551 981 0.8000 1.0000 2.0000 0.0000 Constraint 551 973 0.8000 1.0000 2.0000 0.0000 Constraint 551 958 0.8000 1.0000 2.0000 0.0000 Constraint 551 944 0.8000 1.0000 2.0000 0.0000 Constraint 551 939 0.8000 1.0000 2.0000 0.0000 Constraint 551 931 0.8000 1.0000 2.0000 0.0000 Constraint 551 915 0.8000 1.0000 2.0000 0.0000 Constraint 551 907 0.8000 1.0000 2.0000 0.0000 Constraint 551 781 0.8000 1.0000 2.0000 0.0000 Constraint 551 756 0.8000 1.0000 2.0000 0.0000 Constraint 551 742 0.8000 1.0000 2.0000 0.0000 Constraint 551 691 0.8000 1.0000 2.0000 0.0000 Constraint 551 669 0.8000 1.0000 2.0000 0.0000 Constraint 551 660 0.8000 1.0000 2.0000 0.0000 Constraint 551 632 0.8000 1.0000 2.0000 0.0000 Constraint 551 618 0.8000 1.0000 2.0000 0.0000 Constraint 551 610 0.8000 1.0000 2.0000 0.0000 Constraint 551 602 0.8000 1.0000 2.0000 0.0000 Constraint 551 596 0.8000 1.0000 2.0000 0.0000 Constraint 551 585 0.8000 1.0000 2.0000 0.0000 Constraint 551 579 0.8000 1.0000 2.0000 0.0000 Constraint 551 570 0.8000 1.0000 2.0000 0.0000 Constraint 551 562 0.8000 1.0000 2.0000 0.0000 Constraint 544 1476 0.8000 1.0000 2.0000 0.0000 Constraint 544 1467 0.8000 1.0000 2.0000 0.0000 Constraint 544 1459 0.8000 1.0000 2.0000 0.0000 Constraint 544 1451 0.8000 1.0000 2.0000 0.0000 Constraint 544 1442 0.8000 1.0000 2.0000 0.0000 Constraint 544 1430 0.8000 1.0000 2.0000 0.0000 Constraint 544 1421 0.8000 1.0000 2.0000 0.0000 Constraint 544 1413 0.8000 1.0000 2.0000 0.0000 Constraint 544 1402 0.8000 1.0000 2.0000 0.0000 Constraint 544 1395 0.8000 1.0000 2.0000 0.0000 Constraint 544 1386 0.8000 1.0000 2.0000 0.0000 Constraint 544 1381 0.8000 1.0000 2.0000 0.0000 Constraint 544 1373 0.8000 1.0000 2.0000 0.0000 Constraint 544 1362 0.8000 1.0000 2.0000 0.0000 Constraint 544 1354 0.8000 1.0000 2.0000 0.0000 Constraint 544 1347 0.8000 1.0000 2.0000 0.0000 Constraint 544 1339 0.8000 1.0000 2.0000 0.0000 Constraint 544 1329 0.8000 1.0000 2.0000 0.0000 Constraint 544 1318 0.8000 1.0000 2.0000 0.0000 Constraint 544 1306 0.8000 1.0000 2.0000 0.0000 Constraint 544 1295 0.8000 1.0000 2.0000 0.0000 Constraint 544 1288 0.8000 1.0000 2.0000 0.0000 Constraint 544 1281 0.8000 1.0000 2.0000 0.0000 Constraint 544 1272 0.8000 1.0000 2.0000 0.0000 Constraint 544 1264 0.8000 1.0000 2.0000 0.0000 Constraint 544 1256 0.8000 1.0000 2.0000 0.0000 Constraint 544 1244 0.8000 1.0000 2.0000 0.0000 Constraint 544 1235 0.8000 1.0000 2.0000 0.0000 Constraint 544 1225 0.8000 1.0000 2.0000 0.0000 Constraint 544 1213 0.8000 1.0000 2.0000 0.0000 Constraint 544 1208 0.8000 1.0000 2.0000 0.0000 Constraint 544 1201 0.8000 1.0000 2.0000 0.0000 Constraint 544 1192 0.8000 1.0000 2.0000 0.0000 Constraint 544 1186 0.8000 1.0000 2.0000 0.0000 Constraint 544 1174 0.8000 1.0000 2.0000 0.0000 Constraint 544 1168 0.8000 1.0000 2.0000 0.0000 Constraint 544 1159 0.8000 1.0000 2.0000 0.0000 Constraint 544 1150 0.8000 1.0000 2.0000 0.0000 Constraint 544 1144 0.8000 1.0000 2.0000 0.0000 Constraint 544 1133 0.8000 1.0000 2.0000 0.0000 Constraint 544 1124 0.8000 1.0000 2.0000 0.0000 Constraint 544 1087 0.8000 1.0000 2.0000 0.0000 Constraint 544 1066 0.8000 1.0000 2.0000 0.0000 Constraint 544 1051 0.8000 1.0000 2.0000 0.0000 Constraint 544 1015 0.8000 1.0000 2.0000 0.0000 Constraint 544 973 0.8000 1.0000 2.0000 0.0000 Constraint 544 967 0.8000 1.0000 2.0000 0.0000 Constraint 544 958 0.8000 1.0000 2.0000 0.0000 Constraint 544 951 0.8000 1.0000 2.0000 0.0000 Constraint 544 944 0.8000 1.0000 2.0000 0.0000 Constraint 544 939 0.8000 1.0000 2.0000 0.0000 Constraint 544 931 0.8000 1.0000 2.0000 0.0000 Constraint 544 924 0.8000 1.0000 2.0000 0.0000 Constraint 544 915 0.8000 1.0000 2.0000 0.0000 Constraint 544 907 0.8000 1.0000 2.0000 0.0000 Constraint 544 900 0.8000 1.0000 2.0000 0.0000 Constraint 544 892 0.8000 1.0000 2.0000 0.0000 Constraint 544 742 0.8000 1.0000 2.0000 0.0000 Constraint 544 728 0.8000 1.0000 2.0000 0.0000 Constraint 544 716 0.8000 1.0000 2.0000 0.0000 Constraint 544 708 0.8000 1.0000 2.0000 0.0000 Constraint 544 669 0.8000 1.0000 2.0000 0.0000 Constraint 544 660 0.8000 1.0000 2.0000 0.0000 Constraint 544 641 0.8000 1.0000 2.0000 0.0000 Constraint 544 632 0.8000 1.0000 2.0000 0.0000 Constraint 544 610 0.8000 1.0000 2.0000 0.0000 Constraint 544 602 0.8000 1.0000 2.0000 0.0000 Constraint 544 596 0.8000 1.0000 2.0000 0.0000 Constraint 544 585 0.8000 1.0000 2.0000 0.0000 Constraint 544 579 0.8000 1.0000 2.0000 0.0000 Constraint 544 570 0.8000 1.0000 2.0000 0.0000 Constraint 544 562 0.8000 1.0000 2.0000 0.0000 Constraint 544 551 0.8000 1.0000 2.0000 0.0000 Constraint 532 1476 0.8000 1.0000 2.0000 0.0000 Constraint 532 1467 0.8000 1.0000 2.0000 0.0000 Constraint 532 1459 0.8000 1.0000 2.0000 0.0000 Constraint 532 1451 0.8000 1.0000 2.0000 0.0000 Constraint 532 1442 0.8000 1.0000 2.0000 0.0000 Constraint 532 1430 0.8000 1.0000 2.0000 0.0000 Constraint 532 1421 0.8000 1.0000 2.0000 0.0000 Constraint 532 1413 0.8000 1.0000 2.0000 0.0000 Constraint 532 1402 0.8000 1.0000 2.0000 0.0000 Constraint 532 1395 0.8000 1.0000 2.0000 0.0000 Constraint 532 1386 0.8000 1.0000 2.0000 0.0000 Constraint 532 1381 0.8000 1.0000 2.0000 0.0000 Constraint 532 1373 0.8000 1.0000 2.0000 0.0000 Constraint 532 1362 0.8000 1.0000 2.0000 0.0000 Constraint 532 1354 0.8000 1.0000 2.0000 0.0000 Constraint 532 1347 0.8000 1.0000 2.0000 0.0000 Constraint 532 1339 0.8000 1.0000 2.0000 0.0000 Constraint 532 1318 0.8000 1.0000 2.0000 0.0000 Constraint 532 1306 0.8000 1.0000 2.0000 0.0000 Constraint 532 1295 0.8000 1.0000 2.0000 0.0000 Constraint 532 1288 0.8000 1.0000 2.0000 0.0000 Constraint 532 1281 0.8000 1.0000 2.0000 0.0000 Constraint 532 1272 0.8000 1.0000 2.0000 0.0000 Constraint 532 1264 0.8000 1.0000 2.0000 0.0000 Constraint 532 1256 0.8000 1.0000 2.0000 0.0000 Constraint 532 1244 0.8000 1.0000 2.0000 0.0000 Constraint 532 1235 0.8000 1.0000 2.0000 0.0000 Constraint 532 1225 0.8000 1.0000 2.0000 0.0000 Constraint 532 1213 0.8000 1.0000 2.0000 0.0000 Constraint 532 1208 0.8000 1.0000 2.0000 0.0000 Constraint 532 1201 0.8000 1.0000 2.0000 0.0000 Constraint 532 1192 0.8000 1.0000 2.0000 0.0000 Constraint 532 1186 0.8000 1.0000 2.0000 0.0000 Constraint 532 1174 0.8000 1.0000 2.0000 0.0000 Constraint 532 1168 0.8000 1.0000 2.0000 0.0000 Constraint 532 1159 0.8000 1.0000 2.0000 0.0000 Constraint 532 1150 0.8000 1.0000 2.0000 0.0000 Constraint 532 1095 0.8000 1.0000 2.0000 0.0000 Constraint 532 1087 0.8000 1.0000 2.0000 0.0000 Constraint 532 1075 0.8000 1.0000 2.0000 0.0000 Constraint 532 1066 0.8000 1.0000 2.0000 0.0000 Constraint 532 1051 0.8000 1.0000 2.0000 0.0000 Constraint 532 1039 0.8000 1.0000 2.0000 0.0000 Constraint 532 958 0.8000 1.0000 2.0000 0.0000 Constraint 532 939 0.8000 1.0000 2.0000 0.0000 Constraint 532 931 0.8000 1.0000 2.0000 0.0000 Constraint 532 900 0.8000 1.0000 2.0000 0.0000 Constraint 532 892 0.8000 1.0000 2.0000 0.0000 Constraint 532 756 0.8000 1.0000 2.0000 0.0000 Constraint 532 742 0.8000 1.0000 2.0000 0.0000 Constraint 532 716 0.8000 1.0000 2.0000 0.0000 Constraint 532 641 0.8000 1.0000 2.0000 0.0000 Constraint 532 632 0.8000 1.0000 2.0000 0.0000 Constraint 532 624 0.8000 1.0000 2.0000 0.0000 Constraint 532 618 0.8000 1.0000 2.0000 0.0000 Constraint 532 602 0.8000 1.0000 2.0000 0.0000 Constraint 532 596 0.8000 1.0000 2.0000 0.0000 Constraint 532 585 0.8000 1.0000 2.0000 0.0000 Constraint 532 579 0.8000 1.0000 2.0000 0.0000 Constraint 532 570 0.8000 1.0000 2.0000 0.0000 Constraint 532 562 0.8000 1.0000 2.0000 0.0000 Constraint 532 551 0.8000 1.0000 2.0000 0.0000 Constraint 532 544 0.8000 1.0000 2.0000 0.0000 Constraint 522 1476 0.8000 1.0000 2.0000 0.0000 Constraint 522 1467 0.8000 1.0000 2.0000 0.0000 Constraint 522 1459 0.8000 1.0000 2.0000 0.0000 Constraint 522 1451 0.8000 1.0000 2.0000 0.0000 Constraint 522 1442 0.8000 1.0000 2.0000 0.0000 Constraint 522 1430 0.8000 1.0000 2.0000 0.0000 Constraint 522 1421 0.8000 1.0000 2.0000 0.0000 Constraint 522 1413 0.8000 1.0000 2.0000 0.0000 Constraint 522 1402 0.8000 1.0000 2.0000 0.0000 Constraint 522 1395 0.8000 1.0000 2.0000 0.0000 Constraint 522 1386 0.8000 1.0000 2.0000 0.0000 Constraint 522 1381 0.8000 1.0000 2.0000 0.0000 Constraint 522 1373 0.8000 1.0000 2.0000 0.0000 Constraint 522 1362 0.8000 1.0000 2.0000 0.0000 Constraint 522 1354 0.8000 1.0000 2.0000 0.0000 Constraint 522 1347 0.8000 1.0000 2.0000 0.0000 Constraint 522 1339 0.8000 1.0000 2.0000 0.0000 Constraint 522 1318 0.8000 1.0000 2.0000 0.0000 Constraint 522 1306 0.8000 1.0000 2.0000 0.0000 Constraint 522 1295 0.8000 1.0000 2.0000 0.0000 Constraint 522 1288 0.8000 1.0000 2.0000 0.0000 Constraint 522 1281 0.8000 1.0000 2.0000 0.0000 Constraint 522 1272 0.8000 1.0000 2.0000 0.0000 Constraint 522 1264 0.8000 1.0000 2.0000 0.0000 Constraint 522 1256 0.8000 1.0000 2.0000 0.0000 Constraint 522 1244 0.8000 1.0000 2.0000 0.0000 Constraint 522 1235 0.8000 1.0000 2.0000 0.0000 Constraint 522 1225 0.8000 1.0000 2.0000 0.0000 Constraint 522 1213 0.8000 1.0000 2.0000 0.0000 Constraint 522 1208 0.8000 1.0000 2.0000 0.0000 Constraint 522 1201 0.8000 1.0000 2.0000 0.0000 Constraint 522 1192 0.8000 1.0000 2.0000 0.0000 Constraint 522 1186 0.8000 1.0000 2.0000 0.0000 Constraint 522 1174 0.8000 1.0000 2.0000 0.0000 Constraint 522 1168 0.8000 1.0000 2.0000 0.0000 Constraint 522 1159 0.8000 1.0000 2.0000 0.0000 Constraint 522 1150 0.8000 1.0000 2.0000 0.0000 Constraint 522 1144 0.8000 1.0000 2.0000 0.0000 Constraint 522 1124 0.8000 1.0000 2.0000 0.0000 Constraint 522 1106 0.8000 1.0000 2.0000 0.0000 Constraint 522 1095 0.8000 1.0000 2.0000 0.0000 Constraint 522 1087 0.8000 1.0000 2.0000 0.0000 Constraint 522 1066 0.8000 1.0000 2.0000 0.0000 Constraint 522 1051 0.8000 1.0000 2.0000 0.0000 Constraint 522 1039 0.8000 1.0000 2.0000 0.0000 Constraint 522 1031 0.8000 1.0000 2.0000 0.0000 Constraint 522 1024 0.8000 1.0000 2.0000 0.0000 Constraint 522 1015 0.8000 1.0000 2.0000 0.0000 Constraint 522 1007 0.8000 1.0000 2.0000 0.0000 Constraint 522 998 0.8000 1.0000 2.0000 0.0000 Constraint 522 990 0.8000 1.0000 2.0000 0.0000 Constraint 522 981 0.8000 1.0000 2.0000 0.0000 Constraint 522 973 0.8000 1.0000 2.0000 0.0000 Constraint 522 958 0.8000 1.0000 2.0000 0.0000 Constraint 522 951 0.8000 1.0000 2.0000 0.0000 Constraint 522 931 0.8000 1.0000 2.0000 0.0000 Constraint 522 871 0.8000 1.0000 2.0000 0.0000 Constraint 522 864 0.8000 1.0000 2.0000 0.0000 Constraint 522 833 0.8000 1.0000 2.0000 0.0000 Constraint 522 822 0.8000 1.0000 2.0000 0.0000 Constraint 522 805 0.8000 1.0000 2.0000 0.0000 Constraint 522 794 0.8000 1.0000 2.0000 0.0000 Constraint 522 632 0.8000 1.0000 2.0000 0.0000 Constraint 522 624 0.8000 1.0000 2.0000 0.0000 Constraint 522 610 0.8000 1.0000 2.0000 0.0000 Constraint 522 596 0.8000 1.0000 2.0000 0.0000 Constraint 522 585 0.8000 1.0000 2.0000 0.0000 Constraint 522 579 0.8000 1.0000 2.0000 0.0000 Constraint 522 570 0.8000 1.0000 2.0000 0.0000 Constraint 522 562 0.8000 1.0000 2.0000 0.0000 Constraint 522 551 0.8000 1.0000 2.0000 0.0000 Constraint 522 544 0.8000 1.0000 2.0000 0.0000 Constraint 522 532 0.8000 1.0000 2.0000 0.0000 Constraint 515 1476 0.8000 1.0000 2.0000 0.0000 Constraint 515 1467 0.8000 1.0000 2.0000 0.0000 Constraint 515 1459 0.8000 1.0000 2.0000 0.0000 Constraint 515 1451 0.8000 1.0000 2.0000 0.0000 Constraint 515 1442 0.8000 1.0000 2.0000 0.0000 Constraint 515 1430 0.8000 1.0000 2.0000 0.0000 Constraint 515 1421 0.8000 1.0000 2.0000 0.0000 Constraint 515 1413 0.8000 1.0000 2.0000 0.0000 Constraint 515 1402 0.8000 1.0000 2.0000 0.0000 Constraint 515 1395 0.8000 1.0000 2.0000 0.0000 Constraint 515 1386 0.8000 1.0000 2.0000 0.0000 Constraint 515 1381 0.8000 1.0000 2.0000 0.0000 Constraint 515 1373 0.8000 1.0000 2.0000 0.0000 Constraint 515 1362 0.8000 1.0000 2.0000 0.0000 Constraint 515 1354 0.8000 1.0000 2.0000 0.0000 Constraint 515 1347 0.8000 1.0000 2.0000 0.0000 Constraint 515 1339 0.8000 1.0000 2.0000 0.0000 Constraint 515 1329 0.8000 1.0000 2.0000 0.0000 Constraint 515 1318 0.8000 1.0000 2.0000 0.0000 Constraint 515 1306 0.8000 1.0000 2.0000 0.0000 Constraint 515 1295 0.8000 1.0000 2.0000 0.0000 Constraint 515 1288 0.8000 1.0000 2.0000 0.0000 Constraint 515 1281 0.8000 1.0000 2.0000 0.0000 Constraint 515 1272 0.8000 1.0000 2.0000 0.0000 Constraint 515 1256 0.8000 1.0000 2.0000 0.0000 Constraint 515 1244 0.8000 1.0000 2.0000 0.0000 Constraint 515 1235 0.8000 1.0000 2.0000 0.0000 Constraint 515 1225 0.8000 1.0000 2.0000 0.0000 Constraint 515 1213 0.8000 1.0000 2.0000 0.0000 Constraint 515 1208 0.8000 1.0000 2.0000 0.0000 Constraint 515 1201 0.8000 1.0000 2.0000 0.0000 Constraint 515 1192 0.8000 1.0000 2.0000 0.0000 Constraint 515 1186 0.8000 1.0000 2.0000 0.0000 Constraint 515 1174 0.8000 1.0000 2.0000 0.0000 Constraint 515 1168 0.8000 1.0000 2.0000 0.0000 Constraint 515 1159 0.8000 1.0000 2.0000 0.0000 Constraint 515 1150 0.8000 1.0000 2.0000 0.0000 Constraint 515 1144 0.8000 1.0000 2.0000 0.0000 Constraint 515 1133 0.8000 1.0000 2.0000 0.0000 Constraint 515 1124 0.8000 1.0000 2.0000 0.0000 Constraint 515 1106 0.8000 1.0000 2.0000 0.0000 Constraint 515 1095 0.8000 1.0000 2.0000 0.0000 Constraint 515 1087 0.8000 1.0000 2.0000 0.0000 Constraint 515 1066 0.8000 1.0000 2.0000 0.0000 Constraint 515 1051 0.8000 1.0000 2.0000 0.0000 Constraint 515 1039 0.8000 1.0000 2.0000 0.0000 Constraint 515 1031 0.8000 1.0000 2.0000 0.0000 Constraint 515 1024 0.8000 1.0000 2.0000 0.0000 Constraint 515 1015 0.8000 1.0000 2.0000 0.0000 Constraint 515 1007 0.8000 1.0000 2.0000 0.0000 Constraint 515 998 0.8000 1.0000 2.0000 0.0000 Constraint 515 990 0.8000 1.0000 2.0000 0.0000 Constraint 515 981 0.8000 1.0000 2.0000 0.0000 Constraint 515 973 0.8000 1.0000 2.0000 0.0000 Constraint 515 967 0.8000 1.0000 2.0000 0.0000 Constraint 515 958 0.8000 1.0000 2.0000 0.0000 Constraint 515 951 0.8000 1.0000 2.0000 0.0000 Constraint 515 939 0.8000 1.0000 2.0000 0.0000 Constraint 515 931 0.8000 1.0000 2.0000 0.0000 Constraint 515 915 0.8000 1.0000 2.0000 0.0000 Constraint 515 907 0.8000 1.0000 2.0000 0.0000 Constraint 515 892 0.8000 1.0000 2.0000 0.0000 Constraint 515 884 0.8000 1.0000 2.0000 0.0000 Constraint 515 871 0.8000 1.0000 2.0000 0.0000 Constraint 515 864 0.8000 1.0000 2.0000 0.0000 Constraint 515 822 0.8000 1.0000 2.0000 0.0000 Constraint 515 794 0.8000 1.0000 2.0000 0.0000 Constraint 515 781 0.8000 1.0000 2.0000 0.0000 Constraint 515 762 0.8000 1.0000 2.0000 0.0000 Constraint 515 728 0.8000 1.0000 2.0000 0.0000 Constraint 515 723 0.8000 1.0000 2.0000 0.0000 Constraint 515 674 0.8000 1.0000 2.0000 0.0000 Constraint 515 649 0.8000 1.0000 2.0000 0.0000 Constraint 515 641 0.8000 1.0000 2.0000 0.0000 Constraint 515 610 0.8000 1.0000 2.0000 0.0000 Constraint 515 602 0.8000 1.0000 2.0000 0.0000 Constraint 515 585 0.8000 1.0000 2.0000 0.0000 Constraint 515 579 0.8000 1.0000 2.0000 0.0000 Constraint 515 570 0.8000 1.0000 2.0000 0.0000 Constraint 515 562 0.8000 1.0000 2.0000 0.0000 Constraint 515 551 0.8000 1.0000 2.0000 0.0000 Constraint 515 544 0.8000 1.0000 2.0000 0.0000 Constraint 515 532 0.8000 1.0000 2.0000 0.0000 Constraint 515 522 0.8000 1.0000 2.0000 0.0000 Constraint 510 1476 0.8000 1.0000 2.0000 0.0000 Constraint 510 1467 0.8000 1.0000 2.0000 0.0000 Constraint 510 1459 0.8000 1.0000 2.0000 0.0000 Constraint 510 1451 0.8000 1.0000 2.0000 0.0000 Constraint 510 1442 0.8000 1.0000 2.0000 0.0000 Constraint 510 1430 0.8000 1.0000 2.0000 0.0000 Constraint 510 1421 0.8000 1.0000 2.0000 0.0000 Constraint 510 1413 0.8000 1.0000 2.0000 0.0000 Constraint 510 1402 0.8000 1.0000 2.0000 0.0000 Constraint 510 1395 0.8000 1.0000 2.0000 0.0000 Constraint 510 1386 0.8000 1.0000 2.0000 0.0000 Constraint 510 1381 0.8000 1.0000 2.0000 0.0000 Constraint 510 1373 0.8000 1.0000 2.0000 0.0000 Constraint 510 1362 0.8000 1.0000 2.0000 0.0000 Constraint 510 1354 0.8000 1.0000 2.0000 0.0000 Constraint 510 1347 0.8000 1.0000 2.0000 0.0000 Constraint 510 1339 0.8000 1.0000 2.0000 0.0000 Constraint 510 1329 0.8000 1.0000 2.0000 0.0000 Constraint 510 1318 0.8000 1.0000 2.0000 0.0000 Constraint 510 1306 0.8000 1.0000 2.0000 0.0000 Constraint 510 1295 0.8000 1.0000 2.0000 0.0000 Constraint 510 1288 0.8000 1.0000 2.0000 0.0000 Constraint 510 1281 0.8000 1.0000 2.0000 0.0000 Constraint 510 1272 0.8000 1.0000 2.0000 0.0000 Constraint 510 1264 0.8000 1.0000 2.0000 0.0000 Constraint 510 1256 0.8000 1.0000 2.0000 0.0000 Constraint 510 1244 0.8000 1.0000 2.0000 0.0000 Constraint 510 1235 0.8000 1.0000 2.0000 0.0000 Constraint 510 1225 0.8000 1.0000 2.0000 0.0000 Constraint 510 1213 0.8000 1.0000 2.0000 0.0000 Constraint 510 1208 0.8000 1.0000 2.0000 0.0000 Constraint 510 1201 0.8000 1.0000 2.0000 0.0000 Constraint 510 1192 0.8000 1.0000 2.0000 0.0000 Constraint 510 1186 0.8000 1.0000 2.0000 0.0000 Constraint 510 1174 0.8000 1.0000 2.0000 0.0000 Constraint 510 1168 0.8000 1.0000 2.0000 0.0000 Constraint 510 1159 0.8000 1.0000 2.0000 0.0000 Constraint 510 1150 0.8000 1.0000 2.0000 0.0000 Constraint 510 1133 0.8000 1.0000 2.0000 0.0000 Constraint 510 1106 0.8000 1.0000 2.0000 0.0000 Constraint 510 1095 0.8000 1.0000 2.0000 0.0000 Constraint 510 1087 0.8000 1.0000 2.0000 0.0000 Constraint 510 1075 0.8000 1.0000 2.0000 0.0000 Constraint 510 1066 0.8000 1.0000 2.0000 0.0000 Constraint 510 1051 0.8000 1.0000 2.0000 0.0000 Constraint 510 1039 0.8000 1.0000 2.0000 0.0000 Constraint 510 1031 0.8000 1.0000 2.0000 0.0000 Constraint 510 1024 0.8000 1.0000 2.0000 0.0000 Constraint 510 973 0.8000 1.0000 2.0000 0.0000 Constraint 510 967 0.8000 1.0000 2.0000 0.0000 Constraint 510 958 0.8000 1.0000 2.0000 0.0000 Constraint 510 939 0.8000 1.0000 2.0000 0.0000 Constraint 510 907 0.8000 1.0000 2.0000 0.0000 Constraint 510 892 0.8000 1.0000 2.0000 0.0000 Constraint 510 884 0.8000 1.0000 2.0000 0.0000 Constraint 510 871 0.8000 1.0000 2.0000 0.0000 Constraint 510 864 0.8000 1.0000 2.0000 0.0000 Constraint 510 833 0.8000 1.0000 2.0000 0.0000 Constraint 510 674 0.8000 1.0000 2.0000 0.0000 Constraint 510 660 0.8000 1.0000 2.0000 0.0000 Constraint 510 610 0.8000 1.0000 2.0000 0.0000 Constraint 510 602 0.8000 1.0000 2.0000 0.0000 Constraint 510 596 0.8000 1.0000 2.0000 0.0000 Constraint 510 579 0.8000 1.0000 2.0000 0.0000 Constraint 510 570 0.8000 1.0000 2.0000 0.0000 Constraint 510 562 0.8000 1.0000 2.0000 0.0000 Constraint 510 551 0.8000 1.0000 2.0000 0.0000 Constraint 510 544 0.8000 1.0000 2.0000 0.0000 Constraint 510 532 0.8000 1.0000 2.0000 0.0000 Constraint 510 522 0.8000 1.0000 2.0000 0.0000 Constraint 510 515 0.8000 1.0000 2.0000 0.0000 Constraint 499 1476 0.8000 1.0000 2.0000 0.0000 Constraint 499 1467 0.8000 1.0000 2.0000 0.0000 Constraint 499 1459 0.8000 1.0000 2.0000 0.0000 Constraint 499 1451 0.8000 1.0000 2.0000 0.0000 Constraint 499 1442 0.8000 1.0000 2.0000 0.0000 Constraint 499 1430 0.8000 1.0000 2.0000 0.0000 Constraint 499 1421 0.8000 1.0000 2.0000 0.0000 Constraint 499 1413 0.8000 1.0000 2.0000 0.0000 Constraint 499 1402 0.8000 1.0000 2.0000 0.0000 Constraint 499 1395 0.8000 1.0000 2.0000 0.0000 Constraint 499 1386 0.8000 1.0000 2.0000 0.0000 Constraint 499 1362 0.8000 1.0000 2.0000 0.0000 Constraint 499 1354 0.8000 1.0000 2.0000 0.0000 Constraint 499 1347 0.8000 1.0000 2.0000 0.0000 Constraint 499 1339 0.8000 1.0000 2.0000 0.0000 Constraint 499 1329 0.8000 1.0000 2.0000 0.0000 Constraint 499 1318 0.8000 1.0000 2.0000 0.0000 Constraint 499 1306 0.8000 1.0000 2.0000 0.0000 Constraint 499 1295 0.8000 1.0000 2.0000 0.0000 Constraint 499 1288 0.8000 1.0000 2.0000 0.0000 Constraint 499 1281 0.8000 1.0000 2.0000 0.0000 Constraint 499 1272 0.8000 1.0000 2.0000 0.0000 Constraint 499 1264 0.8000 1.0000 2.0000 0.0000 Constraint 499 1244 0.8000 1.0000 2.0000 0.0000 Constraint 499 1235 0.8000 1.0000 2.0000 0.0000 Constraint 499 1225 0.8000 1.0000 2.0000 0.0000 Constraint 499 1213 0.8000 1.0000 2.0000 0.0000 Constraint 499 1208 0.8000 1.0000 2.0000 0.0000 Constraint 499 1201 0.8000 1.0000 2.0000 0.0000 Constraint 499 1192 0.8000 1.0000 2.0000 0.0000 Constraint 499 1186 0.8000 1.0000 2.0000 0.0000 Constraint 499 1174 0.8000 1.0000 2.0000 0.0000 Constraint 499 1168 0.8000 1.0000 2.0000 0.0000 Constraint 499 1159 0.8000 1.0000 2.0000 0.0000 Constraint 499 1150 0.8000 1.0000 2.0000 0.0000 Constraint 499 1144 0.8000 1.0000 2.0000 0.0000 Constraint 499 1133 0.8000 1.0000 2.0000 0.0000 Constraint 499 1066 0.8000 1.0000 2.0000 0.0000 Constraint 499 981 0.8000 1.0000 2.0000 0.0000 Constraint 499 973 0.8000 1.0000 2.0000 0.0000 Constraint 499 958 0.8000 1.0000 2.0000 0.0000 Constraint 499 907 0.8000 1.0000 2.0000 0.0000 Constraint 499 892 0.8000 1.0000 2.0000 0.0000 Constraint 499 773 0.8000 1.0000 2.0000 0.0000 Constraint 499 728 0.8000 1.0000 2.0000 0.0000 Constraint 499 669 0.8000 1.0000 2.0000 0.0000 Constraint 499 660 0.8000 1.0000 2.0000 0.0000 Constraint 499 570 0.8000 1.0000 2.0000 0.0000 Constraint 499 562 0.8000 1.0000 2.0000 0.0000 Constraint 499 551 0.8000 1.0000 2.0000 0.0000 Constraint 499 544 0.8000 1.0000 2.0000 0.0000 Constraint 499 532 0.8000 1.0000 2.0000 0.0000 Constraint 499 522 0.8000 1.0000 2.0000 0.0000 Constraint 499 515 0.8000 1.0000 2.0000 0.0000 Constraint 499 510 0.8000 1.0000 2.0000 0.0000 Constraint 488 1476 0.8000 1.0000 2.0000 0.0000 Constraint 488 1467 0.8000 1.0000 2.0000 0.0000 Constraint 488 1459 0.8000 1.0000 2.0000 0.0000 Constraint 488 1451 0.8000 1.0000 2.0000 0.0000 Constraint 488 1442 0.8000 1.0000 2.0000 0.0000 Constraint 488 1430 0.8000 1.0000 2.0000 0.0000 Constraint 488 1413 0.8000 1.0000 2.0000 0.0000 Constraint 488 1402 0.8000 1.0000 2.0000 0.0000 Constraint 488 1395 0.8000 1.0000 2.0000 0.0000 Constraint 488 1381 0.8000 1.0000 2.0000 0.0000 Constraint 488 1362 0.8000 1.0000 2.0000 0.0000 Constraint 488 1354 0.8000 1.0000 2.0000 0.0000 Constraint 488 1347 0.8000 1.0000 2.0000 0.0000 Constraint 488 1329 0.8000 1.0000 2.0000 0.0000 Constraint 488 1306 0.8000 1.0000 2.0000 0.0000 Constraint 488 1295 0.8000 1.0000 2.0000 0.0000 Constraint 488 1288 0.8000 1.0000 2.0000 0.0000 Constraint 488 1281 0.8000 1.0000 2.0000 0.0000 Constraint 488 1272 0.8000 1.0000 2.0000 0.0000 Constraint 488 1244 0.8000 1.0000 2.0000 0.0000 Constraint 488 1235 0.8000 1.0000 2.0000 0.0000 Constraint 488 1213 0.8000 1.0000 2.0000 0.0000 Constraint 488 1208 0.8000 1.0000 2.0000 0.0000 Constraint 488 1201 0.8000 1.0000 2.0000 0.0000 Constraint 488 1192 0.8000 1.0000 2.0000 0.0000 Constraint 488 1186 0.8000 1.0000 2.0000 0.0000 Constraint 488 1174 0.8000 1.0000 2.0000 0.0000 Constraint 488 1168 0.8000 1.0000 2.0000 0.0000 Constraint 488 1159 0.8000 1.0000 2.0000 0.0000 Constraint 488 1150 0.8000 1.0000 2.0000 0.0000 Constraint 488 1144 0.8000 1.0000 2.0000 0.0000 Constraint 488 1133 0.8000 1.0000 2.0000 0.0000 Constraint 488 1095 0.8000 1.0000 2.0000 0.0000 Constraint 488 1087 0.8000 1.0000 2.0000 0.0000 Constraint 488 1039 0.8000 1.0000 2.0000 0.0000 Constraint 488 1024 0.8000 1.0000 2.0000 0.0000 Constraint 488 1015 0.8000 1.0000 2.0000 0.0000 Constraint 488 1007 0.8000 1.0000 2.0000 0.0000 Constraint 488 981 0.8000 1.0000 2.0000 0.0000 Constraint 488 958 0.8000 1.0000 2.0000 0.0000 Constraint 488 931 0.8000 1.0000 2.0000 0.0000 Constraint 488 924 0.8000 1.0000 2.0000 0.0000 Constraint 488 907 0.8000 1.0000 2.0000 0.0000 Constraint 488 900 0.8000 1.0000 2.0000 0.0000 Constraint 488 892 0.8000 1.0000 2.0000 0.0000 Constraint 488 884 0.8000 1.0000 2.0000 0.0000 Constraint 488 871 0.8000 1.0000 2.0000 0.0000 Constraint 488 805 0.8000 1.0000 2.0000 0.0000 Constraint 488 794 0.8000 1.0000 2.0000 0.0000 Constraint 488 728 0.8000 1.0000 2.0000 0.0000 Constraint 488 723 0.8000 1.0000 2.0000 0.0000 Constraint 488 649 0.8000 1.0000 2.0000 0.0000 Constraint 488 618 0.8000 1.0000 2.0000 0.0000 Constraint 488 610 0.8000 1.0000 2.0000 0.0000 Constraint 488 562 0.8000 1.0000 2.0000 0.0000 Constraint 488 551 0.8000 1.0000 2.0000 0.0000 Constraint 488 544 0.8000 1.0000 2.0000 0.0000 Constraint 488 532 0.8000 1.0000 2.0000 0.0000 Constraint 488 522 0.8000 1.0000 2.0000 0.0000 Constraint 488 515 0.8000 1.0000 2.0000 0.0000 Constraint 488 510 0.8000 1.0000 2.0000 0.0000 Constraint 488 499 0.8000 1.0000 2.0000 0.0000 Constraint 481 1476 0.8000 1.0000 2.0000 0.0000 Constraint 481 1467 0.8000 1.0000 2.0000 0.0000 Constraint 481 1459 0.8000 1.0000 2.0000 0.0000 Constraint 481 1451 0.8000 1.0000 2.0000 0.0000 Constraint 481 1442 0.8000 1.0000 2.0000 0.0000 Constraint 481 1430 0.8000 1.0000 2.0000 0.0000 Constraint 481 1413 0.8000 1.0000 2.0000 0.0000 Constraint 481 1402 0.8000 1.0000 2.0000 0.0000 Constraint 481 1395 0.8000 1.0000 2.0000 0.0000 Constraint 481 1386 0.8000 1.0000 2.0000 0.0000 Constraint 481 1381 0.8000 1.0000 2.0000 0.0000 Constraint 481 1362 0.8000 1.0000 2.0000 0.0000 Constraint 481 1354 0.8000 1.0000 2.0000 0.0000 Constraint 481 1347 0.8000 1.0000 2.0000 0.0000 Constraint 481 1339 0.8000 1.0000 2.0000 0.0000 Constraint 481 1329 0.8000 1.0000 2.0000 0.0000 Constraint 481 1318 0.8000 1.0000 2.0000 0.0000 Constraint 481 1306 0.8000 1.0000 2.0000 0.0000 Constraint 481 1295 0.8000 1.0000 2.0000 0.0000 Constraint 481 1288 0.8000 1.0000 2.0000 0.0000 Constraint 481 1281 0.8000 1.0000 2.0000 0.0000 Constraint 481 1272 0.8000 1.0000 2.0000 0.0000 Constraint 481 1264 0.8000 1.0000 2.0000 0.0000 Constraint 481 1256 0.8000 1.0000 2.0000 0.0000 Constraint 481 1244 0.8000 1.0000 2.0000 0.0000 Constraint 481 1235 0.8000 1.0000 2.0000 0.0000 Constraint 481 1213 0.8000 1.0000 2.0000 0.0000 Constraint 481 1208 0.8000 1.0000 2.0000 0.0000 Constraint 481 1201 0.8000 1.0000 2.0000 0.0000 Constraint 481 1192 0.8000 1.0000 2.0000 0.0000 Constraint 481 1186 0.8000 1.0000 2.0000 0.0000 Constraint 481 1174 0.8000 1.0000 2.0000 0.0000 Constraint 481 1168 0.8000 1.0000 2.0000 0.0000 Constraint 481 1159 0.8000 1.0000 2.0000 0.0000 Constraint 481 1150 0.8000 1.0000 2.0000 0.0000 Constraint 481 1144 0.8000 1.0000 2.0000 0.0000 Constraint 481 1133 0.8000 1.0000 2.0000 0.0000 Constraint 481 1106 0.8000 1.0000 2.0000 0.0000 Constraint 481 1095 0.8000 1.0000 2.0000 0.0000 Constraint 481 1087 0.8000 1.0000 2.0000 0.0000 Constraint 481 1066 0.8000 1.0000 2.0000 0.0000 Constraint 481 1051 0.8000 1.0000 2.0000 0.0000 Constraint 481 1039 0.8000 1.0000 2.0000 0.0000 Constraint 481 1031 0.8000 1.0000 2.0000 0.0000 Constraint 481 1024 0.8000 1.0000 2.0000 0.0000 Constraint 481 1015 0.8000 1.0000 2.0000 0.0000 Constraint 481 1007 0.8000 1.0000 2.0000 0.0000 Constraint 481 981 0.8000 1.0000 2.0000 0.0000 Constraint 481 973 0.8000 1.0000 2.0000 0.0000 Constraint 481 958 0.8000 1.0000 2.0000 0.0000 Constraint 481 951 0.8000 1.0000 2.0000 0.0000 Constraint 481 944 0.8000 1.0000 2.0000 0.0000 Constraint 481 939 0.8000 1.0000 2.0000 0.0000 Constraint 481 931 0.8000 1.0000 2.0000 0.0000 Constraint 481 924 0.8000 1.0000 2.0000 0.0000 Constraint 481 915 0.8000 1.0000 2.0000 0.0000 Constraint 481 907 0.8000 1.0000 2.0000 0.0000 Constraint 481 900 0.8000 1.0000 2.0000 0.0000 Constraint 481 892 0.8000 1.0000 2.0000 0.0000 Constraint 481 884 0.8000 1.0000 2.0000 0.0000 Constraint 481 871 0.8000 1.0000 2.0000 0.0000 Constraint 481 864 0.8000 1.0000 2.0000 0.0000 Constraint 481 852 0.8000 1.0000 2.0000 0.0000 Constraint 481 841 0.8000 1.0000 2.0000 0.0000 Constraint 481 833 0.8000 1.0000 2.0000 0.0000 Constraint 481 814 0.8000 1.0000 2.0000 0.0000 Constraint 481 805 0.8000 1.0000 2.0000 0.0000 Constraint 481 794 0.8000 1.0000 2.0000 0.0000 Constraint 481 789 0.8000 1.0000 2.0000 0.0000 Constraint 481 723 0.8000 1.0000 2.0000 0.0000 Constraint 481 691 0.8000 1.0000 2.0000 0.0000 Constraint 481 669 0.8000 1.0000 2.0000 0.0000 Constraint 481 649 0.8000 1.0000 2.0000 0.0000 Constraint 481 641 0.8000 1.0000 2.0000 0.0000 Constraint 481 624 0.8000 1.0000 2.0000 0.0000 Constraint 481 618 0.8000 1.0000 2.0000 0.0000 Constraint 481 610 0.8000 1.0000 2.0000 0.0000 Constraint 481 602 0.8000 1.0000 2.0000 0.0000 Constraint 481 596 0.8000 1.0000 2.0000 0.0000 Constraint 481 585 0.8000 1.0000 2.0000 0.0000 Constraint 481 570 0.8000 1.0000 2.0000 0.0000 Constraint 481 551 0.8000 1.0000 2.0000 0.0000 Constraint 481 544 0.8000 1.0000 2.0000 0.0000 Constraint 481 532 0.8000 1.0000 2.0000 0.0000 Constraint 481 522 0.8000 1.0000 2.0000 0.0000 Constraint 481 515 0.8000 1.0000 2.0000 0.0000 Constraint 481 510 0.8000 1.0000 2.0000 0.0000 Constraint 481 499 0.8000 1.0000 2.0000 0.0000 Constraint 481 488 0.8000 1.0000 2.0000 0.0000 Constraint 472 1476 0.8000 1.0000 2.0000 0.0000 Constraint 472 1467 0.8000 1.0000 2.0000 0.0000 Constraint 472 1451 0.8000 1.0000 2.0000 0.0000 Constraint 472 1442 0.8000 1.0000 2.0000 0.0000 Constraint 472 1430 0.8000 1.0000 2.0000 0.0000 Constraint 472 1421 0.8000 1.0000 2.0000 0.0000 Constraint 472 1413 0.8000 1.0000 2.0000 0.0000 Constraint 472 1402 0.8000 1.0000 2.0000 0.0000 Constraint 472 1362 0.8000 1.0000 2.0000 0.0000 Constraint 472 1354 0.8000 1.0000 2.0000 0.0000 Constraint 472 1347 0.8000 1.0000 2.0000 0.0000 Constraint 472 1339 0.8000 1.0000 2.0000 0.0000 Constraint 472 1329 0.8000 1.0000 2.0000 0.0000 Constraint 472 1318 0.8000 1.0000 2.0000 0.0000 Constraint 472 1295 0.8000 1.0000 2.0000 0.0000 Constraint 472 1288 0.8000 1.0000 2.0000 0.0000 Constraint 472 1281 0.8000 1.0000 2.0000 0.0000 Constraint 472 1264 0.8000 1.0000 2.0000 0.0000 Constraint 472 1256 0.8000 1.0000 2.0000 0.0000 Constraint 472 1244 0.8000 1.0000 2.0000 0.0000 Constraint 472 1235 0.8000 1.0000 2.0000 0.0000 Constraint 472 1225 0.8000 1.0000 2.0000 0.0000 Constraint 472 1213 0.8000 1.0000 2.0000 0.0000 Constraint 472 1208 0.8000 1.0000 2.0000 0.0000 Constraint 472 1201 0.8000 1.0000 2.0000 0.0000 Constraint 472 1192 0.8000 1.0000 2.0000 0.0000 Constraint 472 1186 0.8000 1.0000 2.0000 0.0000 Constraint 472 1174 0.8000 1.0000 2.0000 0.0000 Constraint 472 1168 0.8000 1.0000 2.0000 0.0000 Constraint 472 1159 0.8000 1.0000 2.0000 0.0000 Constraint 472 1150 0.8000 1.0000 2.0000 0.0000 Constraint 472 1144 0.8000 1.0000 2.0000 0.0000 Constraint 472 1133 0.8000 1.0000 2.0000 0.0000 Constraint 472 1106 0.8000 1.0000 2.0000 0.0000 Constraint 472 1095 0.8000 1.0000 2.0000 0.0000 Constraint 472 1087 0.8000 1.0000 2.0000 0.0000 Constraint 472 1075 0.8000 1.0000 2.0000 0.0000 Constraint 472 1066 0.8000 1.0000 2.0000 0.0000 Constraint 472 1051 0.8000 1.0000 2.0000 0.0000 Constraint 472 1039 0.8000 1.0000 2.0000 0.0000 Constraint 472 1031 0.8000 1.0000 2.0000 0.0000 Constraint 472 1024 0.8000 1.0000 2.0000 0.0000 Constraint 472 981 0.8000 1.0000 2.0000 0.0000 Constraint 472 967 0.8000 1.0000 2.0000 0.0000 Constraint 472 958 0.8000 1.0000 2.0000 0.0000 Constraint 472 944 0.8000 1.0000 2.0000 0.0000 Constraint 472 939 0.8000 1.0000 2.0000 0.0000 Constraint 472 924 0.8000 1.0000 2.0000 0.0000 Constraint 472 907 0.8000 1.0000 2.0000 0.0000 Constraint 472 900 0.8000 1.0000 2.0000 0.0000 Constraint 472 892 0.8000 1.0000 2.0000 0.0000 Constraint 472 884 0.8000 1.0000 2.0000 0.0000 Constraint 472 871 0.8000 1.0000 2.0000 0.0000 Constraint 472 864 0.8000 1.0000 2.0000 0.0000 Constraint 472 852 0.8000 1.0000 2.0000 0.0000 Constraint 472 691 0.8000 1.0000 2.0000 0.0000 Constraint 472 641 0.8000 1.0000 2.0000 0.0000 Constraint 472 544 0.8000 1.0000 2.0000 0.0000 Constraint 472 532 0.8000 1.0000 2.0000 0.0000 Constraint 472 522 0.8000 1.0000 2.0000 0.0000 Constraint 472 515 0.8000 1.0000 2.0000 0.0000 Constraint 472 510 0.8000 1.0000 2.0000 0.0000 Constraint 472 499 0.8000 1.0000 2.0000 0.0000 Constraint 472 488 0.8000 1.0000 2.0000 0.0000 Constraint 472 481 0.8000 1.0000 2.0000 0.0000 Constraint 464 1476 0.8000 1.0000 2.0000 0.0000 Constraint 464 1467 0.8000 1.0000 2.0000 0.0000 Constraint 464 1451 0.8000 1.0000 2.0000 0.0000 Constraint 464 1442 0.8000 1.0000 2.0000 0.0000 Constraint 464 1421 0.8000 1.0000 2.0000 0.0000 Constraint 464 1413 0.8000 1.0000 2.0000 0.0000 Constraint 464 1386 0.8000 1.0000 2.0000 0.0000 Constraint 464 1373 0.8000 1.0000 2.0000 0.0000 Constraint 464 1362 0.8000 1.0000 2.0000 0.0000 Constraint 464 1354 0.8000 1.0000 2.0000 0.0000 Constraint 464 1329 0.8000 1.0000 2.0000 0.0000 Constraint 464 1318 0.8000 1.0000 2.0000 0.0000 Constraint 464 1306 0.8000 1.0000 2.0000 0.0000 Constraint 464 1295 0.8000 1.0000 2.0000 0.0000 Constraint 464 1288 0.8000 1.0000 2.0000 0.0000 Constraint 464 1281 0.8000 1.0000 2.0000 0.0000 Constraint 464 1272 0.8000 1.0000 2.0000 0.0000 Constraint 464 1264 0.8000 1.0000 2.0000 0.0000 Constraint 464 1244 0.8000 1.0000 2.0000 0.0000 Constraint 464 1235 0.8000 1.0000 2.0000 0.0000 Constraint 464 1225 0.8000 1.0000 2.0000 0.0000 Constraint 464 1213 0.8000 1.0000 2.0000 0.0000 Constraint 464 1208 0.8000 1.0000 2.0000 0.0000 Constraint 464 1201 0.8000 1.0000 2.0000 0.0000 Constraint 464 1192 0.8000 1.0000 2.0000 0.0000 Constraint 464 1186 0.8000 1.0000 2.0000 0.0000 Constraint 464 1174 0.8000 1.0000 2.0000 0.0000 Constraint 464 1168 0.8000 1.0000 2.0000 0.0000 Constraint 464 1159 0.8000 1.0000 2.0000 0.0000 Constraint 464 1150 0.8000 1.0000 2.0000 0.0000 Constraint 464 1144 0.8000 1.0000 2.0000 0.0000 Constraint 464 1133 0.8000 1.0000 2.0000 0.0000 Constraint 464 1124 0.8000 1.0000 2.0000 0.0000 Constraint 464 1066 0.8000 1.0000 2.0000 0.0000 Constraint 464 1015 0.8000 1.0000 2.0000 0.0000 Constraint 464 998 0.8000 1.0000 2.0000 0.0000 Constraint 464 990 0.8000 1.0000 2.0000 0.0000 Constraint 464 967 0.8000 1.0000 2.0000 0.0000 Constraint 464 907 0.8000 1.0000 2.0000 0.0000 Constraint 464 884 0.8000 1.0000 2.0000 0.0000 Constraint 464 871 0.8000 1.0000 2.0000 0.0000 Constraint 464 773 0.8000 1.0000 2.0000 0.0000 Constraint 464 691 0.8000 1.0000 2.0000 0.0000 Constraint 464 641 0.8000 1.0000 2.0000 0.0000 Constraint 464 632 0.8000 1.0000 2.0000 0.0000 Constraint 464 624 0.8000 1.0000 2.0000 0.0000 Constraint 464 532 0.8000 1.0000 2.0000 0.0000 Constraint 464 522 0.8000 1.0000 2.0000 0.0000 Constraint 464 515 0.8000 1.0000 2.0000 0.0000 Constraint 464 510 0.8000 1.0000 2.0000 0.0000 Constraint 464 499 0.8000 1.0000 2.0000 0.0000 Constraint 464 488 0.8000 1.0000 2.0000 0.0000 Constraint 464 481 0.8000 1.0000 2.0000 0.0000 Constraint 464 472 0.8000 1.0000 2.0000 0.0000 Constraint 455 1476 0.8000 1.0000 2.0000 0.0000 Constraint 455 1467 0.8000 1.0000 2.0000 0.0000 Constraint 455 1451 0.8000 1.0000 2.0000 0.0000 Constraint 455 1430 0.8000 1.0000 2.0000 0.0000 Constraint 455 1413 0.8000 1.0000 2.0000 0.0000 Constraint 455 1402 0.8000 1.0000 2.0000 0.0000 Constraint 455 1381 0.8000 1.0000 2.0000 0.0000 Constraint 455 1373 0.8000 1.0000 2.0000 0.0000 Constraint 455 1362 0.8000 1.0000 2.0000 0.0000 Constraint 455 1354 0.8000 1.0000 2.0000 0.0000 Constraint 455 1329 0.8000 1.0000 2.0000 0.0000 Constraint 455 1318 0.8000 1.0000 2.0000 0.0000 Constraint 455 1306 0.8000 1.0000 2.0000 0.0000 Constraint 455 1295 0.8000 1.0000 2.0000 0.0000 Constraint 455 1288 0.8000 1.0000 2.0000 0.0000 Constraint 455 1281 0.8000 1.0000 2.0000 0.0000 Constraint 455 1272 0.8000 1.0000 2.0000 0.0000 Constraint 455 1264 0.8000 1.0000 2.0000 0.0000 Constraint 455 1244 0.8000 1.0000 2.0000 0.0000 Constraint 455 1235 0.8000 1.0000 2.0000 0.0000 Constraint 455 1208 0.8000 1.0000 2.0000 0.0000 Constraint 455 1201 0.8000 1.0000 2.0000 0.0000 Constraint 455 1186 0.8000 1.0000 2.0000 0.0000 Constraint 455 1174 0.8000 1.0000 2.0000 0.0000 Constraint 455 1168 0.8000 1.0000 2.0000 0.0000 Constraint 455 1159 0.8000 1.0000 2.0000 0.0000 Constraint 455 1150 0.8000 1.0000 2.0000 0.0000 Constraint 455 1144 0.8000 1.0000 2.0000 0.0000 Constraint 455 1133 0.8000 1.0000 2.0000 0.0000 Constraint 455 1124 0.8000 1.0000 2.0000 0.0000 Constraint 455 1106 0.8000 1.0000 2.0000 0.0000 Constraint 455 1095 0.8000 1.0000 2.0000 0.0000 Constraint 455 1087 0.8000 1.0000 2.0000 0.0000 Constraint 455 1075 0.8000 1.0000 2.0000 0.0000 Constraint 455 1066 0.8000 1.0000 2.0000 0.0000 Constraint 455 1039 0.8000 1.0000 2.0000 0.0000 Constraint 455 1031 0.8000 1.0000 2.0000 0.0000 Constraint 455 1024 0.8000 1.0000 2.0000 0.0000 Constraint 455 1007 0.8000 1.0000 2.0000 0.0000 Constraint 455 981 0.8000 1.0000 2.0000 0.0000 Constraint 455 958 0.8000 1.0000 2.0000 0.0000 Constraint 455 951 0.8000 1.0000 2.0000 0.0000 Constraint 455 939 0.8000 1.0000 2.0000 0.0000 Constraint 455 931 0.8000 1.0000 2.0000 0.0000 Constraint 455 924 0.8000 1.0000 2.0000 0.0000 Constraint 455 915 0.8000 1.0000 2.0000 0.0000 Constraint 455 907 0.8000 1.0000 2.0000 0.0000 Constraint 455 900 0.8000 1.0000 2.0000 0.0000 Constraint 455 892 0.8000 1.0000 2.0000 0.0000 Constraint 455 884 0.8000 1.0000 2.0000 0.0000 Constraint 455 871 0.8000 1.0000 2.0000 0.0000 Constraint 455 852 0.8000 1.0000 2.0000 0.0000 Constraint 455 822 0.8000 1.0000 2.0000 0.0000 Constraint 455 805 0.8000 1.0000 2.0000 0.0000 Constraint 455 794 0.8000 1.0000 2.0000 0.0000 Constraint 455 789 0.8000 1.0000 2.0000 0.0000 Constraint 455 781 0.8000 1.0000 2.0000 0.0000 Constraint 455 773 0.8000 1.0000 2.0000 0.0000 Constraint 455 756 0.8000 1.0000 2.0000 0.0000 Constraint 455 742 0.8000 1.0000 2.0000 0.0000 Constraint 455 708 0.8000 1.0000 2.0000 0.0000 Constraint 455 641 0.8000 1.0000 2.0000 0.0000 Constraint 455 632 0.8000 1.0000 2.0000 0.0000 Constraint 455 624 0.8000 1.0000 2.0000 0.0000 Constraint 455 618 0.8000 1.0000 2.0000 0.0000 Constraint 455 610 0.8000 1.0000 2.0000 0.0000 Constraint 455 602 0.8000 1.0000 2.0000 0.0000 Constraint 455 596 0.8000 1.0000 2.0000 0.0000 Constraint 455 522 0.8000 1.0000 2.0000 0.0000 Constraint 455 515 0.8000 1.0000 2.0000 0.0000 Constraint 455 510 0.8000 1.0000 2.0000 0.0000 Constraint 455 499 0.8000 1.0000 2.0000 0.0000 Constraint 455 488 0.8000 1.0000 2.0000 0.0000 Constraint 455 481 0.8000 1.0000 2.0000 0.0000 Constraint 455 472 0.8000 1.0000 2.0000 0.0000 Constraint 455 464 0.8000 1.0000 2.0000 0.0000 Constraint 446 1476 0.8000 1.0000 2.0000 0.0000 Constraint 446 1467 0.8000 1.0000 2.0000 0.0000 Constraint 446 1459 0.8000 1.0000 2.0000 0.0000 Constraint 446 1451 0.8000 1.0000 2.0000 0.0000 Constraint 446 1442 0.8000 1.0000 2.0000 0.0000 Constraint 446 1430 0.8000 1.0000 2.0000 0.0000 Constraint 446 1421 0.8000 1.0000 2.0000 0.0000 Constraint 446 1413 0.8000 1.0000 2.0000 0.0000 Constraint 446 1402 0.8000 1.0000 2.0000 0.0000 Constraint 446 1395 0.8000 1.0000 2.0000 0.0000 Constraint 446 1386 0.8000 1.0000 2.0000 0.0000 Constraint 446 1381 0.8000 1.0000 2.0000 0.0000 Constraint 446 1373 0.8000 1.0000 2.0000 0.0000 Constraint 446 1362 0.8000 1.0000 2.0000 0.0000 Constraint 446 1354 0.8000 1.0000 2.0000 0.0000 Constraint 446 1347 0.8000 1.0000 2.0000 0.0000 Constraint 446 1339 0.8000 1.0000 2.0000 0.0000 Constraint 446 1329 0.8000 1.0000 2.0000 0.0000 Constraint 446 1318 0.8000 1.0000 2.0000 0.0000 Constraint 446 1306 0.8000 1.0000 2.0000 0.0000 Constraint 446 1295 0.8000 1.0000 2.0000 0.0000 Constraint 446 1288 0.8000 1.0000 2.0000 0.0000 Constraint 446 1281 0.8000 1.0000 2.0000 0.0000 Constraint 446 1272 0.8000 1.0000 2.0000 0.0000 Constraint 446 1264 0.8000 1.0000 2.0000 0.0000 Constraint 446 1256 0.8000 1.0000 2.0000 0.0000 Constraint 446 1244 0.8000 1.0000 2.0000 0.0000 Constraint 446 1235 0.8000 1.0000 2.0000 0.0000 Constraint 446 1225 0.8000 1.0000 2.0000 0.0000 Constraint 446 1213 0.8000 1.0000 2.0000 0.0000 Constraint 446 1208 0.8000 1.0000 2.0000 0.0000 Constraint 446 1201 0.8000 1.0000 2.0000 0.0000 Constraint 446 1192 0.8000 1.0000 2.0000 0.0000 Constraint 446 1186 0.8000 1.0000 2.0000 0.0000 Constraint 446 1174 0.8000 1.0000 2.0000 0.0000 Constraint 446 1168 0.8000 1.0000 2.0000 0.0000 Constraint 446 1159 0.8000 1.0000 2.0000 0.0000 Constraint 446 1150 0.8000 1.0000 2.0000 0.0000 Constraint 446 1144 0.8000 1.0000 2.0000 0.0000 Constraint 446 1133 0.8000 1.0000 2.0000 0.0000 Constraint 446 1124 0.8000 1.0000 2.0000 0.0000 Constraint 446 1106 0.8000 1.0000 2.0000 0.0000 Constraint 446 1095 0.8000 1.0000 2.0000 0.0000 Constraint 446 1087 0.8000 1.0000 2.0000 0.0000 Constraint 446 1075 0.8000 1.0000 2.0000 0.0000 Constraint 446 1066 0.8000 1.0000 2.0000 0.0000 Constraint 446 1051 0.8000 1.0000 2.0000 0.0000 Constraint 446 1039 0.8000 1.0000 2.0000 0.0000 Constraint 446 1031 0.8000 1.0000 2.0000 0.0000 Constraint 446 1024 0.8000 1.0000 2.0000 0.0000 Constraint 446 1015 0.8000 1.0000 2.0000 0.0000 Constraint 446 1007 0.8000 1.0000 2.0000 0.0000 Constraint 446 981 0.8000 1.0000 2.0000 0.0000 Constraint 446 967 0.8000 1.0000 2.0000 0.0000 Constraint 446 958 0.8000 1.0000 2.0000 0.0000 Constraint 446 951 0.8000 1.0000 2.0000 0.0000 Constraint 446 944 0.8000 1.0000 2.0000 0.0000 Constraint 446 939 0.8000 1.0000 2.0000 0.0000 Constraint 446 931 0.8000 1.0000 2.0000 0.0000 Constraint 446 924 0.8000 1.0000 2.0000 0.0000 Constraint 446 915 0.8000 1.0000 2.0000 0.0000 Constraint 446 907 0.8000 1.0000 2.0000 0.0000 Constraint 446 900 0.8000 1.0000 2.0000 0.0000 Constraint 446 892 0.8000 1.0000 2.0000 0.0000 Constraint 446 884 0.8000 1.0000 2.0000 0.0000 Constraint 446 871 0.8000 1.0000 2.0000 0.0000 Constraint 446 864 0.8000 1.0000 2.0000 0.0000 Constraint 446 822 0.8000 1.0000 2.0000 0.0000 Constraint 446 814 0.8000 1.0000 2.0000 0.0000 Constraint 446 805 0.8000 1.0000 2.0000 0.0000 Constraint 446 794 0.8000 1.0000 2.0000 0.0000 Constraint 446 789 0.8000 1.0000 2.0000 0.0000 Constraint 446 781 0.8000 1.0000 2.0000 0.0000 Constraint 446 773 0.8000 1.0000 2.0000 0.0000 Constraint 446 756 0.8000 1.0000 2.0000 0.0000 Constraint 446 691 0.8000 1.0000 2.0000 0.0000 Constraint 446 632 0.8000 1.0000 2.0000 0.0000 Constraint 446 624 0.8000 1.0000 2.0000 0.0000 Constraint 446 618 0.8000 1.0000 2.0000 0.0000 Constraint 446 610 0.8000 1.0000 2.0000 0.0000 Constraint 446 602 0.8000 1.0000 2.0000 0.0000 Constraint 446 596 0.8000 1.0000 2.0000 0.0000 Constraint 446 579 0.8000 1.0000 2.0000 0.0000 Constraint 446 570 0.8000 1.0000 2.0000 0.0000 Constraint 446 515 0.8000 1.0000 2.0000 0.0000 Constraint 446 510 0.8000 1.0000 2.0000 0.0000 Constraint 446 499 0.8000 1.0000 2.0000 0.0000 Constraint 446 488 0.8000 1.0000 2.0000 0.0000 Constraint 446 481 0.8000 1.0000 2.0000 0.0000 Constraint 446 472 0.8000 1.0000 2.0000 0.0000 Constraint 446 464 0.8000 1.0000 2.0000 0.0000 Constraint 446 455 0.8000 1.0000 2.0000 0.0000 Constraint 439 1476 0.8000 1.0000 2.0000 0.0000 Constraint 439 1467 0.8000 1.0000 2.0000 0.0000 Constraint 439 1442 0.8000 1.0000 2.0000 0.0000 Constraint 439 1421 0.8000 1.0000 2.0000 0.0000 Constraint 439 1386 0.8000 1.0000 2.0000 0.0000 Constraint 439 1381 0.8000 1.0000 2.0000 0.0000 Constraint 439 1373 0.8000 1.0000 2.0000 0.0000 Constraint 439 1362 0.8000 1.0000 2.0000 0.0000 Constraint 439 1354 0.8000 1.0000 2.0000 0.0000 Constraint 439 1347 0.8000 1.0000 2.0000 0.0000 Constraint 439 1339 0.8000 1.0000 2.0000 0.0000 Constraint 439 1329 0.8000 1.0000 2.0000 0.0000 Constraint 439 1318 0.8000 1.0000 2.0000 0.0000 Constraint 439 1306 0.8000 1.0000 2.0000 0.0000 Constraint 439 1295 0.8000 1.0000 2.0000 0.0000 Constraint 439 1288 0.8000 1.0000 2.0000 0.0000 Constraint 439 1281 0.8000 1.0000 2.0000 0.0000 Constraint 439 1272 0.8000 1.0000 2.0000 0.0000 Constraint 439 1264 0.8000 1.0000 2.0000 0.0000 Constraint 439 1256 0.8000 1.0000 2.0000 0.0000 Constraint 439 1244 0.8000 1.0000 2.0000 0.0000 Constraint 439 1235 0.8000 1.0000 2.0000 0.0000 Constraint 439 1225 0.8000 1.0000 2.0000 0.0000 Constraint 439 1213 0.8000 1.0000 2.0000 0.0000 Constraint 439 1208 0.8000 1.0000 2.0000 0.0000 Constraint 439 1201 0.8000 1.0000 2.0000 0.0000 Constraint 439 1192 0.8000 1.0000 2.0000 0.0000 Constraint 439 1186 0.8000 1.0000 2.0000 0.0000 Constraint 439 1174 0.8000 1.0000 2.0000 0.0000 Constraint 439 1168 0.8000 1.0000 2.0000 0.0000 Constraint 439 1159 0.8000 1.0000 2.0000 0.0000 Constraint 439 1150 0.8000 1.0000 2.0000 0.0000 Constraint 439 1144 0.8000 1.0000 2.0000 0.0000 Constraint 439 1133 0.8000 1.0000 2.0000 0.0000 Constraint 439 1124 0.8000 1.0000 2.0000 0.0000 Constraint 439 1095 0.8000 1.0000 2.0000 0.0000 Constraint 439 1087 0.8000 1.0000 2.0000 0.0000 Constraint 439 1066 0.8000 1.0000 2.0000 0.0000 Constraint 439 1039 0.8000 1.0000 2.0000 0.0000 Constraint 439 1031 0.8000 1.0000 2.0000 0.0000 Constraint 439 1024 0.8000 1.0000 2.0000 0.0000 Constraint 439 1015 0.8000 1.0000 2.0000 0.0000 Constraint 439 998 0.8000 1.0000 2.0000 0.0000 Constraint 439 967 0.8000 1.0000 2.0000 0.0000 Constraint 439 958 0.8000 1.0000 2.0000 0.0000 Constraint 439 907 0.8000 1.0000 2.0000 0.0000 Constraint 439 892 0.8000 1.0000 2.0000 0.0000 Constraint 439 822 0.8000 1.0000 2.0000 0.0000 Constraint 439 794 0.8000 1.0000 2.0000 0.0000 Constraint 439 632 0.8000 1.0000 2.0000 0.0000 Constraint 439 510 0.8000 1.0000 2.0000 0.0000 Constraint 439 499 0.8000 1.0000 2.0000 0.0000 Constraint 439 488 0.8000 1.0000 2.0000 0.0000 Constraint 439 481 0.8000 1.0000 2.0000 0.0000 Constraint 439 472 0.8000 1.0000 2.0000 0.0000 Constraint 439 464 0.8000 1.0000 2.0000 0.0000 Constraint 439 455 0.8000 1.0000 2.0000 0.0000 Constraint 439 446 0.8000 1.0000 2.0000 0.0000 Constraint 431 1476 0.8000 1.0000 2.0000 0.0000 Constraint 431 1467 0.8000 1.0000 2.0000 0.0000 Constraint 431 1459 0.8000 1.0000 2.0000 0.0000 Constraint 431 1451 0.8000 1.0000 2.0000 0.0000 Constraint 431 1442 0.8000 1.0000 2.0000 0.0000 Constraint 431 1421 0.8000 1.0000 2.0000 0.0000 Constraint 431 1413 0.8000 1.0000 2.0000 0.0000 Constraint 431 1402 0.8000 1.0000 2.0000 0.0000 Constraint 431 1395 0.8000 1.0000 2.0000 0.0000 Constraint 431 1386 0.8000 1.0000 2.0000 0.0000 Constraint 431 1381 0.8000 1.0000 2.0000 0.0000 Constraint 431 1373 0.8000 1.0000 2.0000 0.0000 Constraint 431 1362 0.8000 1.0000 2.0000 0.0000 Constraint 431 1354 0.8000 1.0000 2.0000 0.0000 Constraint 431 1347 0.8000 1.0000 2.0000 0.0000 Constraint 431 1339 0.8000 1.0000 2.0000 0.0000 Constraint 431 1329 0.8000 1.0000 2.0000 0.0000 Constraint 431 1318 0.8000 1.0000 2.0000 0.0000 Constraint 431 1306 0.8000 1.0000 2.0000 0.0000 Constraint 431 1295 0.8000 1.0000 2.0000 0.0000 Constraint 431 1288 0.8000 1.0000 2.0000 0.0000 Constraint 431 1281 0.8000 1.0000 2.0000 0.0000 Constraint 431 1272 0.8000 1.0000 2.0000 0.0000 Constraint 431 1264 0.8000 1.0000 2.0000 0.0000 Constraint 431 1256 0.8000 1.0000 2.0000 0.0000 Constraint 431 1244 0.8000 1.0000 2.0000 0.0000 Constraint 431 1235 0.8000 1.0000 2.0000 0.0000 Constraint 431 1225 0.8000 1.0000 2.0000 0.0000 Constraint 431 1208 0.8000 1.0000 2.0000 0.0000 Constraint 431 1201 0.8000 1.0000 2.0000 0.0000 Constraint 431 1192 0.8000 1.0000 2.0000 0.0000 Constraint 431 1186 0.8000 1.0000 2.0000 0.0000 Constraint 431 1174 0.8000 1.0000 2.0000 0.0000 Constraint 431 1168 0.8000 1.0000 2.0000 0.0000 Constraint 431 1150 0.8000 1.0000 2.0000 0.0000 Constraint 431 1144 0.8000 1.0000 2.0000 0.0000 Constraint 431 1133 0.8000 1.0000 2.0000 0.0000 Constraint 431 1124 0.8000 1.0000 2.0000 0.0000 Constraint 431 1106 0.8000 1.0000 2.0000 0.0000 Constraint 431 1095 0.8000 1.0000 2.0000 0.0000 Constraint 431 1087 0.8000 1.0000 2.0000 0.0000 Constraint 431 1075 0.8000 1.0000 2.0000 0.0000 Constraint 431 1066 0.8000 1.0000 2.0000 0.0000 Constraint 431 1039 0.8000 1.0000 2.0000 0.0000 Constraint 431 1024 0.8000 1.0000 2.0000 0.0000 Constraint 431 981 0.8000 1.0000 2.0000 0.0000 Constraint 431 967 0.8000 1.0000 2.0000 0.0000 Constraint 431 958 0.8000 1.0000 2.0000 0.0000 Constraint 431 939 0.8000 1.0000 2.0000 0.0000 Constraint 431 931 0.8000 1.0000 2.0000 0.0000 Constraint 431 907 0.8000 1.0000 2.0000 0.0000 Constraint 431 900 0.8000 1.0000 2.0000 0.0000 Constraint 431 871 0.8000 1.0000 2.0000 0.0000 Constraint 431 833 0.8000 1.0000 2.0000 0.0000 Constraint 431 805 0.8000 1.0000 2.0000 0.0000 Constraint 431 794 0.8000 1.0000 2.0000 0.0000 Constraint 431 789 0.8000 1.0000 2.0000 0.0000 Constraint 431 691 0.8000 1.0000 2.0000 0.0000 Constraint 431 660 0.8000 1.0000 2.0000 0.0000 Constraint 431 632 0.8000 1.0000 2.0000 0.0000 Constraint 431 562 0.8000 1.0000 2.0000 0.0000 Constraint 431 499 0.8000 1.0000 2.0000 0.0000 Constraint 431 488 0.8000 1.0000 2.0000 0.0000 Constraint 431 481 0.8000 1.0000 2.0000 0.0000 Constraint 431 472 0.8000 1.0000 2.0000 0.0000 Constraint 431 464 0.8000 1.0000 2.0000 0.0000 Constraint 431 455 0.8000 1.0000 2.0000 0.0000 Constraint 431 446 0.8000 1.0000 2.0000 0.0000 Constraint 431 439 0.8000 1.0000 2.0000 0.0000 Constraint 422 1476 0.8000 1.0000 2.0000 0.0000 Constraint 422 1467 0.8000 1.0000 2.0000 0.0000 Constraint 422 1459 0.8000 1.0000 2.0000 0.0000 Constraint 422 1451 0.8000 1.0000 2.0000 0.0000 Constraint 422 1442 0.8000 1.0000 2.0000 0.0000 Constraint 422 1430 0.8000 1.0000 2.0000 0.0000 Constraint 422 1421 0.8000 1.0000 2.0000 0.0000 Constraint 422 1395 0.8000 1.0000 2.0000 0.0000 Constraint 422 1386 0.8000 1.0000 2.0000 0.0000 Constraint 422 1373 0.8000 1.0000 2.0000 0.0000 Constraint 422 1362 0.8000 1.0000 2.0000 0.0000 Constraint 422 1354 0.8000 1.0000 2.0000 0.0000 Constraint 422 1347 0.8000 1.0000 2.0000 0.0000 Constraint 422 1339 0.8000 1.0000 2.0000 0.0000 Constraint 422 1329 0.8000 1.0000 2.0000 0.0000 Constraint 422 1318 0.8000 1.0000 2.0000 0.0000 Constraint 422 1306 0.8000 1.0000 2.0000 0.0000 Constraint 422 1295 0.8000 1.0000 2.0000 0.0000 Constraint 422 1288 0.8000 1.0000 2.0000 0.0000 Constraint 422 1281 0.8000 1.0000 2.0000 0.0000 Constraint 422 1272 0.8000 1.0000 2.0000 0.0000 Constraint 422 1264 0.8000 1.0000 2.0000 0.0000 Constraint 422 1256 0.8000 1.0000 2.0000 0.0000 Constraint 422 1244 0.8000 1.0000 2.0000 0.0000 Constraint 422 1235 0.8000 1.0000 2.0000 0.0000 Constraint 422 1225 0.8000 1.0000 2.0000 0.0000 Constraint 422 1213 0.8000 1.0000 2.0000 0.0000 Constraint 422 1208 0.8000 1.0000 2.0000 0.0000 Constraint 422 1201 0.8000 1.0000 2.0000 0.0000 Constraint 422 1192 0.8000 1.0000 2.0000 0.0000 Constraint 422 1186 0.8000 1.0000 2.0000 0.0000 Constraint 422 1174 0.8000 1.0000 2.0000 0.0000 Constraint 422 1168 0.8000 1.0000 2.0000 0.0000 Constraint 422 1159 0.8000 1.0000 2.0000 0.0000 Constraint 422 1150 0.8000 1.0000 2.0000 0.0000 Constraint 422 1144 0.8000 1.0000 2.0000 0.0000 Constraint 422 1133 0.8000 1.0000 2.0000 0.0000 Constraint 422 1124 0.8000 1.0000 2.0000 0.0000 Constraint 422 1106 0.8000 1.0000 2.0000 0.0000 Constraint 422 1095 0.8000 1.0000 2.0000 0.0000 Constraint 422 1087 0.8000 1.0000 2.0000 0.0000 Constraint 422 1075 0.8000 1.0000 2.0000 0.0000 Constraint 422 1066 0.8000 1.0000 2.0000 0.0000 Constraint 422 1051 0.8000 1.0000 2.0000 0.0000 Constraint 422 1039 0.8000 1.0000 2.0000 0.0000 Constraint 422 1031 0.8000 1.0000 2.0000 0.0000 Constraint 422 1024 0.8000 1.0000 2.0000 0.0000 Constraint 422 1015 0.8000 1.0000 2.0000 0.0000 Constraint 422 981 0.8000 1.0000 2.0000 0.0000 Constraint 422 967 0.8000 1.0000 2.0000 0.0000 Constraint 422 958 0.8000 1.0000 2.0000 0.0000 Constraint 422 951 0.8000 1.0000 2.0000 0.0000 Constraint 422 944 0.8000 1.0000 2.0000 0.0000 Constraint 422 939 0.8000 1.0000 2.0000 0.0000 Constraint 422 931 0.8000 1.0000 2.0000 0.0000 Constraint 422 924 0.8000 1.0000 2.0000 0.0000 Constraint 422 915 0.8000 1.0000 2.0000 0.0000 Constraint 422 907 0.8000 1.0000 2.0000 0.0000 Constraint 422 900 0.8000 1.0000 2.0000 0.0000 Constraint 422 892 0.8000 1.0000 2.0000 0.0000 Constraint 422 871 0.8000 1.0000 2.0000 0.0000 Constraint 422 864 0.8000 1.0000 2.0000 0.0000 Constraint 422 852 0.8000 1.0000 2.0000 0.0000 Constraint 422 841 0.8000 1.0000 2.0000 0.0000 Constraint 422 822 0.8000 1.0000 2.0000 0.0000 Constraint 422 805 0.8000 1.0000 2.0000 0.0000 Constraint 422 794 0.8000 1.0000 2.0000 0.0000 Constraint 422 789 0.8000 1.0000 2.0000 0.0000 Constraint 422 762 0.8000 1.0000 2.0000 0.0000 Constraint 422 728 0.8000 1.0000 2.0000 0.0000 Constraint 422 691 0.8000 1.0000 2.0000 0.0000 Constraint 422 683 0.8000 1.0000 2.0000 0.0000 Constraint 422 674 0.8000 1.0000 2.0000 0.0000 Constraint 422 660 0.8000 1.0000 2.0000 0.0000 Constraint 422 649 0.8000 1.0000 2.0000 0.0000 Constraint 422 632 0.8000 1.0000 2.0000 0.0000 Constraint 422 624 0.8000 1.0000 2.0000 0.0000 Constraint 422 618 0.8000 1.0000 2.0000 0.0000 Constraint 422 610 0.8000 1.0000 2.0000 0.0000 Constraint 422 602 0.8000 1.0000 2.0000 0.0000 Constraint 422 596 0.8000 1.0000 2.0000 0.0000 Constraint 422 585 0.8000 1.0000 2.0000 0.0000 Constraint 422 579 0.8000 1.0000 2.0000 0.0000 Constraint 422 562 0.8000 1.0000 2.0000 0.0000 Constraint 422 551 0.8000 1.0000 2.0000 0.0000 Constraint 422 515 0.8000 1.0000 2.0000 0.0000 Constraint 422 488 0.8000 1.0000 2.0000 0.0000 Constraint 422 481 0.8000 1.0000 2.0000 0.0000 Constraint 422 472 0.8000 1.0000 2.0000 0.0000 Constraint 422 464 0.8000 1.0000 2.0000 0.0000 Constraint 422 455 0.8000 1.0000 2.0000 0.0000 Constraint 422 446 0.8000 1.0000 2.0000 0.0000 Constraint 422 439 0.8000 1.0000 2.0000 0.0000 Constraint 422 431 0.8000 1.0000 2.0000 0.0000 Constraint 417 1476 0.8000 1.0000 2.0000 0.0000 Constraint 417 1467 0.8000 1.0000 2.0000 0.0000 Constraint 417 1459 0.8000 1.0000 2.0000 0.0000 Constraint 417 1451 0.8000 1.0000 2.0000 0.0000 Constraint 417 1442 0.8000 1.0000 2.0000 0.0000 Constraint 417 1430 0.8000 1.0000 2.0000 0.0000 Constraint 417 1421 0.8000 1.0000 2.0000 0.0000 Constraint 417 1402 0.8000 1.0000 2.0000 0.0000 Constraint 417 1395 0.8000 1.0000 2.0000 0.0000 Constraint 417 1386 0.8000 1.0000 2.0000 0.0000 Constraint 417 1381 0.8000 1.0000 2.0000 0.0000 Constraint 417 1373 0.8000 1.0000 2.0000 0.0000 Constraint 417 1362 0.8000 1.0000 2.0000 0.0000 Constraint 417 1354 0.8000 1.0000 2.0000 0.0000 Constraint 417 1347 0.8000 1.0000 2.0000 0.0000 Constraint 417 1339 0.8000 1.0000 2.0000 0.0000 Constraint 417 1329 0.8000 1.0000 2.0000 0.0000 Constraint 417 1318 0.8000 1.0000 2.0000 0.0000 Constraint 417 1306 0.8000 1.0000 2.0000 0.0000 Constraint 417 1295 0.8000 1.0000 2.0000 0.0000 Constraint 417 1288 0.8000 1.0000 2.0000 0.0000 Constraint 417 1281 0.8000 1.0000 2.0000 0.0000 Constraint 417 1272 0.8000 1.0000 2.0000 0.0000 Constraint 417 1264 0.8000 1.0000 2.0000 0.0000 Constraint 417 1256 0.8000 1.0000 2.0000 0.0000 Constraint 417 1244 0.8000 1.0000 2.0000 0.0000 Constraint 417 1235 0.8000 1.0000 2.0000 0.0000 Constraint 417 1225 0.8000 1.0000 2.0000 0.0000 Constraint 417 1213 0.8000 1.0000 2.0000 0.0000 Constraint 417 1208 0.8000 1.0000 2.0000 0.0000 Constraint 417 1201 0.8000 1.0000 2.0000 0.0000 Constraint 417 1192 0.8000 1.0000 2.0000 0.0000 Constraint 417 1186 0.8000 1.0000 2.0000 0.0000 Constraint 417 1174 0.8000 1.0000 2.0000 0.0000 Constraint 417 1168 0.8000 1.0000 2.0000 0.0000 Constraint 417 1159 0.8000 1.0000 2.0000 0.0000 Constraint 417 1150 0.8000 1.0000 2.0000 0.0000 Constraint 417 1144 0.8000 1.0000 2.0000 0.0000 Constraint 417 1133 0.8000 1.0000 2.0000 0.0000 Constraint 417 1124 0.8000 1.0000 2.0000 0.0000 Constraint 417 1106 0.8000 1.0000 2.0000 0.0000 Constraint 417 1095 0.8000 1.0000 2.0000 0.0000 Constraint 417 1087 0.8000 1.0000 2.0000 0.0000 Constraint 417 1051 0.8000 1.0000 2.0000 0.0000 Constraint 417 1039 0.8000 1.0000 2.0000 0.0000 Constraint 417 1031 0.8000 1.0000 2.0000 0.0000 Constraint 417 1024 0.8000 1.0000 2.0000 0.0000 Constraint 417 1015 0.8000 1.0000 2.0000 0.0000 Constraint 417 1007 0.8000 1.0000 2.0000 0.0000 Constraint 417 967 0.8000 1.0000 2.0000 0.0000 Constraint 417 958 0.8000 1.0000 2.0000 0.0000 Constraint 417 951 0.8000 1.0000 2.0000 0.0000 Constraint 417 939 0.8000 1.0000 2.0000 0.0000 Constraint 417 931 0.8000 1.0000 2.0000 0.0000 Constraint 417 915 0.8000 1.0000 2.0000 0.0000 Constraint 417 900 0.8000 1.0000 2.0000 0.0000 Constraint 417 884 0.8000 1.0000 2.0000 0.0000 Constraint 417 871 0.8000 1.0000 2.0000 0.0000 Constraint 417 864 0.8000 1.0000 2.0000 0.0000 Constraint 417 852 0.8000 1.0000 2.0000 0.0000 Constraint 417 841 0.8000 1.0000 2.0000 0.0000 Constraint 417 833 0.8000 1.0000 2.0000 0.0000 Constraint 417 822 0.8000 1.0000 2.0000 0.0000 Constraint 417 814 0.8000 1.0000 2.0000 0.0000 Constraint 417 805 0.8000 1.0000 2.0000 0.0000 Constraint 417 794 0.8000 1.0000 2.0000 0.0000 Constraint 417 789 0.8000 1.0000 2.0000 0.0000 Constraint 417 781 0.8000 1.0000 2.0000 0.0000 Constraint 417 728 0.8000 1.0000 2.0000 0.0000 Constraint 417 691 0.8000 1.0000 2.0000 0.0000 Constraint 417 683 0.8000 1.0000 2.0000 0.0000 Constraint 417 632 0.8000 1.0000 2.0000 0.0000 Constraint 417 618 0.8000 1.0000 2.0000 0.0000 Constraint 417 610 0.8000 1.0000 2.0000 0.0000 Constraint 417 596 0.8000 1.0000 2.0000 0.0000 Constraint 417 579 0.8000 1.0000 2.0000 0.0000 Constraint 417 570 0.8000 1.0000 2.0000 0.0000 Constraint 417 562 0.8000 1.0000 2.0000 0.0000 Constraint 417 544 0.8000 1.0000 2.0000 0.0000 Constraint 417 532 0.8000 1.0000 2.0000 0.0000 Constraint 417 515 0.8000 1.0000 2.0000 0.0000 Constraint 417 499 0.8000 1.0000 2.0000 0.0000 Constraint 417 481 0.8000 1.0000 2.0000 0.0000 Constraint 417 472 0.8000 1.0000 2.0000 0.0000 Constraint 417 464 0.8000 1.0000 2.0000 0.0000 Constraint 417 455 0.8000 1.0000 2.0000 0.0000 Constraint 417 446 0.8000 1.0000 2.0000 0.0000 Constraint 417 439 0.8000 1.0000 2.0000 0.0000 Constraint 417 431 0.8000 1.0000 2.0000 0.0000 Constraint 417 422 0.8000 1.0000 2.0000 0.0000 Constraint 408 1476 0.8000 1.0000 2.0000 0.0000 Constraint 408 1467 0.8000 1.0000 2.0000 0.0000 Constraint 408 1459 0.8000 1.0000 2.0000 0.0000 Constraint 408 1451 0.8000 1.0000 2.0000 0.0000 Constraint 408 1442 0.8000 1.0000 2.0000 0.0000 Constraint 408 1421 0.8000 1.0000 2.0000 0.0000 Constraint 408 1413 0.8000 1.0000 2.0000 0.0000 Constraint 408 1395 0.8000 1.0000 2.0000 0.0000 Constraint 408 1386 0.8000 1.0000 2.0000 0.0000 Constraint 408 1381 0.8000 1.0000 2.0000 0.0000 Constraint 408 1373 0.8000 1.0000 2.0000 0.0000 Constraint 408 1362 0.8000 1.0000 2.0000 0.0000 Constraint 408 1354 0.8000 1.0000 2.0000 0.0000 Constraint 408 1347 0.8000 1.0000 2.0000 0.0000 Constraint 408 1339 0.8000 1.0000 2.0000 0.0000 Constraint 408 1329 0.8000 1.0000 2.0000 0.0000 Constraint 408 1318 0.8000 1.0000 2.0000 0.0000 Constraint 408 1306 0.8000 1.0000 2.0000 0.0000 Constraint 408 1295 0.8000 1.0000 2.0000 0.0000 Constraint 408 1288 0.8000 1.0000 2.0000 0.0000 Constraint 408 1281 0.8000 1.0000 2.0000 0.0000 Constraint 408 1272 0.8000 1.0000 2.0000 0.0000 Constraint 408 1264 0.8000 1.0000 2.0000 0.0000 Constraint 408 1256 0.8000 1.0000 2.0000 0.0000 Constraint 408 1244 0.8000 1.0000 2.0000 0.0000 Constraint 408 1235 0.8000 1.0000 2.0000 0.0000 Constraint 408 1225 0.8000 1.0000 2.0000 0.0000 Constraint 408 1213 0.8000 1.0000 2.0000 0.0000 Constraint 408 1208 0.8000 1.0000 2.0000 0.0000 Constraint 408 1201 0.8000 1.0000 2.0000 0.0000 Constraint 408 1192 0.8000 1.0000 2.0000 0.0000 Constraint 408 1186 0.8000 1.0000 2.0000 0.0000 Constraint 408 1174 0.8000 1.0000 2.0000 0.0000 Constraint 408 1168 0.8000 1.0000 2.0000 0.0000 Constraint 408 1159 0.8000 1.0000 2.0000 0.0000 Constraint 408 1150 0.8000 1.0000 2.0000 0.0000 Constraint 408 1144 0.8000 1.0000 2.0000 0.0000 Constraint 408 1124 0.8000 1.0000 2.0000 0.0000 Constraint 408 1106 0.8000 1.0000 2.0000 0.0000 Constraint 408 1031 0.8000 1.0000 2.0000 0.0000 Constraint 408 1024 0.8000 1.0000 2.0000 0.0000 Constraint 408 1015 0.8000 1.0000 2.0000 0.0000 Constraint 408 1007 0.8000 1.0000 2.0000 0.0000 Constraint 408 931 0.8000 1.0000 2.0000 0.0000 Constraint 408 907 0.8000 1.0000 2.0000 0.0000 Constraint 408 852 0.8000 1.0000 2.0000 0.0000 Constraint 408 833 0.8000 1.0000 2.0000 0.0000 Constraint 408 822 0.8000 1.0000 2.0000 0.0000 Constraint 408 814 0.8000 1.0000 2.0000 0.0000 Constraint 408 805 0.8000 1.0000 2.0000 0.0000 Constraint 408 789 0.8000 1.0000 2.0000 0.0000 Constraint 408 773 0.8000 1.0000 2.0000 0.0000 Constraint 408 723 0.8000 1.0000 2.0000 0.0000 Constraint 408 716 0.8000 1.0000 2.0000 0.0000 Constraint 408 562 0.8000 1.0000 2.0000 0.0000 Constraint 408 551 0.8000 1.0000 2.0000 0.0000 Constraint 408 532 0.8000 1.0000 2.0000 0.0000 Constraint 408 515 0.8000 1.0000 2.0000 0.0000 Constraint 408 510 0.8000 1.0000 2.0000 0.0000 Constraint 408 499 0.8000 1.0000 2.0000 0.0000 Constraint 408 488 0.8000 1.0000 2.0000 0.0000 Constraint 408 472 0.8000 1.0000 2.0000 0.0000 Constraint 408 464 0.8000 1.0000 2.0000 0.0000 Constraint 408 455 0.8000 1.0000 2.0000 0.0000 Constraint 408 446 0.8000 1.0000 2.0000 0.0000 Constraint 408 439 0.8000 1.0000 2.0000 0.0000 Constraint 408 431 0.8000 1.0000 2.0000 0.0000 Constraint 408 422 0.8000 1.0000 2.0000 0.0000 Constraint 408 417 0.8000 1.0000 2.0000 0.0000 Constraint 402 1476 0.8000 1.0000 2.0000 0.0000 Constraint 402 1467 0.8000 1.0000 2.0000 0.0000 Constraint 402 1459 0.8000 1.0000 2.0000 0.0000 Constraint 402 1451 0.8000 1.0000 2.0000 0.0000 Constraint 402 1442 0.8000 1.0000 2.0000 0.0000 Constraint 402 1430 0.8000 1.0000 2.0000 0.0000 Constraint 402 1402 0.8000 1.0000 2.0000 0.0000 Constraint 402 1395 0.8000 1.0000 2.0000 0.0000 Constraint 402 1386 0.8000 1.0000 2.0000 0.0000 Constraint 402 1381 0.8000 1.0000 2.0000 0.0000 Constraint 402 1373 0.8000 1.0000 2.0000 0.0000 Constraint 402 1362 0.8000 1.0000 2.0000 0.0000 Constraint 402 1354 0.8000 1.0000 2.0000 0.0000 Constraint 402 1347 0.8000 1.0000 2.0000 0.0000 Constraint 402 1339 0.8000 1.0000 2.0000 0.0000 Constraint 402 1329 0.8000 1.0000 2.0000 0.0000 Constraint 402 1318 0.8000 1.0000 2.0000 0.0000 Constraint 402 1306 0.8000 1.0000 2.0000 0.0000 Constraint 402 1295 0.8000 1.0000 2.0000 0.0000 Constraint 402 1288 0.8000 1.0000 2.0000 0.0000 Constraint 402 1281 0.8000 1.0000 2.0000 0.0000 Constraint 402 1272 0.8000 1.0000 2.0000 0.0000 Constraint 402 1264 0.8000 1.0000 2.0000 0.0000 Constraint 402 1256 0.8000 1.0000 2.0000 0.0000 Constraint 402 1244 0.8000 1.0000 2.0000 0.0000 Constraint 402 1235 0.8000 1.0000 2.0000 0.0000 Constraint 402 1225 0.8000 1.0000 2.0000 0.0000 Constraint 402 1213 0.8000 1.0000 2.0000 0.0000 Constraint 402 1208 0.8000 1.0000 2.0000 0.0000 Constraint 402 1201 0.8000 1.0000 2.0000 0.0000 Constraint 402 1192 0.8000 1.0000 2.0000 0.0000 Constraint 402 1186 0.8000 1.0000 2.0000 0.0000 Constraint 402 1174 0.8000 1.0000 2.0000 0.0000 Constraint 402 1168 0.8000 1.0000 2.0000 0.0000 Constraint 402 1159 0.8000 1.0000 2.0000 0.0000 Constraint 402 1150 0.8000 1.0000 2.0000 0.0000 Constraint 402 1144 0.8000 1.0000 2.0000 0.0000 Constraint 402 1106 0.8000 1.0000 2.0000 0.0000 Constraint 402 1095 0.8000 1.0000 2.0000 0.0000 Constraint 402 1087 0.8000 1.0000 2.0000 0.0000 Constraint 402 1031 0.8000 1.0000 2.0000 0.0000 Constraint 402 1024 0.8000 1.0000 2.0000 0.0000 Constraint 402 951 0.8000 1.0000 2.0000 0.0000 Constraint 402 944 0.8000 1.0000 2.0000 0.0000 Constraint 402 939 0.8000 1.0000 2.0000 0.0000 Constraint 402 931 0.8000 1.0000 2.0000 0.0000 Constraint 402 924 0.8000 1.0000 2.0000 0.0000 Constraint 402 915 0.8000 1.0000 2.0000 0.0000 Constraint 402 852 0.8000 1.0000 2.0000 0.0000 Constraint 402 841 0.8000 1.0000 2.0000 0.0000 Constraint 402 833 0.8000 1.0000 2.0000 0.0000 Constraint 402 822 0.8000 1.0000 2.0000 0.0000 Constraint 402 814 0.8000 1.0000 2.0000 0.0000 Constraint 402 805 0.8000 1.0000 2.0000 0.0000 Constraint 402 794 0.8000 1.0000 2.0000 0.0000 Constraint 402 789 0.8000 1.0000 2.0000 0.0000 Constraint 402 773 0.8000 1.0000 2.0000 0.0000 Constraint 402 756 0.8000 1.0000 2.0000 0.0000 Constraint 402 742 0.8000 1.0000 2.0000 0.0000 Constraint 402 728 0.8000 1.0000 2.0000 0.0000 Constraint 402 723 0.8000 1.0000 2.0000 0.0000 Constraint 402 562 0.8000 1.0000 2.0000 0.0000 Constraint 402 551 0.8000 1.0000 2.0000 0.0000 Constraint 402 532 0.8000 1.0000 2.0000 0.0000 Constraint 402 522 0.8000 1.0000 2.0000 0.0000 Constraint 402 515 0.8000 1.0000 2.0000 0.0000 Constraint 402 510 0.8000 1.0000 2.0000 0.0000 Constraint 402 499 0.8000 1.0000 2.0000 0.0000 Constraint 402 464 0.8000 1.0000 2.0000 0.0000 Constraint 402 455 0.8000 1.0000 2.0000 0.0000 Constraint 402 446 0.8000 1.0000 2.0000 0.0000 Constraint 402 439 0.8000 1.0000 2.0000 0.0000 Constraint 402 431 0.8000 1.0000 2.0000 0.0000 Constraint 402 422 0.8000 1.0000 2.0000 0.0000 Constraint 402 417 0.8000 1.0000 2.0000 0.0000 Constraint 402 408 0.8000 1.0000 2.0000 0.0000 Constraint 394 1476 0.8000 1.0000 2.0000 0.0000 Constraint 394 1467 0.8000 1.0000 2.0000 0.0000 Constraint 394 1459 0.8000 1.0000 2.0000 0.0000 Constraint 394 1451 0.8000 1.0000 2.0000 0.0000 Constraint 394 1442 0.8000 1.0000 2.0000 0.0000 Constraint 394 1430 0.8000 1.0000 2.0000 0.0000 Constraint 394 1421 0.8000 1.0000 2.0000 0.0000 Constraint 394 1386 0.8000 1.0000 2.0000 0.0000 Constraint 394 1381 0.8000 1.0000 2.0000 0.0000 Constraint 394 1373 0.8000 1.0000 2.0000 0.0000 Constraint 394 1362 0.8000 1.0000 2.0000 0.0000 Constraint 394 1354 0.8000 1.0000 2.0000 0.0000 Constraint 394 1347 0.8000 1.0000 2.0000 0.0000 Constraint 394 1339 0.8000 1.0000 2.0000 0.0000 Constraint 394 1329 0.8000 1.0000 2.0000 0.0000 Constraint 394 1318 0.8000 1.0000 2.0000 0.0000 Constraint 394 1306 0.8000 1.0000 2.0000 0.0000 Constraint 394 1295 0.8000 1.0000 2.0000 0.0000 Constraint 394 1288 0.8000 1.0000 2.0000 0.0000 Constraint 394 1281 0.8000 1.0000 2.0000 0.0000 Constraint 394 1272 0.8000 1.0000 2.0000 0.0000 Constraint 394 1264 0.8000 1.0000 2.0000 0.0000 Constraint 394 1256 0.8000 1.0000 2.0000 0.0000 Constraint 394 1244 0.8000 1.0000 2.0000 0.0000 Constraint 394 1235 0.8000 1.0000 2.0000 0.0000 Constraint 394 1225 0.8000 1.0000 2.0000 0.0000 Constraint 394 1213 0.8000 1.0000 2.0000 0.0000 Constraint 394 1208 0.8000 1.0000 2.0000 0.0000 Constraint 394 1201 0.8000 1.0000 2.0000 0.0000 Constraint 394 1192 0.8000 1.0000 2.0000 0.0000 Constraint 394 1186 0.8000 1.0000 2.0000 0.0000 Constraint 394 1174 0.8000 1.0000 2.0000 0.0000 Constraint 394 1168 0.8000 1.0000 2.0000 0.0000 Constraint 394 1159 0.8000 1.0000 2.0000 0.0000 Constraint 394 1150 0.8000 1.0000 2.0000 0.0000 Constraint 394 1144 0.8000 1.0000 2.0000 0.0000 Constraint 394 1133 0.8000 1.0000 2.0000 0.0000 Constraint 394 1124 0.8000 1.0000 2.0000 0.0000 Constraint 394 1106 0.8000 1.0000 2.0000 0.0000 Constraint 394 1095 0.8000 1.0000 2.0000 0.0000 Constraint 394 1087 0.8000 1.0000 2.0000 0.0000 Constraint 394 1075 0.8000 1.0000 2.0000 0.0000 Constraint 394 1066 0.8000 1.0000 2.0000 0.0000 Constraint 394 1039 0.8000 1.0000 2.0000 0.0000 Constraint 394 1031 0.8000 1.0000 2.0000 0.0000 Constraint 394 1024 0.8000 1.0000 2.0000 0.0000 Constraint 394 1015 0.8000 1.0000 2.0000 0.0000 Constraint 394 990 0.8000 1.0000 2.0000 0.0000 Constraint 394 981 0.8000 1.0000 2.0000 0.0000 Constraint 394 973 0.8000 1.0000 2.0000 0.0000 Constraint 394 967 0.8000 1.0000 2.0000 0.0000 Constraint 394 951 0.8000 1.0000 2.0000 0.0000 Constraint 394 944 0.8000 1.0000 2.0000 0.0000 Constraint 394 939 0.8000 1.0000 2.0000 0.0000 Constraint 394 931 0.8000 1.0000 2.0000 0.0000 Constraint 394 852 0.8000 1.0000 2.0000 0.0000 Constraint 394 841 0.8000 1.0000 2.0000 0.0000 Constraint 394 833 0.8000 1.0000 2.0000 0.0000 Constraint 394 822 0.8000 1.0000 2.0000 0.0000 Constraint 394 814 0.8000 1.0000 2.0000 0.0000 Constraint 394 756 0.8000 1.0000 2.0000 0.0000 Constraint 394 742 0.8000 1.0000 2.0000 0.0000 Constraint 394 728 0.8000 1.0000 2.0000 0.0000 Constraint 394 723 0.8000 1.0000 2.0000 0.0000 Constraint 394 674 0.8000 1.0000 2.0000 0.0000 Constraint 394 669 0.8000 1.0000 2.0000 0.0000 Constraint 394 660 0.8000 1.0000 2.0000 0.0000 Constraint 394 551 0.8000 1.0000 2.0000 0.0000 Constraint 394 515 0.8000 1.0000 2.0000 0.0000 Constraint 394 510 0.8000 1.0000 2.0000 0.0000 Constraint 394 499 0.8000 1.0000 2.0000 0.0000 Constraint 394 455 0.8000 1.0000 2.0000 0.0000 Constraint 394 446 0.8000 1.0000 2.0000 0.0000 Constraint 394 439 0.8000 1.0000 2.0000 0.0000 Constraint 394 431 0.8000 1.0000 2.0000 0.0000 Constraint 394 422 0.8000 1.0000 2.0000 0.0000 Constraint 394 417 0.8000 1.0000 2.0000 0.0000 Constraint 394 408 0.8000 1.0000 2.0000 0.0000 Constraint 394 402 0.8000 1.0000 2.0000 0.0000 Constraint 386 1476 0.8000 1.0000 2.0000 0.0000 Constraint 386 1467 0.8000 1.0000 2.0000 0.0000 Constraint 386 1459 0.8000 1.0000 2.0000 0.0000 Constraint 386 1451 0.8000 1.0000 2.0000 0.0000 Constraint 386 1442 0.8000 1.0000 2.0000 0.0000 Constraint 386 1386 0.8000 1.0000 2.0000 0.0000 Constraint 386 1381 0.8000 1.0000 2.0000 0.0000 Constraint 386 1373 0.8000 1.0000 2.0000 0.0000 Constraint 386 1362 0.8000 1.0000 2.0000 0.0000 Constraint 386 1354 0.8000 1.0000 2.0000 0.0000 Constraint 386 1347 0.8000 1.0000 2.0000 0.0000 Constraint 386 1339 0.8000 1.0000 2.0000 0.0000 Constraint 386 1329 0.8000 1.0000 2.0000 0.0000 Constraint 386 1318 0.8000 1.0000 2.0000 0.0000 Constraint 386 1306 0.8000 1.0000 2.0000 0.0000 Constraint 386 1295 0.8000 1.0000 2.0000 0.0000 Constraint 386 1288 0.8000 1.0000 2.0000 0.0000 Constraint 386 1281 0.8000 1.0000 2.0000 0.0000 Constraint 386 1272 0.8000 1.0000 2.0000 0.0000 Constraint 386 1264 0.8000 1.0000 2.0000 0.0000 Constraint 386 1256 0.8000 1.0000 2.0000 0.0000 Constraint 386 1244 0.8000 1.0000 2.0000 0.0000 Constraint 386 1235 0.8000 1.0000 2.0000 0.0000 Constraint 386 1225 0.8000 1.0000 2.0000 0.0000 Constraint 386 1213 0.8000 1.0000 2.0000 0.0000 Constraint 386 1208 0.8000 1.0000 2.0000 0.0000 Constraint 386 1201 0.8000 1.0000 2.0000 0.0000 Constraint 386 1192 0.8000 1.0000 2.0000 0.0000 Constraint 386 1186 0.8000 1.0000 2.0000 0.0000 Constraint 386 1174 0.8000 1.0000 2.0000 0.0000 Constraint 386 1168 0.8000 1.0000 2.0000 0.0000 Constraint 386 1159 0.8000 1.0000 2.0000 0.0000 Constraint 386 1150 0.8000 1.0000 2.0000 0.0000 Constraint 386 1144 0.8000 1.0000 2.0000 0.0000 Constraint 386 1133 0.8000 1.0000 2.0000 0.0000 Constraint 386 1124 0.8000 1.0000 2.0000 0.0000 Constraint 386 1106 0.8000 1.0000 2.0000 0.0000 Constraint 386 1087 0.8000 1.0000 2.0000 0.0000 Constraint 386 1066 0.8000 1.0000 2.0000 0.0000 Constraint 386 1031 0.8000 1.0000 2.0000 0.0000 Constraint 386 1015 0.8000 1.0000 2.0000 0.0000 Constraint 386 973 0.8000 1.0000 2.0000 0.0000 Constraint 386 967 0.8000 1.0000 2.0000 0.0000 Constraint 386 958 0.8000 1.0000 2.0000 0.0000 Constraint 386 951 0.8000 1.0000 2.0000 0.0000 Constraint 386 944 0.8000 1.0000 2.0000 0.0000 Constraint 386 939 0.8000 1.0000 2.0000 0.0000 Constraint 386 931 0.8000 1.0000 2.0000 0.0000 Constraint 386 907 0.8000 1.0000 2.0000 0.0000 Constraint 386 833 0.8000 1.0000 2.0000 0.0000 Constraint 386 789 0.8000 1.0000 2.0000 0.0000 Constraint 386 781 0.8000 1.0000 2.0000 0.0000 Constraint 386 773 0.8000 1.0000 2.0000 0.0000 Constraint 386 762 0.8000 1.0000 2.0000 0.0000 Constraint 386 728 0.8000 1.0000 2.0000 0.0000 Constraint 386 723 0.8000 1.0000 2.0000 0.0000 Constraint 386 660 0.8000 1.0000 2.0000 0.0000 Constraint 386 562 0.8000 1.0000 2.0000 0.0000 Constraint 386 551 0.8000 1.0000 2.0000 0.0000 Constraint 386 544 0.8000 1.0000 2.0000 0.0000 Constraint 386 532 0.8000 1.0000 2.0000 0.0000 Constraint 386 522 0.8000 1.0000 2.0000 0.0000 Constraint 386 515 0.8000 1.0000 2.0000 0.0000 Constraint 386 510 0.8000 1.0000 2.0000 0.0000 Constraint 386 499 0.8000 1.0000 2.0000 0.0000 Constraint 386 472 0.8000 1.0000 2.0000 0.0000 Constraint 386 446 0.8000 1.0000 2.0000 0.0000 Constraint 386 439 0.8000 1.0000 2.0000 0.0000 Constraint 386 431 0.8000 1.0000 2.0000 0.0000 Constraint 386 422 0.8000 1.0000 2.0000 0.0000 Constraint 386 417 0.8000 1.0000 2.0000 0.0000 Constraint 386 408 0.8000 1.0000 2.0000 0.0000 Constraint 386 402 0.8000 1.0000 2.0000 0.0000 Constraint 386 394 0.8000 1.0000 2.0000 0.0000 Constraint 380 1476 0.8000 1.0000 2.0000 0.0000 Constraint 380 1467 0.8000 1.0000 2.0000 0.0000 Constraint 380 1459 0.8000 1.0000 2.0000 0.0000 Constraint 380 1451 0.8000 1.0000 2.0000 0.0000 Constraint 380 1442 0.8000 1.0000 2.0000 0.0000 Constraint 380 1430 0.8000 1.0000 2.0000 0.0000 Constraint 380 1421 0.8000 1.0000 2.0000 0.0000 Constraint 380 1413 0.8000 1.0000 2.0000 0.0000 Constraint 380 1373 0.8000 1.0000 2.0000 0.0000 Constraint 380 1362 0.8000 1.0000 2.0000 0.0000 Constraint 380 1354 0.8000 1.0000 2.0000 0.0000 Constraint 380 1339 0.8000 1.0000 2.0000 0.0000 Constraint 380 1329 0.8000 1.0000 2.0000 0.0000 Constraint 380 1318 0.8000 1.0000 2.0000 0.0000 Constraint 380 1306 0.8000 1.0000 2.0000 0.0000 Constraint 380 1295 0.8000 1.0000 2.0000 0.0000 Constraint 380 1288 0.8000 1.0000 2.0000 0.0000 Constraint 380 1281 0.8000 1.0000 2.0000 0.0000 Constraint 380 1272 0.8000 1.0000 2.0000 0.0000 Constraint 380 1264 0.8000 1.0000 2.0000 0.0000 Constraint 380 1256 0.8000 1.0000 2.0000 0.0000 Constraint 380 1244 0.8000 1.0000 2.0000 0.0000 Constraint 380 1235 0.8000 1.0000 2.0000 0.0000 Constraint 380 1225 0.8000 1.0000 2.0000 0.0000 Constraint 380 1213 0.8000 1.0000 2.0000 0.0000 Constraint 380 1208 0.8000 1.0000 2.0000 0.0000 Constraint 380 1201 0.8000 1.0000 2.0000 0.0000 Constraint 380 1192 0.8000 1.0000 2.0000 0.0000 Constraint 380 1186 0.8000 1.0000 2.0000 0.0000 Constraint 380 1174 0.8000 1.0000 2.0000 0.0000 Constraint 380 1168 0.8000 1.0000 2.0000 0.0000 Constraint 380 1159 0.8000 1.0000 2.0000 0.0000 Constraint 380 1150 0.8000 1.0000 2.0000 0.0000 Constraint 380 1144 0.8000 1.0000 2.0000 0.0000 Constraint 380 1133 0.8000 1.0000 2.0000 0.0000 Constraint 380 1106 0.8000 1.0000 2.0000 0.0000 Constraint 380 1066 0.8000 1.0000 2.0000 0.0000 Constraint 380 973 0.8000 1.0000 2.0000 0.0000 Constraint 380 967 0.8000 1.0000 2.0000 0.0000 Constraint 380 958 0.8000 1.0000 2.0000 0.0000 Constraint 380 944 0.8000 1.0000 2.0000 0.0000 Constraint 380 939 0.8000 1.0000 2.0000 0.0000 Constraint 380 931 0.8000 1.0000 2.0000 0.0000 Constraint 380 915 0.8000 1.0000 2.0000 0.0000 Constraint 380 907 0.8000 1.0000 2.0000 0.0000 Constraint 380 900 0.8000 1.0000 2.0000 0.0000 Constraint 380 871 0.8000 1.0000 2.0000 0.0000 Constraint 380 781 0.8000 1.0000 2.0000 0.0000 Constraint 380 773 0.8000 1.0000 2.0000 0.0000 Constraint 380 762 0.8000 1.0000 2.0000 0.0000 Constraint 380 756 0.8000 1.0000 2.0000 0.0000 Constraint 380 742 0.8000 1.0000 2.0000 0.0000 Constraint 380 728 0.8000 1.0000 2.0000 0.0000 Constraint 380 723 0.8000 1.0000 2.0000 0.0000 Constraint 380 716 0.8000 1.0000 2.0000 0.0000 Constraint 380 691 0.8000 1.0000 2.0000 0.0000 Constraint 380 669 0.8000 1.0000 2.0000 0.0000 Constraint 380 660 0.8000 1.0000 2.0000 0.0000 Constraint 380 544 0.8000 1.0000 2.0000 0.0000 Constraint 380 532 0.8000 1.0000 2.0000 0.0000 Constraint 380 515 0.8000 1.0000 2.0000 0.0000 Constraint 380 510 0.8000 1.0000 2.0000 0.0000 Constraint 380 472 0.8000 1.0000 2.0000 0.0000 Constraint 380 439 0.8000 1.0000 2.0000 0.0000 Constraint 380 431 0.8000 1.0000 2.0000 0.0000 Constraint 380 422 0.8000 1.0000 2.0000 0.0000 Constraint 380 417 0.8000 1.0000 2.0000 0.0000 Constraint 380 408 0.8000 1.0000 2.0000 0.0000 Constraint 380 402 0.8000 1.0000 2.0000 0.0000 Constraint 380 394 0.8000 1.0000 2.0000 0.0000 Constraint 380 386 0.8000 1.0000 2.0000 0.0000 Constraint 373 1476 0.8000 1.0000 2.0000 0.0000 Constraint 373 1467 0.8000 1.0000 2.0000 0.0000 Constraint 373 1459 0.8000 1.0000 2.0000 0.0000 Constraint 373 1451 0.8000 1.0000 2.0000 0.0000 Constraint 373 1442 0.8000 1.0000 2.0000 0.0000 Constraint 373 1430 0.8000 1.0000 2.0000 0.0000 Constraint 373 1421 0.8000 1.0000 2.0000 0.0000 Constraint 373 1413 0.8000 1.0000 2.0000 0.0000 Constraint 373 1373 0.8000 1.0000 2.0000 0.0000 Constraint 373 1362 0.8000 1.0000 2.0000 0.0000 Constraint 373 1354 0.8000 1.0000 2.0000 0.0000 Constraint 373 1347 0.8000 1.0000 2.0000 0.0000 Constraint 373 1339 0.8000 1.0000 2.0000 0.0000 Constraint 373 1329 0.8000 1.0000 2.0000 0.0000 Constraint 373 1318 0.8000 1.0000 2.0000 0.0000 Constraint 373 1306 0.8000 1.0000 2.0000 0.0000 Constraint 373 1295 0.8000 1.0000 2.0000 0.0000 Constraint 373 1288 0.8000 1.0000 2.0000 0.0000 Constraint 373 1281 0.8000 1.0000 2.0000 0.0000 Constraint 373 1272 0.8000 1.0000 2.0000 0.0000 Constraint 373 1264 0.8000 1.0000 2.0000 0.0000 Constraint 373 1256 0.8000 1.0000 2.0000 0.0000 Constraint 373 1244 0.8000 1.0000 2.0000 0.0000 Constraint 373 1235 0.8000 1.0000 2.0000 0.0000 Constraint 373 1225 0.8000 1.0000 2.0000 0.0000 Constraint 373 1213 0.8000 1.0000 2.0000 0.0000 Constraint 373 1208 0.8000 1.0000 2.0000 0.0000 Constraint 373 1201 0.8000 1.0000 2.0000 0.0000 Constraint 373 1192 0.8000 1.0000 2.0000 0.0000 Constraint 373 1186 0.8000 1.0000 2.0000 0.0000 Constraint 373 1174 0.8000 1.0000 2.0000 0.0000 Constraint 373 1168 0.8000 1.0000 2.0000 0.0000 Constraint 373 1159 0.8000 1.0000 2.0000 0.0000 Constraint 373 1150 0.8000 1.0000 2.0000 0.0000 Constraint 373 1144 0.8000 1.0000 2.0000 0.0000 Constraint 373 1133 0.8000 1.0000 2.0000 0.0000 Constraint 373 1124 0.8000 1.0000 2.0000 0.0000 Constraint 373 1066 0.8000 1.0000 2.0000 0.0000 Constraint 373 981 0.8000 1.0000 2.0000 0.0000 Constraint 373 973 0.8000 1.0000 2.0000 0.0000 Constraint 373 939 0.8000 1.0000 2.0000 0.0000 Constraint 373 915 0.8000 1.0000 2.0000 0.0000 Constraint 373 907 0.8000 1.0000 2.0000 0.0000 Constraint 373 900 0.8000 1.0000 2.0000 0.0000 Constraint 373 789 0.8000 1.0000 2.0000 0.0000 Constraint 373 781 0.8000 1.0000 2.0000 0.0000 Constraint 373 773 0.8000 1.0000 2.0000 0.0000 Constraint 373 762 0.8000 1.0000 2.0000 0.0000 Constraint 373 756 0.8000 1.0000 2.0000 0.0000 Constraint 373 728 0.8000 1.0000 2.0000 0.0000 Constraint 373 723 0.8000 1.0000 2.0000 0.0000 Constraint 373 691 0.8000 1.0000 2.0000 0.0000 Constraint 373 660 0.8000 1.0000 2.0000 0.0000 Constraint 373 632 0.8000 1.0000 2.0000 0.0000 Constraint 373 544 0.8000 1.0000 2.0000 0.0000 Constraint 373 532 0.8000 1.0000 2.0000 0.0000 Constraint 373 515 0.8000 1.0000 2.0000 0.0000 Constraint 373 431 0.8000 1.0000 2.0000 0.0000 Constraint 373 422 0.8000 1.0000 2.0000 0.0000 Constraint 373 417 0.8000 1.0000 2.0000 0.0000 Constraint 373 408 0.8000 1.0000 2.0000 0.0000 Constraint 373 402 0.8000 1.0000 2.0000 0.0000 Constraint 373 394 0.8000 1.0000 2.0000 0.0000 Constraint 373 386 0.8000 1.0000 2.0000 0.0000 Constraint 373 380 0.8000 1.0000 2.0000 0.0000 Constraint 362 1476 0.8000 1.0000 2.0000 0.0000 Constraint 362 1467 0.8000 1.0000 2.0000 0.0000 Constraint 362 1459 0.8000 1.0000 2.0000 0.0000 Constraint 362 1451 0.8000 1.0000 2.0000 0.0000 Constraint 362 1442 0.8000 1.0000 2.0000 0.0000 Constraint 362 1430 0.8000 1.0000 2.0000 0.0000 Constraint 362 1413 0.8000 1.0000 2.0000 0.0000 Constraint 362 1402 0.8000 1.0000 2.0000 0.0000 Constraint 362 1373 0.8000 1.0000 2.0000 0.0000 Constraint 362 1362 0.8000 1.0000 2.0000 0.0000 Constraint 362 1354 0.8000 1.0000 2.0000 0.0000 Constraint 362 1347 0.8000 1.0000 2.0000 0.0000 Constraint 362 1339 0.8000 1.0000 2.0000 0.0000 Constraint 362 1329 0.8000 1.0000 2.0000 0.0000 Constraint 362 1318 0.8000 1.0000 2.0000 0.0000 Constraint 362 1306 0.8000 1.0000 2.0000 0.0000 Constraint 362 1295 0.8000 1.0000 2.0000 0.0000 Constraint 362 1288 0.8000 1.0000 2.0000 0.0000 Constraint 362 1281 0.8000 1.0000 2.0000 0.0000 Constraint 362 1272 0.8000 1.0000 2.0000 0.0000 Constraint 362 1264 0.8000 1.0000 2.0000 0.0000 Constraint 362 1256 0.8000 1.0000 2.0000 0.0000 Constraint 362 1244 0.8000 1.0000 2.0000 0.0000 Constraint 362 1235 0.8000 1.0000 2.0000 0.0000 Constraint 362 1225 0.8000 1.0000 2.0000 0.0000 Constraint 362 1213 0.8000 1.0000 2.0000 0.0000 Constraint 362 1208 0.8000 1.0000 2.0000 0.0000 Constraint 362 1201 0.8000 1.0000 2.0000 0.0000 Constraint 362 1192 0.8000 1.0000 2.0000 0.0000 Constraint 362 1186 0.8000 1.0000 2.0000 0.0000 Constraint 362 1174 0.8000 1.0000 2.0000 0.0000 Constraint 362 1168 0.8000 1.0000 2.0000 0.0000 Constraint 362 1159 0.8000 1.0000 2.0000 0.0000 Constraint 362 1150 0.8000 1.0000 2.0000 0.0000 Constraint 362 1144 0.8000 1.0000 2.0000 0.0000 Constraint 362 1133 0.8000 1.0000 2.0000 0.0000 Constraint 362 1124 0.8000 1.0000 2.0000 0.0000 Constraint 362 1106 0.8000 1.0000 2.0000 0.0000 Constraint 362 1051 0.8000 1.0000 2.0000 0.0000 Constraint 362 967 0.8000 1.0000 2.0000 0.0000 Constraint 362 958 0.8000 1.0000 2.0000 0.0000 Constraint 362 939 0.8000 1.0000 2.0000 0.0000 Constraint 362 931 0.8000 1.0000 2.0000 0.0000 Constraint 362 915 0.8000 1.0000 2.0000 0.0000 Constraint 362 907 0.8000 1.0000 2.0000 0.0000 Constraint 362 900 0.8000 1.0000 2.0000 0.0000 Constraint 362 892 0.8000 1.0000 2.0000 0.0000 Constraint 362 871 0.8000 1.0000 2.0000 0.0000 Constraint 362 789 0.8000 1.0000 2.0000 0.0000 Constraint 362 691 0.8000 1.0000 2.0000 0.0000 Constraint 362 660 0.8000 1.0000 2.0000 0.0000 Constraint 362 632 0.8000 1.0000 2.0000 0.0000 Constraint 362 510 0.8000 1.0000 2.0000 0.0000 Constraint 362 422 0.8000 1.0000 2.0000 0.0000 Constraint 362 417 0.8000 1.0000 2.0000 0.0000 Constraint 362 408 0.8000 1.0000 2.0000 0.0000 Constraint 362 402 0.8000 1.0000 2.0000 0.0000 Constraint 362 394 0.8000 1.0000 2.0000 0.0000 Constraint 362 386 0.8000 1.0000 2.0000 0.0000 Constraint 362 380 0.8000 1.0000 2.0000 0.0000 Constraint 362 373 0.8000 1.0000 2.0000 0.0000 Constraint 351 1476 0.8000 1.0000 2.0000 0.0000 Constraint 351 1467 0.8000 1.0000 2.0000 0.0000 Constraint 351 1459 0.8000 1.0000 2.0000 0.0000 Constraint 351 1451 0.8000 1.0000 2.0000 0.0000 Constraint 351 1442 0.8000 1.0000 2.0000 0.0000 Constraint 351 1421 0.8000 1.0000 2.0000 0.0000 Constraint 351 1413 0.8000 1.0000 2.0000 0.0000 Constraint 351 1402 0.8000 1.0000 2.0000 0.0000 Constraint 351 1395 0.8000 1.0000 2.0000 0.0000 Constraint 351 1381 0.8000 1.0000 2.0000 0.0000 Constraint 351 1373 0.8000 1.0000 2.0000 0.0000 Constraint 351 1362 0.8000 1.0000 2.0000 0.0000 Constraint 351 1354 0.8000 1.0000 2.0000 0.0000 Constraint 351 1347 0.8000 1.0000 2.0000 0.0000 Constraint 351 1339 0.8000 1.0000 2.0000 0.0000 Constraint 351 1329 0.8000 1.0000 2.0000 0.0000 Constraint 351 1318 0.8000 1.0000 2.0000 0.0000 Constraint 351 1306 0.8000 1.0000 2.0000 0.0000 Constraint 351 1295 0.8000 1.0000 2.0000 0.0000 Constraint 351 1288 0.8000 1.0000 2.0000 0.0000 Constraint 351 1281 0.8000 1.0000 2.0000 0.0000 Constraint 351 1272 0.8000 1.0000 2.0000 0.0000 Constraint 351 1264 0.8000 1.0000 2.0000 0.0000 Constraint 351 1256 0.8000 1.0000 2.0000 0.0000 Constraint 351 1244 0.8000 1.0000 2.0000 0.0000 Constraint 351 1235 0.8000 1.0000 2.0000 0.0000 Constraint 351 1213 0.8000 1.0000 2.0000 0.0000 Constraint 351 1208 0.8000 1.0000 2.0000 0.0000 Constraint 351 1201 0.8000 1.0000 2.0000 0.0000 Constraint 351 1192 0.8000 1.0000 2.0000 0.0000 Constraint 351 1186 0.8000 1.0000 2.0000 0.0000 Constraint 351 1174 0.8000 1.0000 2.0000 0.0000 Constraint 351 1168 0.8000 1.0000 2.0000 0.0000 Constraint 351 1159 0.8000 1.0000 2.0000 0.0000 Constraint 351 1150 0.8000 1.0000 2.0000 0.0000 Constraint 351 1144 0.8000 1.0000 2.0000 0.0000 Constraint 351 1133 0.8000 1.0000 2.0000 0.0000 Constraint 351 998 0.8000 1.0000 2.0000 0.0000 Constraint 351 990 0.8000 1.0000 2.0000 0.0000 Constraint 351 981 0.8000 1.0000 2.0000 0.0000 Constraint 351 967 0.8000 1.0000 2.0000 0.0000 Constraint 351 958 0.8000 1.0000 2.0000 0.0000 Constraint 351 944 0.8000 1.0000 2.0000 0.0000 Constraint 351 939 0.8000 1.0000 2.0000 0.0000 Constraint 351 907 0.8000 1.0000 2.0000 0.0000 Constraint 351 892 0.8000 1.0000 2.0000 0.0000 Constraint 351 871 0.8000 1.0000 2.0000 0.0000 Constraint 351 773 0.8000 1.0000 2.0000 0.0000 Constraint 351 762 0.8000 1.0000 2.0000 0.0000 Constraint 351 756 0.8000 1.0000 2.0000 0.0000 Constraint 351 742 0.8000 1.0000 2.0000 0.0000 Constraint 351 708 0.8000 1.0000 2.0000 0.0000 Constraint 351 700 0.8000 1.0000 2.0000 0.0000 Constraint 351 691 0.8000 1.0000 2.0000 0.0000 Constraint 351 669 0.8000 1.0000 2.0000 0.0000 Constraint 351 660 0.8000 1.0000 2.0000 0.0000 Constraint 351 641 0.8000 1.0000 2.0000 0.0000 Constraint 351 632 0.8000 1.0000 2.0000 0.0000 Constraint 351 481 0.8000 1.0000 2.0000 0.0000 Constraint 351 472 0.8000 1.0000 2.0000 0.0000 Constraint 351 417 0.8000 1.0000 2.0000 0.0000 Constraint 351 408 0.8000 1.0000 2.0000 0.0000 Constraint 351 402 0.8000 1.0000 2.0000 0.0000 Constraint 351 394 0.8000 1.0000 2.0000 0.0000 Constraint 351 386 0.8000 1.0000 2.0000 0.0000 Constraint 351 380 0.8000 1.0000 2.0000 0.0000 Constraint 351 373 0.8000 1.0000 2.0000 0.0000 Constraint 351 362 0.8000 1.0000 2.0000 0.0000 Constraint 343 1476 0.8000 1.0000 2.0000 0.0000 Constraint 343 1467 0.8000 1.0000 2.0000 0.0000 Constraint 343 1459 0.8000 1.0000 2.0000 0.0000 Constraint 343 1442 0.8000 1.0000 2.0000 0.0000 Constraint 343 1413 0.8000 1.0000 2.0000 0.0000 Constraint 343 1402 0.8000 1.0000 2.0000 0.0000 Constraint 343 1381 0.8000 1.0000 2.0000 0.0000 Constraint 343 1373 0.8000 1.0000 2.0000 0.0000 Constraint 343 1362 0.8000 1.0000 2.0000 0.0000 Constraint 343 1354 0.8000 1.0000 2.0000 0.0000 Constraint 343 1329 0.8000 1.0000 2.0000 0.0000 Constraint 343 1318 0.8000 1.0000 2.0000 0.0000 Constraint 343 1306 0.8000 1.0000 2.0000 0.0000 Constraint 343 1295 0.8000 1.0000 2.0000 0.0000 Constraint 343 1288 0.8000 1.0000 2.0000 0.0000 Constraint 343 1281 0.8000 1.0000 2.0000 0.0000 Constraint 343 1272 0.8000 1.0000 2.0000 0.0000 Constraint 343 1264 0.8000 1.0000 2.0000 0.0000 Constraint 343 1256 0.8000 1.0000 2.0000 0.0000 Constraint 343 1244 0.8000 1.0000 2.0000 0.0000 Constraint 343 1235 0.8000 1.0000 2.0000 0.0000 Constraint 343 1225 0.8000 1.0000 2.0000 0.0000 Constraint 343 1213 0.8000 1.0000 2.0000 0.0000 Constraint 343 1208 0.8000 1.0000 2.0000 0.0000 Constraint 343 1201 0.8000 1.0000 2.0000 0.0000 Constraint 343 1192 0.8000 1.0000 2.0000 0.0000 Constraint 343 1186 0.8000 1.0000 2.0000 0.0000 Constraint 343 1174 0.8000 1.0000 2.0000 0.0000 Constraint 343 1168 0.8000 1.0000 2.0000 0.0000 Constraint 343 1159 0.8000 1.0000 2.0000 0.0000 Constraint 343 1150 0.8000 1.0000 2.0000 0.0000 Constraint 343 1144 0.8000 1.0000 2.0000 0.0000 Constraint 343 1133 0.8000 1.0000 2.0000 0.0000 Constraint 343 1066 0.8000 1.0000 2.0000 0.0000 Constraint 343 1051 0.8000 1.0000 2.0000 0.0000 Constraint 343 1015 0.8000 1.0000 2.0000 0.0000 Constraint 343 990 0.8000 1.0000 2.0000 0.0000 Constraint 343 981 0.8000 1.0000 2.0000 0.0000 Constraint 343 967 0.8000 1.0000 2.0000 0.0000 Constraint 343 958 0.8000 1.0000 2.0000 0.0000 Constraint 343 939 0.8000 1.0000 2.0000 0.0000 Constraint 343 931 0.8000 1.0000 2.0000 0.0000 Constraint 343 915 0.8000 1.0000 2.0000 0.0000 Constraint 343 907 0.8000 1.0000 2.0000 0.0000 Constraint 343 892 0.8000 1.0000 2.0000 0.0000 Constraint 343 781 0.8000 1.0000 2.0000 0.0000 Constraint 343 773 0.8000 1.0000 2.0000 0.0000 Constraint 343 723 0.8000 1.0000 2.0000 0.0000 Constraint 343 716 0.8000 1.0000 2.0000 0.0000 Constraint 343 708 0.8000 1.0000 2.0000 0.0000 Constraint 343 691 0.8000 1.0000 2.0000 0.0000 Constraint 343 683 0.8000 1.0000 2.0000 0.0000 Constraint 343 674 0.8000 1.0000 2.0000 0.0000 Constraint 343 669 0.8000 1.0000 2.0000 0.0000 Constraint 343 660 0.8000 1.0000 2.0000 0.0000 Constraint 343 649 0.8000 1.0000 2.0000 0.0000 Constraint 343 641 0.8000 1.0000 2.0000 0.0000 Constraint 343 632 0.8000 1.0000 2.0000 0.0000 Constraint 343 446 0.8000 1.0000 2.0000 0.0000 Constraint 343 417 0.8000 1.0000 2.0000 0.0000 Constraint 343 408 0.8000 1.0000 2.0000 0.0000 Constraint 343 402 0.8000 1.0000 2.0000 0.0000 Constraint 343 394 0.8000 1.0000 2.0000 0.0000 Constraint 343 386 0.8000 1.0000 2.0000 0.0000 Constraint 343 380 0.8000 1.0000 2.0000 0.0000 Constraint 343 373 0.8000 1.0000 2.0000 0.0000 Constraint 343 362 0.8000 1.0000 2.0000 0.0000 Constraint 343 351 0.8000 1.0000 2.0000 0.0000 Constraint 335 1476 0.8000 1.0000 2.0000 0.0000 Constraint 335 1467 0.8000 1.0000 2.0000 0.0000 Constraint 335 1459 0.8000 1.0000 2.0000 0.0000 Constraint 335 1451 0.8000 1.0000 2.0000 0.0000 Constraint 335 1442 0.8000 1.0000 2.0000 0.0000 Constraint 335 1430 0.8000 1.0000 2.0000 0.0000 Constraint 335 1421 0.8000 1.0000 2.0000 0.0000 Constraint 335 1413 0.8000 1.0000 2.0000 0.0000 Constraint 335 1402 0.8000 1.0000 2.0000 0.0000 Constraint 335 1395 0.8000 1.0000 2.0000 0.0000 Constraint 335 1386 0.8000 1.0000 2.0000 0.0000 Constraint 335 1381 0.8000 1.0000 2.0000 0.0000 Constraint 335 1373 0.8000 1.0000 2.0000 0.0000 Constraint 335 1362 0.8000 1.0000 2.0000 0.0000 Constraint 335 1354 0.8000 1.0000 2.0000 0.0000 Constraint 335 1347 0.8000 1.0000 2.0000 0.0000 Constraint 335 1339 0.8000 1.0000 2.0000 0.0000 Constraint 335 1329 0.8000 1.0000 2.0000 0.0000 Constraint 335 1318 0.8000 1.0000 2.0000 0.0000 Constraint 335 1306 0.8000 1.0000 2.0000 0.0000 Constraint 335 1295 0.8000 1.0000 2.0000 0.0000 Constraint 335 1288 0.8000 1.0000 2.0000 0.0000 Constraint 335 1281 0.8000 1.0000 2.0000 0.0000 Constraint 335 1272 0.8000 1.0000 2.0000 0.0000 Constraint 335 1264 0.8000 1.0000 2.0000 0.0000 Constraint 335 1256 0.8000 1.0000 2.0000 0.0000 Constraint 335 1244 0.8000 1.0000 2.0000 0.0000 Constraint 335 1235 0.8000 1.0000 2.0000 0.0000 Constraint 335 1225 0.8000 1.0000 2.0000 0.0000 Constraint 335 1213 0.8000 1.0000 2.0000 0.0000 Constraint 335 1208 0.8000 1.0000 2.0000 0.0000 Constraint 335 1201 0.8000 1.0000 2.0000 0.0000 Constraint 335 1192 0.8000 1.0000 2.0000 0.0000 Constraint 335 1186 0.8000 1.0000 2.0000 0.0000 Constraint 335 1174 0.8000 1.0000 2.0000 0.0000 Constraint 335 1168 0.8000 1.0000 2.0000 0.0000 Constraint 335 1144 0.8000 1.0000 2.0000 0.0000 Constraint 335 1133 0.8000 1.0000 2.0000 0.0000 Constraint 335 1066 0.8000 1.0000 2.0000 0.0000 Constraint 335 1051 0.8000 1.0000 2.0000 0.0000 Constraint 335 1039 0.8000 1.0000 2.0000 0.0000 Constraint 335 1031 0.8000 1.0000 2.0000 0.0000 Constraint 335 1024 0.8000 1.0000 2.0000 0.0000 Constraint 335 1015 0.8000 1.0000 2.0000 0.0000 Constraint 335 1007 0.8000 1.0000 2.0000 0.0000 Constraint 335 998 0.8000 1.0000 2.0000 0.0000 Constraint 335 990 0.8000 1.0000 2.0000 0.0000 Constraint 335 981 0.8000 1.0000 2.0000 0.0000 Constraint 335 973 0.8000 1.0000 2.0000 0.0000 Constraint 335 967 0.8000 1.0000 2.0000 0.0000 Constraint 335 958 0.8000 1.0000 2.0000 0.0000 Constraint 335 951 0.8000 1.0000 2.0000 0.0000 Constraint 335 944 0.8000 1.0000 2.0000 0.0000 Constraint 335 939 0.8000 1.0000 2.0000 0.0000 Constraint 335 907 0.8000 1.0000 2.0000 0.0000 Constraint 335 822 0.8000 1.0000 2.0000 0.0000 Constraint 335 805 0.8000 1.0000 2.0000 0.0000 Constraint 335 781 0.8000 1.0000 2.0000 0.0000 Constraint 335 773 0.8000 1.0000 2.0000 0.0000 Constraint 335 723 0.8000 1.0000 2.0000 0.0000 Constraint 335 716 0.8000 1.0000 2.0000 0.0000 Constraint 335 700 0.8000 1.0000 2.0000 0.0000 Constraint 335 683 0.8000 1.0000 2.0000 0.0000 Constraint 335 669 0.8000 1.0000 2.0000 0.0000 Constraint 335 660 0.8000 1.0000 2.0000 0.0000 Constraint 335 632 0.8000 1.0000 2.0000 0.0000 Constraint 335 624 0.8000 1.0000 2.0000 0.0000 Constraint 335 499 0.8000 1.0000 2.0000 0.0000 Constraint 335 488 0.8000 1.0000 2.0000 0.0000 Constraint 335 402 0.8000 1.0000 2.0000 0.0000 Constraint 335 394 0.8000 1.0000 2.0000 0.0000 Constraint 335 386 0.8000 1.0000 2.0000 0.0000 Constraint 335 380 0.8000 1.0000 2.0000 0.0000 Constraint 335 373 0.8000 1.0000 2.0000 0.0000 Constraint 335 362 0.8000 1.0000 2.0000 0.0000 Constraint 335 351 0.8000 1.0000 2.0000 0.0000 Constraint 335 343 0.8000 1.0000 2.0000 0.0000 Constraint 325 1476 0.8000 1.0000 2.0000 0.0000 Constraint 325 1467 0.8000 1.0000 2.0000 0.0000 Constraint 325 1459 0.8000 1.0000 2.0000 0.0000 Constraint 325 1451 0.8000 1.0000 2.0000 0.0000 Constraint 325 1442 0.8000 1.0000 2.0000 0.0000 Constraint 325 1430 0.8000 1.0000 2.0000 0.0000 Constraint 325 1421 0.8000 1.0000 2.0000 0.0000 Constraint 325 1413 0.8000 1.0000 2.0000 0.0000 Constraint 325 1402 0.8000 1.0000 2.0000 0.0000 Constraint 325 1386 0.8000 1.0000 2.0000 0.0000 Constraint 325 1381 0.8000 1.0000 2.0000 0.0000 Constraint 325 1373 0.8000 1.0000 2.0000 0.0000 Constraint 325 1362 0.8000 1.0000 2.0000 0.0000 Constraint 325 1329 0.8000 1.0000 2.0000 0.0000 Constraint 325 1318 0.8000 1.0000 2.0000 0.0000 Constraint 325 1306 0.8000 1.0000 2.0000 0.0000 Constraint 325 1295 0.8000 1.0000 2.0000 0.0000 Constraint 325 1288 0.8000 1.0000 2.0000 0.0000 Constraint 325 1281 0.8000 1.0000 2.0000 0.0000 Constraint 325 1272 0.8000 1.0000 2.0000 0.0000 Constraint 325 1264 0.8000 1.0000 2.0000 0.0000 Constraint 325 1256 0.8000 1.0000 2.0000 0.0000 Constraint 325 1244 0.8000 1.0000 2.0000 0.0000 Constraint 325 1235 0.8000 1.0000 2.0000 0.0000 Constraint 325 1225 0.8000 1.0000 2.0000 0.0000 Constraint 325 1213 0.8000 1.0000 2.0000 0.0000 Constraint 325 1208 0.8000 1.0000 2.0000 0.0000 Constraint 325 1201 0.8000 1.0000 2.0000 0.0000 Constraint 325 1192 0.8000 1.0000 2.0000 0.0000 Constraint 325 1186 0.8000 1.0000 2.0000 0.0000 Constraint 325 1174 0.8000 1.0000 2.0000 0.0000 Constraint 325 1168 0.8000 1.0000 2.0000 0.0000 Constraint 325 1159 0.8000 1.0000 2.0000 0.0000 Constraint 325 1150 0.8000 1.0000 2.0000 0.0000 Constraint 325 1133 0.8000 1.0000 2.0000 0.0000 Constraint 325 1124 0.8000 1.0000 2.0000 0.0000 Constraint 325 1106 0.8000 1.0000 2.0000 0.0000 Constraint 325 1075 0.8000 1.0000 2.0000 0.0000 Constraint 325 1051 0.8000 1.0000 2.0000 0.0000 Constraint 325 1039 0.8000 1.0000 2.0000 0.0000 Constraint 325 1031 0.8000 1.0000 2.0000 0.0000 Constraint 325 1015 0.8000 1.0000 2.0000 0.0000 Constraint 325 1007 0.8000 1.0000 2.0000 0.0000 Constraint 325 967 0.8000 1.0000 2.0000 0.0000 Constraint 325 958 0.8000 1.0000 2.0000 0.0000 Constraint 325 939 0.8000 1.0000 2.0000 0.0000 Constraint 325 931 0.8000 1.0000 2.0000 0.0000 Constraint 325 915 0.8000 1.0000 2.0000 0.0000 Constraint 325 907 0.8000 1.0000 2.0000 0.0000 Constraint 325 900 0.8000 1.0000 2.0000 0.0000 Constraint 325 892 0.8000 1.0000 2.0000 0.0000 Constraint 325 884 0.8000 1.0000 2.0000 0.0000 Constraint 325 794 0.8000 1.0000 2.0000 0.0000 Constraint 325 773 0.8000 1.0000 2.0000 0.0000 Constraint 325 756 0.8000 1.0000 2.0000 0.0000 Constraint 325 742 0.8000 1.0000 2.0000 0.0000 Constraint 325 723 0.8000 1.0000 2.0000 0.0000 Constraint 325 716 0.8000 1.0000 2.0000 0.0000 Constraint 325 669 0.8000 1.0000 2.0000 0.0000 Constraint 325 660 0.8000 1.0000 2.0000 0.0000 Constraint 325 510 0.8000 1.0000 2.0000 0.0000 Constraint 325 417 0.8000 1.0000 2.0000 0.0000 Constraint 325 408 0.8000 1.0000 2.0000 0.0000 Constraint 325 386 0.8000 1.0000 2.0000 0.0000 Constraint 325 380 0.8000 1.0000 2.0000 0.0000 Constraint 325 373 0.8000 1.0000 2.0000 0.0000 Constraint 325 362 0.8000 1.0000 2.0000 0.0000 Constraint 325 351 0.8000 1.0000 2.0000 0.0000 Constraint 325 343 0.8000 1.0000 2.0000 0.0000 Constraint 325 335 0.8000 1.0000 2.0000 0.0000 Constraint 317 1476 0.8000 1.0000 2.0000 0.0000 Constraint 317 1467 0.8000 1.0000 2.0000 0.0000 Constraint 317 1459 0.8000 1.0000 2.0000 0.0000 Constraint 317 1451 0.8000 1.0000 2.0000 0.0000 Constraint 317 1442 0.8000 1.0000 2.0000 0.0000 Constraint 317 1421 0.8000 1.0000 2.0000 0.0000 Constraint 317 1413 0.8000 1.0000 2.0000 0.0000 Constraint 317 1402 0.8000 1.0000 2.0000 0.0000 Constraint 317 1386 0.8000 1.0000 2.0000 0.0000 Constraint 317 1381 0.8000 1.0000 2.0000 0.0000 Constraint 317 1373 0.8000 1.0000 2.0000 0.0000 Constraint 317 1362 0.8000 1.0000 2.0000 0.0000 Constraint 317 1347 0.8000 1.0000 2.0000 0.0000 Constraint 317 1339 0.8000 1.0000 2.0000 0.0000 Constraint 317 1329 0.8000 1.0000 2.0000 0.0000 Constraint 317 1306 0.8000 1.0000 2.0000 0.0000 Constraint 317 1295 0.8000 1.0000 2.0000 0.0000 Constraint 317 1288 0.8000 1.0000 2.0000 0.0000 Constraint 317 1281 0.8000 1.0000 2.0000 0.0000 Constraint 317 1272 0.8000 1.0000 2.0000 0.0000 Constraint 317 1264 0.8000 1.0000 2.0000 0.0000 Constraint 317 1256 0.8000 1.0000 2.0000 0.0000 Constraint 317 1244 0.8000 1.0000 2.0000 0.0000 Constraint 317 1235 0.8000 1.0000 2.0000 0.0000 Constraint 317 1208 0.8000 1.0000 2.0000 0.0000 Constraint 317 1201 0.8000 1.0000 2.0000 0.0000 Constraint 317 1174 0.8000 1.0000 2.0000 0.0000 Constraint 317 1168 0.8000 1.0000 2.0000 0.0000 Constraint 317 1159 0.8000 1.0000 2.0000 0.0000 Constraint 317 1150 0.8000 1.0000 2.0000 0.0000 Constraint 317 1133 0.8000 1.0000 2.0000 0.0000 Constraint 317 1124 0.8000 1.0000 2.0000 0.0000 Constraint 317 1095 0.8000 1.0000 2.0000 0.0000 Constraint 317 1075 0.8000 1.0000 2.0000 0.0000 Constraint 317 1066 0.8000 1.0000 2.0000 0.0000 Constraint 317 1051 0.8000 1.0000 2.0000 0.0000 Constraint 317 1039 0.8000 1.0000 2.0000 0.0000 Constraint 317 1024 0.8000 1.0000 2.0000 0.0000 Constraint 317 1015 0.8000 1.0000 2.0000 0.0000 Constraint 317 1007 0.8000 1.0000 2.0000 0.0000 Constraint 317 998 0.8000 1.0000 2.0000 0.0000 Constraint 317 990 0.8000 1.0000 2.0000 0.0000 Constraint 317 981 0.8000 1.0000 2.0000 0.0000 Constraint 317 939 0.8000 1.0000 2.0000 0.0000 Constraint 317 931 0.8000 1.0000 2.0000 0.0000 Constraint 317 915 0.8000 1.0000 2.0000 0.0000 Constraint 317 907 0.8000 1.0000 2.0000 0.0000 Constraint 317 900 0.8000 1.0000 2.0000 0.0000 Constraint 317 892 0.8000 1.0000 2.0000 0.0000 Constraint 317 789 0.8000 1.0000 2.0000 0.0000 Constraint 317 781 0.8000 1.0000 2.0000 0.0000 Constraint 317 773 0.8000 1.0000 2.0000 0.0000 Constraint 317 762 0.8000 1.0000 2.0000 0.0000 Constraint 317 756 0.8000 1.0000 2.0000 0.0000 Constraint 317 742 0.8000 1.0000 2.0000 0.0000 Constraint 317 728 0.8000 1.0000 2.0000 0.0000 Constraint 317 723 0.8000 1.0000 2.0000 0.0000 Constraint 317 716 0.8000 1.0000 2.0000 0.0000 Constraint 317 708 0.8000 1.0000 2.0000 0.0000 Constraint 317 700 0.8000 1.0000 2.0000 0.0000 Constraint 317 691 0.8000 1.0000 2.0000 0.0000 Constraint 317 649 0.8000 1.0000 2.0000 0.0000 Constraint 317 641 0.8000 1.0000 2.0000 0.0000 Constraint 317 618 0.8000 1.0000 2.0000 0.0000 Constraint 317 481 0.8000 1.0000 2.0000 0.0000 Constraint 317 446 0.8000 1.0000 2.0000 0.0000 Constraint 317 417 0.8000 1.0000 2.0000 0.0000 Constraint 317 402 0.8000 1.0000 2.0000 0.0000 Constraint 317 386 0.8000 1.0000 2.0000 0.0000 Constraint 317 380 0.8000 1.0000 2.0000 0.0000 Constraint 317 373 0.8000 1.0000 2.0000 0.0000 Constraint 317 362 0.8000 1.0000 2.0000 0.0000 Constraint 317 351 0.8000 1.0000 2.0000 0.0000 Constraint 317 343 0.8000 1.0000 2.0000 0.0000 Constraint 317 335 0.8000 1.0000 2.0000 0.0000 Constraint 317 325 0.8000 1.0000 2.0000 0.0000 Constraint 309 1476 0.8000 1.0000 2.0000 0.0000 Constraint 309 1467 0.8000 1.0000 2.0000 0.0000 Constraint 309 1459 0.8000 1.0000 2.0000 0.0000 Constraint 309 1451 0.8000 1.0000 2.0000 0.0000 Constraint 309 1442 0.8000 1.0000 2.0000 0.0000 Constraint 309 1413 0.8000 1.0000 2.0000 0.0000 Constraint 309 1402 0.8000 1.0000 2.0000 0.0000 Constraint 309 1386 0.8000 1.0000 2.0000 0.0000 Constraint 309 1362 0.8000 1.0000 2.0000 0.0000 Constraint 309 1354 0.8000 1.0000 2.0000 0.0000 Constraint 309 1347 0.8000 1.0000 2.0000 0.0000 Constraint 309 1339 0.8000 1.0000 2.0000 0.0000 Constraint 309 1329 0.8000 1.0000 2.0000 0.0000 Constraint 309 1306 0.8000 1.0000 2.0000 0.0000 Constraint 309 1295 0.8000 1.0000 2.0000 0.0000 Constraint 309 1288 0.8000 1.0000 2.0000 0.0000 Constraint 309 1281 0.8000 1.0000 2.0000 0.0000 Constraint 309 1272 0.8000 1.0000 2.0000 0.0000 Constraint 309 1264 0.8000 1.0000 2.0000 0.0000 Constraint 309 1256 0.8000 1.0000 2.0000 0.0000 Constraint 309 1244 0.8000 1.0000 2.0000 0.0000 Constraint 309 1235 0.8000 1.0000 2.0000 0.0000 Constraint 309 1225 0.8000 1.0000 2.0000 0.0000 Constraint 309 1213 0.8000 1.0000 2.0000 0.0000 Constraint 309 1208 0.8000 1.0000 2.0000 0.0000 Constraint 309 1201 0.8000 1.0000 2.0000 0.0000 Constraint 309 1192 0.8000 1.0000 2.0000 0.0000 Constraint 309 1186 0.8000 1.0000 2.0000 0.0000 Constraint 309 1174 0.8000 1.0000 2.0000 0.0000 Constraint 309 1168 0.8000 1.0000 2.0000 0.0000 Constraint 309 1159 0.8000 1.0000 2.0000 0.0000 Constraint 309 1150 0.8000 1.0000 2.0000 0.0000 Constraint 309 1144 0.8000 1.0000 2.0000 0.0000 Constraint 309 1133 0.8000 1.0000 2.0000 0.0000 Constraint 309 1124 0.8000 1.0000 2.0000 0.0000 Constraint 309 1075 0.8000 1.0000 2.0000 0.0000 Constraint 309 1066 0.8000 1.0000 2.0000 0.0000 Constraint 309 1051 0.8000 1.0000 2.0000 0.0000 Constraint 309 1039 0.8000 1.0000 2.0000 0.0000 Constraint 309 1031 0.8000 1.0000 2.0000 0.0000 Constraint 309 1007 0.8000 1.0000 2.0000 0.0000 Constraint 309 990 0.8000 1.0000 2.0000 0.0000 Constraint 309 981 0.8000 1.0000 2.0000 0.0000 Constraint 309 973 0.8000 1.0000 2.0000 0.0000 Constraint 309 967 0.8000 1.0000 2.0000 0.0000 Constraint 309 958 0.8000 1.0000 2.0000 0.0000 Constraint 309 944 0.8000 1.0000 2.0000 0.0000 Constraint 309 939 0.8000 1.0000 2.0000 0.0000 Constraint 309 931 0.8000 1.0000 2.0000 0.0000 Constraint 309 924 0.8000 1.0000 2.0000 0.0000 Constraint 309 915 0.8000 1.0000 2.0000 0.0000 Constraint 309 907 0.8000 1.0000 2.0000 0.0000 Constraint 309 892 0.8000 1.0000 2.0000 0.0000 Constraint 309 884 0.8000 1.0000 2.0000 0.0000 Constraint 309 756 0.8000 1.0000 2.0000 0.0000 Constraint 309 742 0.8000 1.0000 2.0000 0.0000 Constraint 309 728 0.8000 1.0000 2.0000 0.0000 Constraint 309 723 0.8000 1.0000 2.0000 0.0000 Constraint 309 716 0.8000 1.0000 2.0000 0.0000 Constraint 309 708 0.8000 1.0000 2.0000 0.0000 Constraint 309 700 0.8000 1.0000 2.0000 0.0000 Constraint 309 691 0.8000 1.0000 2.0000 0.0000 Constraint 309 641 0.8000 1.0000 2.0000 0.0000 Constraint 309 618 0.8000 1.0000 2.0000 0.0000 Constraint 309 481 0.8000 1.0000 2.0000 0.0000 Constraint 309 417 0.8000 1.0000 2.0000 0.0000 Constraint 309 386 0.8000 1.0000 2.0000 0.0000 Constraint 309 380 0.8000 1.0000 2.0000 0.0000 Constraint 309 373 0.8000 1.0000 2.0000 0.0000 Constraint 309 362 0.8000 1.0000 2.0000 0.0000 Constraint 309 351 0.8000 1.0000 2.0000 0.0000 Constraint 309 343 0.8000 1.0000 2.0000 0.0000 Constraint 309 335 0.8000 1.0000 2.0000 0.0000 Constraint 309 325 0.8000 1.0000 2.0000 0.0000 Constraint 309 317 0.8000 1.0000 2.0000 0.0000 Constraint 297 1476 0.8000 1.0000 2.0000 0.0000 Constraint 297 1467 0.8000 1.0000 2.0000 0.0000 Constraint 297 1451 0.8000 1.0000 2.0000 0.0000 Constraint 297 1442 0.8000 1.0000 2.0000 0.0000 Constraint 297 1421 0.8000 1.0000 2.0000 0.0000 Constraint 297 1413 0.8000 1.0000 2.0000 0.0000 Constraint 297 1402 0.8000 1.0000 2.0000 0.0000 Constraint 297 1395 0.8000 1.0000 2.0000 0.0000 Constraint 297 1386 0.8000 1.0000 2.0000 0.0000 Constraint 297 1381 0.8000 1.0000 2.0000 0.0000 Constraint 297 1373 0.8000 1.0000 2.0000 0.0000 Constraint 297 1362 0.8000 1.0000 2.0000 0.0000 Constraint 297 1354 0.8000 1.0000 2.0000 0.0000 Constraint 297 1347 0.8000 1.0000 2.0000 0.0000 Constraint 297 1339 0.8000 1.0000 2.0000 0.0000 Constraint 297 1329 0.8000 1.0000 2.0000 0.0000 Constraint 297 1288 0.8000 1.0000 2.0000 0.0000 Constraint 297 1281 0.8000 1.0000 2.0000 0.0000 Constraint 297 1272 0.8000 1.0000 2.0000 0.0000 Constraint 297 1264 0.8000 1.0000 2.0000 0.0000 Constraint 297 1244 0.8000 1.0000 2.0000 0.0000 Constraint 297 1235 0.8000 1.0000 2.0000 0.0000 Constraint 297 1225 0.8000 1.0000 2.0000 0.0000 Constraint 297 1208 0.8000 1.0000 2.0000 0.0000 Constraint 297 1201 0.8000 1.0000 2.0000 0.0000 Constraint 297 1192 0.8000 1.0000 2.0000 0.0000 Constraint 297 1186 0.8000 1.0000 2.0000 0.0000 Constraint 297 1174 0.8000 1.0000 2.0000 0.0000 Constraint 297 1168 0.8000 1.0000 2.0000 0.0000 Constraint 297 1159 0.8000 1.0000 2.0000 0.0000 Constraint 297 1150 0.8000 1.0000 2.0000 0.0000 Constraint 297 1144 0.8000 1.0000 2.0000 0.0000 Constraint 297 1133 0.8000 1.0000 2.0000 0.0000 Constraint 297 1124 0.8000 1.0000 2.0000 0.0000 Constraint 297 1066 0.8000 1.0000 2.0000 0.0000 Constraint 297 1051 0.8000 1.0000 2.0000 0.0000 Constraint 297 1039 0.8000 1.0000 2.0000 0.0000 Constraint 297 1031 0.8000 1.0000 2.0000 0.0000 Constraint 297 1024 0.8000 1.0000 2.0000 0.0000 Constraint 297 998 0.8000 1.0000 2.0000 0.0000 Constraint 297 990 0.8000 1.0000 2.0000 0.0000 Constraint 297 981 0.8000 1.0000 2.0000 0.0000 Constraint 297 967 0.8000 1.0000 2.0000 0.0000 Constraint 297 958 0.8000 1.0000 2.0000 0.0000 Constraint 297 939 0.8000 1.0000 2.0000 0.0000 Constraint 297 915 0.8000 1.0000 2.0000 0.0000 Constraint 297 907 0.8000 1.0000 2.0000 0.0000 Constraint 297 900 0.8000 1.0000 2.0000 0.0000 Constraint 297 892 0.8000 1.0000 2.0000 0.0000 Constraint 297 884 0.8000 1.0000 2.0000 0.0000 Constraint 297 871 0.8000 1.0000 2.0000 0.0000 Constraint 297 789 0.8000 1.0000 2.0000 0.0000 Constraint 297 773 0.8000 1.0000 2.0000 0.0000 Constraint 297 762 0.8000 1.0000 2.0000 0.0000 Constraint 297 756 0.8000 1.0000 2.0000 0.0000 Constraint 297 742 0.8000 1.0000 2.0000 0.0000 Constraint 297 728 0.8000 1.0000 2.0000 0.0000 Constraint 297 723 0.8000 1.0000 2.0000 0.0000 Constraint 297 716 0.8000 1.0000 2.0000 0.0000 Constraint 297 708 0.8000 1.0000 2.0000 0.0000 Constraint 297 700 0.8000 1.0000 2.0000 0.0000 Constraint 297 691 0.8000 1.0000 2.0000 0.0000 Constraint 297 683 0.8000 1.0000 2.0000 0.0000 Constraint 297 674 0.8000 1.0000 2.0000 0.0000 Constraint 297 632 0.8000 1.0000 2.0000 0.0000 Constraint 297 624 0.8000 1.0000 2.0000 0.0000 Constraint 297 618 0.8000 1.0000 2.0000 0.0000 Constraint 297 610 0.8000 1.0000 2.0000 0.0000 Constraint 297 417 0.8000 1.0000 2.0000 0.0000 Constraint 297 362 0.8000 1.0000 2.0000 0.0000 Constraint 297 351 0.8000 1.0000 2.0000 0.0000 Constraint 297 343 0.8000 1.0000 2.0000 0.0000 Constraint 297 335 0.8000 1.0000 2.0000 0.0000 Constraint 297 325 0.8000 1.0000 2.0000 0.0000 Constraint 297 317 0.8000 1.0000 2.0000 0.0000 Constraint 297 309 0.8000 1.0000 2.0000 0.0000 Constraint 291 1476 0.8000 1.0000 2.0000 0.0000 Constraint 291 1467 0.8000 1.0000 2.0000 0.0000 Constraint 291 1459 0.8000 1.0000 2.0000 0.0000 Constraint 291 1451 0.8000 1.0000 2.0000 0.0000 Constraint 291 1442 0.8000 1.0000 2.0000 0.0000 Constraint 291 1430 0.8000 1.0000 2.0000 0.0000 Constraint 291 1421 0.8000 1.0000 2.0000 0.0000 Constraint 291 1413 0.8000 1.0000 2.0000 0.0000 Constraint 291 1402 0.8000 1.0000 2.0000 0.0000 Constraint 291 1395 0.8000 1.0000 2.0000 0.0000 Constraint 291 1386 0.8000 1.0000 2.0000 0.0000 Constraint 291 1381 0.8000 1.0000 2.0000 0.0000 Constraint 291 1373 0.8000 1.0000 2.0000 0.0000 Constraint 291 1362 0.8000 1.0000 2.0000 0.0000 Constraint 291 1354 0.8000 1.0000 2.0000 0.0000 Constraint 291 1347 0.8000 1.0000 2.0000 0.0000 Constraint 291 1339 0.8000 1.0000 2.0000 0.0000 Constraint 291 1329 0.8000 1.0000 2.0000 0.0000 Constraint 291 1288 0.8000 1.0000 2.0000 0.0000 Constraint 291 1281 0.8000 1.0000 2.0000 0.0000 Constraint 291 1272 0.8000 1.0000 2.0000 0.0000 Constraint 291 1264 0.8000 1.0000 2.0000 0.0000 Constraint 291 1256 0.8000 1.0000 2.0000 0.0000 Constraint 291 1244 0.8000 1.0000 2.0000 0.0000 Constraint 291 1235 0.8000 1.0000 2.0000 0.0000 Constraint 291 1225 0.8000 1.0000 2.0000 0.0000 Constraint 291 1213 0.8000 1.0000 2.0000 0.0000 Constraint 291 1208 0.8000 1.0000 2.0000 0.0000 Constraint 291 1201 0.8000 1.0000 2.0000 0.0000 Constraint 291 1192 0.8000 1.0000 2.0000 0.0000 Constraint 291 1186 0.8000 1.0000 2.0000 0.0000 Constraint 291 1174 0.8000 1.0000 2.0000 0.0000 Constraint 291 1168 0.8000 1.0000 2.0000 0.0000 Constraint 291 1159 0.8000 1.0000 2.0000 0.0000 Constraint 291 1150 0.8000 1.0000 2.0000 0.0000 Constraint 291 1144 0.8000 1.0000 2.0000 0.0000 Constraint 291 1133 0.8000 1.0000 2.0000 0.0000 Constraint 291 1124 0.8000 1.0000 2.0000 0.0000 Constraint 291 1066 0.8000 1.0000 2.0000 0.0000 Constraint 291 1051 0.8000 1.0000 2.0000 0.0000 Constraint 291 1039 0.8000 1.0000 2.0000 0.0000 Constraint 291 1024 0.8000 1.0000 2.0000 0.0000 Constraint 291 1015 0.8000 1.0000 2.0000 0.0000 Constraint 291 1007 0.8000 1.0000 2.0000 0.0000 Constraint 291 998 0.8000 1.0000 2.0000 0.0000 Constraint 291 990 0.8000 1.0000 2.0000 0.0000 Constraint 291 981 0.8000 1.0000 2.0000 0.0000 Constraint 291 973 0.8000 1.0000 2.0000 0.0000 Constraint 291 967 0.8000 1.0000 2.0000 0.0000 Constraint 291 958 0.8000 1.0000 2.0000 0.0000 Constraint 291 944 0.8000 1.0000 2.0000 0.0000 Constraint 291 939 0.8000 1.0000 2.0000 0.0000 Constraint 291 931 0.8000 1.0000 2.0000 0.0000 Constraint 291 915 0.8000 1.0000 2.0000 0.0000 Constraint 291 907 0.8000 1.0000 2.0000 0.0000 Constraint 291 900 0.8000 1.0000 2.0000 0.0000 Constraint 291 892 0.8000 1.0000 2.0000 0.0000 Constraint 291 884 0.8000 1.0000 2.0000 0.0000 Constraint 291 871 0.8000 1.0000 2.0000 0.0000 Constraint 291 864 0.8000 1.0000 2.0000 0.0000 Constraint 291 852 0.8000 1.0000 2.0000 0.0000 Constraint 291 756 0.8000 1.0000 2.0000 0.0000 Constraint 291 742 0.8000 1.0000 2.0000 0.0000 Constraint 291 728 0.8000 1.0000 2.0000 0.0000 Constraint 291 723 0.8000 1.0000 2.0000 0.0000 Constraint 291 716 0.8000 1.0000 2.0000 0.0000 Constraint 291 708 0.8000 1.0000 2.0000 0.0000 Constraint 291 700 0.8000 1.0000 2.0000 0.0000 Constraint 291 691 0.8000 1.0000 2.0000 0.0000 Constraint 291 660 0.8000 1.0000 2.0000 0.0000 Constraint 291 632 0.8000 1.0000 2.0000 0.0000 Constraint 291 624 0.8000 1.0000 2.0000 0.0000 Constraint 291 618 0.8000 1.0000 2.0000 0.0000 Constraint 291 610 0.8000 1.0000 2.0000 0.0000 Constraint 291 472 0.8000 1.0000 2.0000 0.0000 Constraint 291 446 0.8000 1.0000 2.0000 0.0000 Constraint 291 422 0.8000 1.0000 2.0000 0.0000 Constraint 291 417 0.8000 1.0000 2.0000 0.0000 Constraint 291 351 0.8000 1.0000 2.0000 0.0000 Constraint 291 343 0.8000 1.0000 2.0000 0.0000 Constraint 291 335 0.8000 1.0000 2.0000 0.0000 Constraint 291 325 0.8000 1.0000 2.0000 0.0000 Constraint 291 317 0.8000 1.0000 2.0000 0.0000 Constraint 291 309 0.8000 1.0000 2.0000 0.0000 Constraint 291 297 0.8000 1.0000 2.0000 0.0000 Constraint 282 1476 0.8000 1.0000 2.0000 0.0000 Constraint 282 1467 0.8000 1.0000 2.0000 0.0000 Constraint 282 1442 0.8000 1.0000 2.0000 0.0000 Constraint 282 1413 0.8000 1.0000 2.0000 0.0000 Constraint 282 1381 0.8000 1.0000 2.0000 0.0000 Constraint 282 1373 0.8000 1.0000 2.0000 0.0000 Constraint 282 1362 0.8000 1.0000 2.0000 0.0000 Constraint 282 1354 0.8000 1.0000 2.0000 0.0000 Constraint 282 1347 0.8000 1.0000 2.0000 0.0000 Constraint 282 1339 0.8000 1.0000 2.0000 0.0000 Constraint 282 1329 0.8000 1.0000 2.0000 0.0000 Constraint 282 1318 0.8000 1.0000 2.0000 0.0000 Constraint 282 1288 0.8000 1.0000 2.0000 0.0000 Constraint 282 1281 0.8000 1.0000 2.0000 0.0000 Constraint 282 1272 0.8000 1.0000 2.0000 0.0000 Constraint 282 1264 0.8000 1.0000 2.0000 0.0000 Constraint 282 1256 0.8000 1.0000 2.0000 0.0000 Constraint 282 1244 0.8000 1.0000 2.0000 0.0000 Constraint 282 1235 0.8000 1.0000 2.0000 0.0000 Constraint 282 1225 0.8000 1.0000 2.0000 0.0000 Constraint 282 1213 0.8000 1.0000 2.0000 0.0000 Constraint 282 1208 0.8000 1.0000 2.0000 0.0000 Constraint 282 1201 0.8000 1.0000 2.0000 0.0000 Constraint 282 1192 0.8000 1.0000 2.0000 0.0000 Constraint 282 1186 0.8000 1.0000 2.0000 0.0000 Constraint 282 1174 0.8000 1.0000 2.0000 0.0000 Constraint 282 1168 0.8000 1.0000 2.0000 0.0000 Constraint 282 1159 0.8000 1.0000 2.0000 0.0000 Constraint 282 1150 0.8000 1.0000 2.0000 0.0000 Constraint 282 1144 0.8000 1.0000 2.0000 0.0000 Constraint 282 1133 0.8000 1.0000 2.0000 0.0000 Constraint 282 1124 0.8000 1.0000 2.0000 0.0000 Constraint 282 1106 0.8000 1.0000 2.0000 0.0000 Constraint 282 1095 0.8000 1.0000 2.0000 0.0000 Constraint 282 1051 0.8000 1.0000 2.0000 0.0000 Constraint 282 1039 0.8000 1.0000 2.0000 0.0000 Constraint 282 1031 0.8000 1.0000 2.0000 0.0000 Constraint 282 1024 0.8000 1.0000 2.0000 0.0000 Constraint 282 1015 0.8000 1.0000 2.0000 0.0000 Constraint 282 1007 0.8000 1.0000 2.0000 0.0000 Constraint 282 998 0.8000 1.0000 2.0000 0.0000 Constraint 282 990 0.8000 1.0000 2.0000 0.0000 Constraint 282 967 0.8000 1.0000 2.0000 0.0000 Constraint 282 958 0.8000 1.0000 2.0000 0.0000 Constraint 282 944 0.8000 1.0000 2.0000 0.0000 Constraint 282 939 0.8000 1.0000 2.0000 0.0000 Constraint 282 931 0.8000 1.0000 2.0000 0.0000 Constraint 282 924 0.8000 1.0000 2.0000 0.0000 Constraint 282 915 0.8000 1.0000 2.0000 0.0000 Constraint 282 907 0.8000 1.0000 2.0000 0.0000 Constraint 282 900 0.8000 1.0000 2.0000 0.0000 Constraint 282 892 0.8000 1.0000 2.0000 0.0000 Constraint 282 884 0.8000 1.0000 2.0000 0.0000 Constraint 282 871 0.8000 1.0000 2.0000 0.0000 Constraint 282 864 0.8000 1.0000 2.0000 0.0000 Constraint 282 852 0.8000 1.0000 2.0000 0.0000 Constraint 282 822 0.8000 1.0000 2.0000 0.0000 Constraint 282 794 0.8000 1.0000 2.0000 0.0000 Constraint 282 781 0.8000 1.0000 2.0000 0.0000 Constraint 282 756 0.8000 1.0000 2.0000 0.0000 Constraint 282 742 0.8000 1.0000 2.0000 0.0000 Constraint 282 728 0.8000 1.0000 2.0000 0.0000 Constraint 282 723 0.8000 1.0000 2.0000 0.0000 Constraint 282 716 0.8000 1.0000 2.0000 0.0000 Constraint 282 708 0.8000 1.0000 2.0000 0.0000 Constraint 282 700 0.8000 1.0000 2.0000 0.0000 Constraint 282 691 0.8000 1.0000 2.0000 0.0000 Constraint 282 683 0.8000 1.0000 2.0000 0.0000 Constraint 282 674 0.8000 1.0000 2.0000 0.0000 Constraint 282 669 0.8000 1.0000 2.0000 0.0000 Constraint 282 660 0.8000 1.0000 2.0000 0.0000 Constraint 282 632 0.8000 1.0000 2.0000 0.0000 Constraint 282 618 0.8000 1.0000 2.0000 0.0000 Constraint 282 610 0.8000 1.0000 2.0000 0.0000 Constraint 282 602 0.8000 1.0000 2.0000 0.0000 Constraint 282 596 0.8000 1.0000 2.0000 0.0000 Constraint 282 532 0.8000 1.0000 2.0000 0.0000 Constraint 282 481 0.8000 1.0000 2.0000 0.0000 Constraint 282 472 0.8000 1.0000 2.0000 0.0000 Constraint 282 446 0.8000 1.0000 2.0000 0.0000 Constraint 282 439 0.8000 1.0000 2.0000 0.0000 Constraint 282 431 0.8000 1.0000 2.0000 0.0000 Constraint 282 422 0.8000 1.0000 2.0000 0.0000 Constraint 282 417 0.8000 1.0000 2.0000 0.0000 Constraint 282 408 0.8000 1.0000 2.0000 0.0000 Constraint 282 394 0.8000 1.0000 2.0000 0.0000 Constraint 282 362 0.8000 1.0000 2.0000 0.0000 Constraint 282 343 0.8000 1.0000 2.0000 0.0000 Constraint 282 335 0.8000 1.0000 2.0000 0.0000 Constraint 282 325 0.8000 1.0000 2.0000 0.0000 Constraint 282 317 0.8000 1.0000 2.0000 0.0000 Constraint 282 309 0.8000 1.0000 2.0000 0.0000 Constraint 282 297 0.8000 1.0000 2.0000 0.0000 Constraint 282 291 0.8000 1.0000 2.0000 0.0000 Constraint 275 1476 0.8000 1.0000 2.0000 0.0000 Constraint 275 1467 0.8000 1.0000 2.0000 0.0000 Constraint 275 1459 0.8000 1.0000 2.0000 0.0000 Constraint 275 1451 0.8000 1.0000 2.0000 0.0000 Constraint 275 1442 0.8000 1.0000 2.0000 0.0000 Constraint 275 1430 0.8000 1.0000 2.0000 0.0000 Constraint 275 1421 0.8000 1.0000 2.0000 0.0000 Constraint 275 1413 0.8000 1.0000 2.0000 0.0000 Constraint 275 1373 0.8000 1.0000 2.0000 0.0000 Constraint 275 1362 0.8000 1.0000 2.0000 0.0000 Constraint 275 1354 0.8000 1.0000 2.0000 0.0000 Constraint 275 1347 0.8000 1.0000 2.0000 0.0000 Constraint 275 1339 0.8000 1.0000 2.0000 0.0000 Constraint 275 1329 0.8000 1.0000 2.0000 0.0000 Constraint 275 1318 0.8000 1.0000 2.0000 0.0000 Constraint 275 1306 0.8000 1.0000 2.0000 0.0000 Constraint 275 1288 0.8000 1.0000 2.0000 0.0000 Constraint 275 1281 0.8000 1.0000 2.0000 0.0000 Constraint 275 1272 0.8000 1.0000 2.0000 0.0000 Constraint 275 1264 0.8000 1.0000 2.0000 0.0000 Constraint 275 1244 0.8000 1.0000 2.0000 0.0000 Constraint 275 1235 0.8000 1.0000 2.0000 0.0000 Constraint 275 1225 0.8000 1.0000 2.0000 0.0000 Constraint 275 1213 0.8000 1.0000 2.0000 0.0000 Constraint 275 1208 0.8000 1.0000 2.0000 0.0000 Constraint 275 1201 0.8000 1.0000 2.0000 0.0000 Constraint 275 1192 0.8000 1.0000 2.0000 0.0000 Constraint 275 1186 0.8000 1.0000 2.0000 0.0000 Constraint 275 1174 0.8000 1.0000 2.0000 0.0000 Constraint 275 1168 0.8000 1.0000 2.0000 0.0000 Constraint 275 1159 0.8000 1.0000 2.0000 0.0000 Constraint 275 1150 0.8000 1.0000 2.0000 0.0000 Constraint 275 1144 0.8000 1.0000 2.0000 0.0000 Constraint 275 1133 0.8000 1.0000 2.0000 0.0000 Constraint 275 1124 0.8000 1.0000 2.0000 0.0000 Constraint 275 1106 0.8000 1.0000 2.0000 0.0000 Constraint 275 1095 0.8000 1.0000 2.0000 0.0000 Constraint 275 1075 0.8000 1.0000 2.0000 0.0000 Constraint 275 1066 0.8000 1.0000 2.0000 0.0000 Constraint 275 1051 0.8000 1.0000 2.0000 0.0000 Constraint 275 1039 0.8000 1.0000 2.0000 0.0000 Constraint 275 1031 0.8000 1.0000 2.0000 0.0000 Constraint 275 1024 0.8000 1.0000 2.0000 0.0000 Constraint 275 1015 0.8000 1.0000 2.0000 0.0000 Constraint 275 1007 0.8000 1.0000 2.0000 0.0000 Constraint 275 981 0.8000 1.0000 2.0000 0.0000 Constraint 275 973 0.8000 1.0000 2.0000 0.0000 Constraint 275 967 0.8000 1.0000 2.0000 0.0000 Constraint 275 958 0.8000 1.0000 2.0000 0.0000 Constraint 275 944 0.8000 1.0000 2.0000 0.0000 Constraint 275 939 0.8000 1.0000 2.0000 0.0000 Constraint 275 931 0.8000 1.0000 2.0000 0.0000 Constraint 275 924 0.8000 1.0000 2.0000 0.0000 Constraint 275 915 0.8000 1.0000 2.0000 0.0000 Constraint 275 907 0.8000 1.0000 2.0000 0.0000 Constraint 275 900 0.8000 1.0000 2.0000 0.0000 Constraint 275 892 0.8000 1.0000 2.0000 0.0000 Constraint 275 884 0.8000 1.0000 2.0000 0.0000 Constraint 275 871 0.8000 1.0000 2.0000 0.0000 Constraint 275 833 0.8000 1.0000 2.0000 0.0000 Constraint 275 805 0.8000 1.0000 2.0000 0.0000 Constraint 275 781 0.8000 1.0000 2.0000 0.0000 Constraint 275 773 0.8000 1.0000 2.0000 0.0000 Constraint 275 756 0.8000 1.0000 2.0000 0.0000 Constraint 275 742 0.8000 1.0000 2.0000 0.0000 Constraint 275 728 0.8000 1.0000 2.0000 0.0000 Constraint 275 723 0.8000 1.0000 2.0000 0.0000 Constraint 275 716 0.8000 1.0000 2.0000 0.0000 Constraint 275 708 0.8000 1.0000 2.0000 0.0000 Constraint 275 700 0.8000 1.0000 2.0000 0.0000 Constraint 275 691 0.8000 1.0000 2.0000 0.0000 Constraint 275 674 0.8000 1.0000 2.0000 0.0000 Constraint 275 669 0.8000 1.0000 2.0000 0.0000 Constraint 275 660 0.8000 1.0000 2.0000 0.0000 Constraint 275 649 0.8000 1.0000 2.0000 0.0000 Constraint 275 632 0.8000 1.0000 2.0000 0.0000 Constraint 275 624 0.8000 1.0000 2.0000 0.0000 Constraint 275 618 0.8000 1.0000 2.0000 0.0000 Constraint 275 610 0.8000 1.0000 2.0000 0.0000 Constraint 275 602 0.8000 1.0000 2.0000 0.0000 Constraint 275 570 0.8000 1.0000 2.0000 0.0000 Constraint 275 515 0.8000 1.0000 2.0000 0.0000 Constraint 275 481 0.8000 1.0000 2.0000 0.0000 Constraint 275 472 0.8000 1.0000 2.0000 0.0000 Constraint 275 455 0.8000 1.0000 2.0000 0.0000 Constraint 275 439 0.8000 1.0000 2.0000 0.0000 Constraint 275 431 0.8000 1.0000 2.0000 0.0000 Constraint 275 422 0.8000 1.0000 2.0000 0.0000 Constraint 275 417 0.8000 1.0000 2.0000 0.0000 Constraint 275 408 0.8000 1.0000 2.0000 0.0000 Constraint 275 335 0.8000 1.0000 2.0000 0.0000 Constraint 275 325 0.8000 1.0000 2.0000 0.0000 Constraint 275 317 0.8000 1.0000 2.0000 0.0000 Constraint 275 309 0.8000 1.0000 2.0000 0.0000 Constraint 275 297 0.8000 1.0000 2.0000 0.0000 Constraint 275 291 0.8000 1.0000 2.0000 0.0000 Constraint 275 282 0.8000 1.0000 2.0000 0.0000 Constraint 266 1476 0.8000 1.0000 2.0000 0.0000 Constraint 266 1467 0.8000 1.0000 2.0000 0.0000 Constraint 266 1459 0.8000 1.0000 2.0000 0.0000 Constraint 266 1451 0.8000 1.0000 2.0000 0.0000 Constraint 266 1442 0.8000 1.0000 2.0000 0.0000 Constraint 266 1430 0.8000 1.0000 2.0000 0.0000 Constraint 266 1421 0.8000 1.0000 2.0000 0.0000 Constraint 266 1413 0.8000 1.0000 2.0000 0.0000 Constraint 266 1402 0.8000 1.0000 2.0000 0.0000 Constraint 266 1381 0.8000 1.0000 2.0000 0.0000 Constraint 266 1373 0.8000 1.0000 2.0000 0.0000 Constraint 266 1362 0.8000 1.0000 2.0000 0.0000 Constraint 266 1354 0.8000 1.0000 2.0000 0.0000 Constraint 266 1347 0.8000 1.0000 2.0000 0.0000 Constraint 266 1339 0.8000 1.0000 2.0000 0.0000 Constraint 266 1329 0.8000 1.0000 2.0000 0.0000 Constraint 266 1318 0.8000 1.0000 2.0000 0.0000 Constraint 266 1306 0.8000 1.0000 2.0000 0.0000 Constraint 266 1295 0.8000 1.0000 2.0000 0.0000 Constraint 266 1288 0.8000 1.0000 2.0000 0.0000 Constraint 266 1281 0.8000 1.0000 2.0000 0.0000 Constraint 266 1272 0.8000 1.0000 2.0000 0.0000 Constraint 266 1264 0.8000 1.0000 2.0000 0.0000 Constraint 266 1256 0.8000 1.0000 2.0000 0.0000 Constraint 266 1244 0.8000 1.0000 2.0000 0.0000 Constraint 266 1235 0.8000 1.0000 2.0000 0.0000 Constraint 266 1225 0.8000 1.0000 2.0000 0.0000 Constraint 266 1213 0.8000 1.0000 2.0000 0.0000 Constraint 266 1208 0.8000 1.0000 2.0000 0.0000 Constraint 266 1201 0.8000 1.0000 2.0000 0.0000 Constraint 266 1192 0.8000 1.0000 2.0000 0.0000 Constraint 266 1186 0.8000 1.0000 2.0000 0.0000 Constraint 266 1174 0.8000 1.0000 2.0000 0.0000 Constraint 266 1168 0.8000 1.0000 2.0000 0.0000 Constraint 266 1159 0.8000 1.0000 2.0000 0.0000 Constraint 266 1150 0.8000 1.0000 2.0000 0.0000 Constraint 266 1144 0.8000 1.0000 2.0000 0.0000 Constraint 266 1133 0.8000 1.0000 2.0000 0.0000 Constraint 266 1124 0.8000 1.0000 2.0000 0.0000 Constraint 266 1106 0.8000 1.0000 2.0000 0.0000 Constraint 266 1095 0.8000 1.0000 2.0000 0.0000 Constraint 266 1087 0.8000 1.0000 2.0000 0.0000 Constraint 266 1075 0.8000 1.0000 2.0000 0.0000 Constraint 266 1066 0.8000 1.0000 2.0000 0.0000 Constraint 266 1051 0.8000 1.0000 2.0000 0.0000 Constraint 266 1039 0.8000 1.0000 2.0000 0.0000 Constraint 266 1031 0.8000 1.0000 2.0000 0.0000 Constraint 266 1015 0.8000 1.0000 2.0000 0.0000 Constraint 266 1007 0.8000 1.0000 2.0000 0.0000 Constraint 266 981 0.8000 1.0000 2.0000 0.0000 Constraint 266 973 0.8000 1.0000 2.0000 0.0000 Constraint 266 958 0.8000 1.0000 2.0000 0.0000 Constraint 266 951 0.8000 1.0000 2.0000 0.0000 Constraint 266 944 0.8000 1.0000 2.0000 0.0000 Constraint 266 939 0.8000 1.0000 2.0000 0.0000 Constraint 266 931 0.8000 1.0000 2.0000 0.0000 Constraint 266 924 0.8000 1.0000 2.0000 0.0000 Constraint 266 915 0.8000 1.0000 2.0000 0.0000 Constraint 266 907 0.8000 1.0000 2.0000 0.0000 Constraint 266 900 0.8000 1.0000 2.0000 0.0000 Constraint 266 892 0.8000 1.0000 2.0000 0.0000 Constraint 266 884 0.8000 1.0000 2.0000 0.0000 Constraint 266 871 0.8000 1.0000 2.0000 0.0000 Constraint 266 864 0.8000 1.0000 2.0000 0.0000 Constraint 266 822 0.8000 1.0000 2.0000 0.0000 Constraint 266 814 0.8000 1.0000 2.0000 0.0000 Constraint 266 794 0.8000 1.0000 2.0000 0.0000 Constraint 266 781 0.8000 1.0000 2.0000 0.0000 Constraint 266 773 0.8000 1.0000 2.0000 0.0000 Constraint 266 762 0.8000 1.0000 2.0000 0.0000 Constraint 266 756 0.8000 1.0000 2.0000 0.0000 Constraint 266 742 0.8000 1.0000 2.0000 0.0000 Constraint 266 723 0.8000 1.0000 2.0000 0.0000 Constraint 266 716 0.8000 1.0000 2.0000 0.0000 Constraint 266 708 0.8000 1.0000 2.0000 0.0000 Constraint 266 700 0.8000 1.0000 2.0000 0.0000 Constraint 266 691 0.8000 1.0000 2.0000 0.0000 Constraint 266 683 0.8000 1.0000 2.0000 0.0000 Constraint 266 674 0.8000 1.0000 2.0000 0.0000 Constraint 266 669 0.8000 1.0000 2.0000 0.0000 Constraint 266 660 0.8000 1.0000 2.0000 0.0000 Constraint 266 649 0.8000 1.0000 2.0000 0.0000 Constraint 266 641 0.8000 1.0000 2.0000 0.0000 Constraint 266 632 0.8000 1.0000 2.0000 0.0000 Constraint 266 624 0.8000 1.0000 2.0000 0.0000 Constraint 266 618 0.8000 1.0000 2.0000 0.0000 Constraint 266 610 0.8000 1.0000 2.0000 0.0000 Constraint 266 602 0.8000 1.0000 2.0000 0.0000 Constraint 266 596 0.8000 1.0000 2.0000 0.0000 Constraint 266 585 0.8000 1.0000 2.0000 0.0000 Constraint 266 532 0.8000 1.0000 2.0000 0.0000 Constraint 266 522 0.8000 1.0000 2.0000 0.0000 Constraint 266 510 0.8000 1.0000 2.0000 0.0000 Constraint 266 499 0.8000 1.0000 2.0000 0.0000 Constraint 266 481 0.8000 1.0000 2.0000 0.0000 Constraint 266 472 0.8000 1.0000 2.0000 0.0000 Constraint 266 464 0.8000 1.0000 2.0000 0.0000 Constraint 266 455 0.8000 1.0000 2.0000 0.0000 Constraint 266 446 0.8000 1.0000 2.0000 0.0000 Constraint 266 439 0.8000 1.0000 2.0000 0.0000 Constraint 266 431 0.8000 1.0000 2.0000 0.0000 Constraint 266 422 0.8000 1.0000 2.0000 0.0000 Constraint 266 417 0.8000 1.0000 2.0000 0.0000 Constraint 266 408 0.8000 1.0000 2.0000 0.0000 Constraint 266 343 0.8000 1.0000 2.0000 0.0000 Constraint 266 325 0.8000 1.0000 2.0000 0.0000 Constraint 266 317 0.8000 1.0000 2.0000 0.0000 Constraint 266 309 0.8000 1.0000 2.0000 0.0000 Constraint 266 297 0.8000 1.0000 2.0000 0.0000 Constraint 266 291 0.8000 1.0000 2.0000 0.0000 Constraint 266 282 0.8000 1.0000 2.0000 0.0000 Constraint 266 275 0.8000 1.0000 2.0000 0.0000 Constraint 257 1476 0.8000 1.0000 2.0000 0.0000 Constraint 257 1467 0.8000 1.0000 2.0000 0.0000 Constraint 257 1459 0.8000 1.0000 2.0000 0.0000 Constraint 257 1451 0.8000 1.0000 2.0000 0.0000 Constraint 257 1442 0.8000 1.0000 2.0000 0.0000 Constraint 257 1421 0.8000 1.0000 2.0000 0.0000 Constraint 257 1413 0.8000 1.0000 2.0000 0.0000 Constraint 257 1402 0.8000 1.0000 2.0000 0.0000 Constraint 257 1395 0.8000 1.0000 2.0000 0.0000 Constraint 257 1381 0.8000 1.0000 2.0000 0.0000 Constraint 257 1373 0.8000 1.0000 2.0000 0.0000 Constraint 257 1362 0.8000 1.0000 2.0000 0.0000 Constraint 257 1354 0.8000 1.0000 2.0000 0.0000 Constraint 257 1347 0.8000 1.0000 2.0000 0.0000 Constraint 257 1339 0.8000 1.0000 2.0000 0.0000 Constraint 257 1329 0.8000 1.0000 2.0000 0.0000 Constraint 257 1318 0.8000 1.0000 2.0000 0.0000 Constraint 257 1306 0.8000 1.0000 2.0000 0.0000 Constraint 257 1295 0.8000 1.0000 2.0000 0.0000 Constraint 257 1288 0.8000 1.0000 2.0000 0.0000 Constraint 257 1281 0.8000 1.0000 2.0000 0.0000 Constraint 257 1272 0.8000 1.0000 2.0000 0.0000 Constraint 257 1264 0.8000 1.0000 2.0000 0.0000 Constraint 257 1256 0.8000 1.0000 2.0000 0.0000 Constraint 257 1244 0.8000 1.0000 2.0000 0.0000 Constraint 257 1235 0.8000 1.0000 2.0000 0.0000 Constraint 257 1225 0.8000 1.0000 2.0000 0.0000 Constraint 257 1213 0.8000 1.0000 2.0000 0.0000 Constraint 257 1208 0.8000 1.0000 2.0000 0.0000 Constraint 257 1201 0.8000 1.0000 2.0000 0.0000 Constraint 257 1192 0.8000 1.0000 2.0000 0.0000 Constraint 257 1186 0.8000 1.0000 2.0000 0.0000 Constraint 257 1174 0.8000 1.0000 2.0000 0.0000 Constraint 257 1168 0.8000 1.0000 2.0000 0.0000 Constraint 257 1159 0.8000 1.0000 2.0000 0.0000 Constraint 257 1150 0.8000 1.0000 2.0000 0.0000 Constraint 257 1144 0.8000 1.0000 2.0000 0.0000 Constraint 257 1133 0.8000 1.0000 2.0000 0.0000 Constraint 257 1124 0.8000 1.0000 2.0000 0.0000 Constraint 257 1106 0.8000 1.0000 2.0000 0.0000 Constraint 257 1095 0.8000 1.0000 2.0000 0.0000 Constraint 257 1087 0.8000 1.0000 2.0000 0.0000 Constraint 257 1075 0.8000 1.0000 2.0000 0.0000 Constraint 257 1066 0.8000 1.0000 2.0000 0.0000 Constraint 257 1051 0.8000 1.0000 2.0000 0.0000 Constraint 257 1039 0.8000 1.0000 2.0000 0.0000 Constraint 257 1031 0.8000 1.0000 2.0000 0.0000 Constraint 257 1024 0.8000 1.0000 2.0000 0.0000 Constraint 257 1015 0.8000 1.0000 2.0000 0.0000 Constraint 257 1007 0.8000 1.0000 2.0000 0.0000 Constraint 257 981 0.8000 1.0000 2.0000 0.0000 Constraint 257 973 0.8000 1.0000 2.0000 0.0000 Constraint 257 967 0.8000 1.0000 2.0000 0.0000 Constraint 257 958 0.8000 1.0000 2.0000 0.0000 Constraint 257 951 0.8000 1.0000 2.0000 0.0000 Constraint 257 944 0.8000 1.0000 2.0000 0.0000 Constraint 257 939 0.8000 1.0000 2.0000 0.0000 Constraint 257 931 0.8000 1.0000 2.0000 0.0000 Constraint 257 924 0.8000 1.0000 2.0000 0.0000 Constraint 257 915 0.8000 1.0000 2.0000 0.0000 Constraint 257 907 0.8000 1.0000 2.0000 0.0000 Constraint 257 900 0.8000 1.0000 2.0000 0.0000 Constraint 257 892 0.8000 1.0000 2.0000 0.0000 Constraint 257 884 0.8000 1.0000 2.0000 0.0000 Constraint 257 841 0.8000 1.0000 2.0000 0.0000 Constraint 257 833 0.8000 1.0000 2.0000 0.0000 Constraint 257 822 0.8000 1.0000 2.0000 0.0000 Constraint 257 814 0.8000 1.0000 2.0000 0.0000 Constraint 257 805 0.8000 1.0000 2.0000 0.0000 Constraint 257 794 0.8000 1.0000 2.0000 0.0000 Constraint 257 781 0.8000 1.0000 2.0000 0.0000 Constraint 257 773 0.8000 1.0000 2.0000 0.0000 Constraint 257 756 0.8000 1.0000 2.0000 0.0000 Constraint 257 742 0.8000 1.0000 2.0000 0.0000 Constraint 257 723 0.8000 1.0000 2.0000 0.0000 Constraint 257 716 0.8000 1.0000 2.0000 0.0000 Constraint 257 708 0.8000 1.0000 2.0000 0.0000 Constraint 257 700 0.8000 1.0000 2.0000 0.0000 Constraint 257 691 0.8000 1.0000 2.0000 0.0000 Constraint 257 683 0.8000 1.0000 2.0000 0.0000 Constraint 257 674 0.8000 1.0000 2.0000 0.0000 Constraint 257 669 0.8000 1.0000 2.0000 0.0000 Constraint 257 660 0.8000 1.0000 2.0000 0.0000 Constraint 257 649 0.8000 1.0000 2.0000 0.0000 Constraint 257 641 0.8000 1.0000 2.0000 0.0000 Constraint 257 632 0.8000 1.0000 2.0000 0.0000 Constraint 257 624 0.8000 1.0000 2.0000 0.0000 Constraint 257 618 0.8000 1.0000 2.0000 0.0000 Constraint 257 610 0.8000 1.0000 2.0000 0.0000 Constraint 257 596 0.8000 1.0000 2.0000 0.0000 Constraint 257 585 0.8000 1.0000 2.0000 0.0000 Constraint 257 515 0.8000 1.0000 2.0000 0.0000 Constraint 257 510 0.8000 1.0000 2.0000 0.0000 Constraint 257 499 0.8000 1.0000 2.0000 0.0000 Constraint 257 481 0.8000 1.0000 2.0000 0.0000 Constraint 257 472 0.8000 1.0000 2.0000 0.0000 Constraint 257 464 0.8000 1.0000 2.0000 0.0000 Constraint 257 455 0.8000 1.0000 2.0000 0.0000 Constraint 257 446 0.8000 1.0000 2.0000 0.0000 Constraint 257 439 0.8000 1.0000 2.0000 0.0000 Constraint 257 431 0.8000 1.0000 2.0000 0.0000 Constraint 257 422 0.8000 1.0000 2.0000 0.0000 Constraint 257 417 0.8000 1.0000 2.0000 0.0000 Constraint 257 408 0.8000 1.0000 2.0000 0.0000 Constraint 257 325 0.8000 1.0000 2.0000 0.0000 Constraint 257 317 0.8000 1.0000 2.0000 0.0000 Constraint 257 309 0.8000 1.0000 2.0000 0.0000 Constraint 257 297 0.8000 1.0000 2.0000 0.0000 Constraint 257 291 0.8000 1.0000 2.0000 0.0000 Constraint 257 282 0.8000 1.0000 2.0000 0.0000 Constraint 257 275 0.8000 1.0000 2.0000 0.0000 Constraint 257 266 0.8000 1.0000 2.0000 0.0000 Constraint 249 1476 0.8000 1.0000 2.0000 0.0000 Constraint 249 1467 0.8000 1.0000 2.0000 0.0000 Constraint 249 1451 0.8000 1.0000 2.0000 0.0000 Constraint 249 1442 0.8000 1.0000 2.0000 0.0000 Constraint 249 1421 0.8000 1.0000 2.0000 0.0000 Constraint 249 1413 0.8000 1.0000 2.0000 0.0000 Constraint 249 1395 0.8000 1.0000 2.0000 0.0000 Constraint 249 1386 0.8000 1.0000 2.0000 0.0000 Constraint 249 1381 0.8000 1.0000 2.0000 0.0000 Constraint 249 1373 0.8000 1.0000 2.0000 0.0000 Constraint 249 1362 0.8000 1.0000 2.0000 0.0000 Constraint 249 1354 0.8000 1.0000 2.0000 0.0000 Constraint 249 1347 0.8000 1.0000 2.0000 0.0000 Constraint 249 1339 0.8000 1.0000 2.0000 0.0000 Constraint 249 1329 0.8000 1.0000 2.0000 0.0000 Constraint 249 1318 0.8000 1.0000 2.0000 0.0000 Constraint 249 1306 0.8000 1.0000 2.0000 0.0000 Constraint 249 1295 0.8000 1.0000 2.0000 0.0000 Constraint 249 1288 0.8000 1.0000 2.0000 0.0000 Constraint 249 1281 0.8000 1.0000 2.0000 0.0000 Constraint 249 1272 0.8000 1.0000 2.0000 0.0000 Constraint 249 1244 0.8000 1.0000 2.0000 0.0000 Constraint 249 1235 0.8000 1.0000 2.0000 0.0000 Constraint 249 1213 0.8000 1.0000 2.0000 0.0000 Constraint 249 1208 0.8000 1.0000 2.0000 0.0000 Constraint 249 1201 0.8000 1.0000 2.0000 0.0000 Constraint 249 1192 0.8000 1.0000 2.0000 0.0000 Constraint 249 1186 0.8000 1.0000 2.0000 0.0000 Constraint 249 1174 0.8000 1.0000 2.0000 0.0000 Constraint 249 1168 0.8000 1.0000 2.0000 0.0000 Constraint 249 1159 0.8000 1.0000 2.0000 0.0000 Constraint 249 1150 0.8000 1.0000 2.0000 0.0000 Constraint 249 1144 0.8000 1.0000 2.0000 0.0000 Constraint 249 1133 0.8000 1.0000 2.0000 0.0000 Constraint 249 1124 0.8000 1.0000 2.0000 0.0000 Constraint 249 1106 0.8000 1.0000 2.0000 0.0000 Constraint 249 1095 0.8000 1.0000 2.0000 0.0000 Constraint 249 1075 0.8000 1.0000 2.0000 0.0000 Constraint 249 1066 0.8000 1.0000 2.0000 0.0000 Constraint 249 1051 0.8000 1.0000 2.0000 0.0000 Constraint 249 1039 0.8000 1.0000 2.0000 0.0000 Constraint 249 1031 0.8000 1.0000 2.0000 0.0000 Constraint 249 1015 0.8000 1.0000 2.0000 0.0000 Constraint 249 1007 0.8000 1.0000 2.0000 0.0000 Constraint 249 981 0.8000 1.0000 2.0000 0.0000 Constraint 249 973 0.8000 1.0000 2.0000 0.0000 Constraint 249 967 0.8000 1.0000 2.0000 0.0000 Constraint 249 944 0.8000 1.0000 2.0000 0.0000 Constraint 249 939 0.8000 1.0000 2.0000 0.0000 Constraint 249 924 0.8000 1.0000 2.0000 0.0000 Constraint 249 915 0.8000 1.0000 2.0000 0.0000 Constraint 249 907 0.8000 1.0000 2.0000 0.0000 Constraint 249 900 0.8000 1.0000 2.0000 0.0000 Constraint 249 892 0.8000 1.0000 2.0000 0.0000 Constraint 249 841 0.8000 1.0000 2.0000 0.0000 Constraint 249 833 0.8000 1.0000 2.0000 0.0000 Constraint 249 762 0.8000 1.0000 2.0000 0.0000 Constraint 249 756 0.8000 1.0000 2.0000 0.0000 Constraint 249 742 0.8000 1.0000 2.0000 0.0000 Constraint 249 728 0.8000 1.0000 2.0000 0.0000 Constraint 249 723 0.8000 1.0000 2.0000 0.0000 Constraint 249 700 0.8000 1.0000 2.0000 0.0000 Constraint 249 691 0.8000 1.0000 2.0000 0.0000 Constraint 249 683 0.8000 1.0000 2.0000 0.0000 Constraint 249 669 0.8000 1.0000 2.0000 0.0000 Constraint 249 660 0.8000 1.0000 2.0000 0.0000 Constraint 249 632 0.8000 1.0000 2.0000 0.0000 Constraint 249 624 0.8000 1.0000 2.0000 0.0000 Constraint 249 618 0.8000 1.0000 2.0000 0.0000 Constraint 249 610 0.8000 1.0000 2.0000 0.0000 Constraint 249 596 0.8000 1.0000 2.0000 0.0000 Constraint 249 585 0.8000 1.0000 2.0000 0.0000 Constraint 249 579 0.8000 1.0000 2.0000 0.0000 Constraint 249 515 0.8000 1.0000 2.0000 0.0000 Constraint 249 472 0.8000 1.0000 2.0000 0.0000 Constraint 249 446 0.8000 1.0000 2.0000 0.0000 Constraint 249 439 0.8000 1.0000 2.0000 0.0000 Constraint 249 431 0.8000 1.0000 2.0000 0.0000 Constraint 249 422 0.8000 1.0000 2.0000 0.0000 Constraint 249 417 0.8000 1.0000 2.0000 0.0000 Constraint 249 408 0.8000 1.0000 2.0000 0.0000 Constraint 249 317 0.8000 1.0000 2.0000 0.0000 Constraint 249 309 0.8000 1.0000 2.0000 0.0000 Constraint 249 297 0.8000 1.0000 2.0000 0.0000 Constraint 249 291 0.8000 1.0000 2.0000 0.0000 Constraint 249 282 0.8000 1.0000 2.0000 0.0000 Constraint 249 275 0.8000 1.0000 2.0000 0.0000 Constraint 249 266 0.8000 1.0000 2.0000 0.0000 Constraint 249 257 0.8000 1.0000 2.0000 0.0000 Constraint 237 1476 0.8000 1.0000 2.0000 0.0000 Constraint 237 1467 0.8000 1.0000 2.0000 0.0000 Constraint 237 1459 0.8000 1.0000 2.0000 0.0000 Constraint 237 1451 0.8000 1.0000 2.0000 0.0000 Constraint 237 1442 0.8000 1.0000 2.0000 0.0000 Constraint 237 1430 0.8000 1.0000 2.0000 0.0000 Constraint 237 1421 0.8000 1.0000 2.0000 0.0000 Constraint 237 1413 0.8000 1.0000 2.0000 0.0000 Constraint 237 1395 0.8000 1.0000 2.0000 0.0000 Constraint 237 1386 0.8000 1.0000 2.0000 0.0000 Constraint 237 1381 0.8000 1.0000 2.0000 0.0000 Constraint 237 1373 0.8000 1.0000 2.0000 0.0000 Constraint 237 1362 0.8000 1.0000 2.0000 0.0000 Constraint 237 1354 0.8000 1.0000 2.0000 0.0000 Constraint 237 1347 0.8000 1.0000 2.0000 0.0000 Constraint 237 1339 0.8000 1.0000 2.0000 0.0000 Constraint 237 1329 0.8000 1.0000 2.0000 0.0000 Constraint 237 1318 0.8000 1.0000 2.0000 0.0000 Constraint 237 1306 0.8000 1.0000 2.0000 0.0000 Constraint 237 1295 0.8000 1.0000 2.0000 0.0000 Constraint 237 1288 0.8000 1.0000 2.0000 0.0000 Constraint 237 1281 0.8000 1.0000 2.0000 0.0000 Constraint 237 1272 0.8000 1.0000 2.0000 0.0000 Constraint 237 1235 0.8000 1.0000 2.0000 0.0000 Constraint 237 1208 0.8000 1.0000 2.0000 0.0000 Constraint 237 1201 0.8000 1.0000 2.0000 0.0000 Constraint 237 1192 0.8000 1.0000 2.0000 0.0000 Constraint 237 1186 0.8000 1.0000 2.0000 0.0000 Constraint 237 1174 0.8000 1.0000 2.0000 0.0000 Constraint 237 1168 0.8000 1.0000 2.0000 0.0000 Constraint 237 1159 0.8000 1.0000 2.0000 0.0000 Constraint 237 1150 0.8000 1.0000 2.0000 0.0000 Constraint 237 1144 0.8000 1.0000 2.0000 0.0000 Constraint 237 1133 0.8000 1.0000 2.0000 0.0000 Constraint 237 1124 0.8000 1.0000 2.0000 0.0000 Constraint 237 1106 0.8000 1.0000 2.0000 0.0000 Constraint 237 1095 0.8000 1.0000 2.0000 0.0000 Constraint 237 1087 0.8000 1.0000 2.0000 0.0000 Constraint 237 1039 0.8000 1.0000 2.0000 0.0000 Constraint 237 1031 0.8000 1.0000 2.0000 0.0000 Constraint 237 1024 0.8000 1.0000 2.0000 0.0000 Constraint 237 1015 0.8000 1.0000 2.0000 0.0000 Constraint 237 1007 0.8000 1.0000 2.0000 0.0000 Constraint 237 990 0.8000 1.0000 2.0000 0.0000 Constraint 237 981 0.8000 1.0000 2.0000 0.0000 Constraint 237 973 0.8000 1.0000 2.0000 0.0000 Constraint 237 967 0.8000 1.0000 2.0000 0.0000 Constraint 237 958 0.8000 1.0000 2.0000 0.0000 Constraint 237 944 0.8000 1.0000 2.0000 0.0000 Constraint 237 939 0.8000 1.0000 2.0000 0.0000 Constraint 237 915 0.8000 1.0000 2.0000 0.0000 Constraint 237 907 0.8000 1.0000 2.0000 0.0000 Constraint 237 900 0.8000 1.0000 2.0000 0.0000 Constraint 237 892 0.8000 1.0000 2.0000 0.0000 Constraint 237 864 0.8000 1.0000 2.0000 0.0000 Constraint 237 852 0.8000 1.0000 2.0000 0.0000 Constraint 237 841 0.8000 1.0000 2.0000 0.0000 Constraint 237 833 0.8000 1.0000 2.0000 0.0000 Constraint 237 822 0.8000 1.0000 2.0000 0.0000 Constraint 237 814 0.8000 1.0000 2.0000 0.0000 Constraint 237 805 0.8000 1.0000 2.0000 0.0000 Constraint 237 794 0.8000 1.0000 2.0000 0.0000 Constraint 237 789 0.8000 1.0000 2.0000 0.0000 Constraint 237 781 0.8000 1.0000 2.0000 0.0000 Constraint 237 773 0.8000 1.0000 2.0000 0.0000 Constraint 237 762 0.8000 1.0000 2.0000 0.0000 Constraint 237 756 0.8000 1.0000 2.0000 0.0000 Constraint 237 742 0.8000 1.0000 2.0000 0.0000 Constraint 237 728 0.8000 1.0000 2.0000 0.0000 Constraint 237 723 0.8000 1.0000 2.0000 0.0000 Constraint 237 716 0.8000 1.0000 2.0000 0.0000 Constraint 237 708 0.8000 1.0000 2.0000 0.0000 Constraint 237 700 0.8000 1.0000 2.0000 0.0000 Constraint 237 691 0.8000 1.0000 2.0000 0.0000 Constraint 237 683 0.8000 1.0000 2.0000 0.0000 Constraint 237 669 0.8000 1.0000 2.0000 0.0000 Constraint 237 632 0.8000 1.0000 2.0000 0.0000 Constraint 237 624 0.8000 1.0000 2.0000 0.0000 Constraint 237 618 0.8000 1.0000 2.0000 0.0000 Constraint 237 610 0.8000 1.0000 2.0000 0.0000 Constraint 237 602 0.8000 1.0000 2.0000 0.0000 Constraint 237 596 0.8000 1.0000 2.0000 0.0000 Constraint 237 585 0.8000 1.0000 2.0000 0.0000 Constraint 237 579 0.8000 1.0000 2.0000 0.0000 Constraint 237 544 0.8000 1.0000 2.0000 0.0000 Constraint 237 532 0.8000 1.0000 2.0000 0.0000 Constraint 237 510 0.8000 1.0000 2.0000 0.0000 Constraint 237 499 0.8000 1.0000 2.0000 0.0000 Constraint 237 472 0.8000 1.0000 2.0000 0.0000 Constraint 237 464 0.8000 1.0000 2.0000 0.0000 Constraint 237 446 0.8000 1.0000 2.0000 0.0000 Constraint 237 439 0.8000 1.0000 2.0000 0.0000 Constraint 237 431 0.8000 1.0000 2.0000 0.0000 Constraint 237 417 0.8000 1.0000 2.0000 0.0000 Constraint 237 408 0.8000 1.0000 2.0000 0.0000 Constraint 237 402 0.8000 1.0000 2.0000 0.0000 Constraint 237 386 0.8000 1.0000 2.0000 0.0000 Constraint 237 351 0.8000 1.0000 2.0000 0.0000 Constraint 237 325 0.8000 1.0000 2.0000 0.0000 Constraint 237 317 0.8000 1.0000 2.0000 0.0000 Constraint 237 297 0.8000 1.0000 2.0000 0.0000 Constraint 237 291 0.8000 1.0000 2.0000 0.0000 Constraint 237 282 0.8000 1.0000 2.0000 0.0000 Constraint 237 275 0.8000 1.0000 2.0000 0.0000 Constraint 237 266 0.8000 1.0000 2.0000 0.0000 Constraint 237 257 0.8000 1.0000 2.0000 0.0000 Constraint 237 249 0.8000 1.0000 2.0000 0.0000 Constraint 229 1476 0.8000 1.0000 2.0000 0.0000 Constraint 229 1467 0.8000 1.0000 2.0000 0.0000 Constraint 229 1459 0.8000 1.0000 2.0000 0.0000 Constraint 229 1451 0.8000 1.0000 2.0000 0.0000 Constraint 229 1442 0.8000 1.0000 2.0000 0.0000 Constraint 229 1430 0.8000 1.0000 2.0000 0.0000 Constraint 229 1421 0.8000 1.0000 2.0000 0.0000 Constraint 229 1413 0.8000 1.0000 2.0000 0.0000 Constraint 229 1402 0.8000 1.0000 2.0000 0.0000 Constraint 229 1395 0.8000 1.0000 2.0000 0.0000 Constraint 229 1386 0.8000 1.0000 2.0000 0.0000 Constraint 229 1381 0.8000 1.0000 2.0000 0.0000 Constraint 229 1373 0.8000 1.0000 2.0000 0.0000 Constraint 229 1362 0.8000 1.0000 2.0000 0.0000 Constraint 229 1354 0.8000 1.0000 2.0000 0.0000 Constraint 229 1347 0.8000 1.0000 2.0000 0.0000 Constraint 229 1339 0.8000 1.0000 2.0000 0.0000 Constraint 229 1329 0.8000 1.0000 2.0000 0.0000 Constraint 229 1318 0.8000 1.0000 2.0000 0.0000 Constraint 229 1306 0.8000 1.0000 2.0000 0.0000 Constraint 229 1295 0.8000 1.0000 2.0000 0.0000 Constraint 229 1288 0.8000 1.0000 2.0000 0.0000 Constraint 229 1272 0.8000 1.0000 2.0000 0.0000 Constraint 229 1264 0.8000 1.0000 2.0000 0.0000 Constraint 229 1256 0.8000 1.0000 2.0000 0.0000 Constraint 229 1244 0.8000 1.0000 2.0000 0.0000 Constraint 229 1235 0.8000 1.0000 2.0000 0.0000 Constraint 229 1225 0.8000 1.0000 2.0000 0.0000 Constraint 229 1213 0.8000 1.0000 2.0000 0.0000 Constraint 229 1208 0.8000 1.0000 2.0000 0.0000 Constraint 229 1201 0.8000 1.0000 2.0000 0.0000 Constraint 229 1186 0.8000 1.0000 2.0000 0.0000 Constraint 229 1174 0.8000 1.0000 2.0000 0.0000 Constraint 229 1168 0.8000 1.0000 2.0000 0.0000 Constraint 229 1159 0.8000 1.0000 2.0000 0.0000 Constraint 229 1150 0.8000 1.0000 2.0000 0.0000 Constraint 229 1144 0.8000 1.0000 2.0000 0.0000 Constraint 229 1133 0.8000 1.0000 2.0000 0.0000 Constraint 229 1124 0.8000 1.0000 2.0000 0.0000 Constraint 229 1106 0.8000 1.0000 2.0000 0.0000 Constraint 229 1095 0.8000 1.0000 2.0000 0.0000 Constraint 229 1087 0.8000 1.0000 2.0000 0.0000 Constraint 229 1066 0.8000 1.0000 2.0000 0.0000 Constraint 229 1051 0.8000 1.0000 2.0000 0.0000 Constraint 229 1039 0.8000 1.0000 2.0000 0.0000 Constraint 229 1031 0.8000 1.0000 2.0000 0.0000 Constraint 229 1024 0.8000 1.0000 2.0000 0.0000 Constraint 229 1015 0.8000 1.0000 2.0000 0.0000 Constraint 229 1007 0.8000 1.0000 2.0000 0.0000 Constraint 229 998 0.8000 1.0000 2.0000 0.0000 Constraint 229 990 0.8000 1.0000 2.0000 0.0000 Constraint 229 981 0.8000 1.0000 2.0000 0.0000 Constraint 229 973 0.8000 1.0000 2.0000 0.0000 Constraint 229 967 0.8000 1.0000 2.0000 0.0000 Constraint 229 958 0.8000 1.0000 2.0000 0.0000 Constraint 229 944 0.8000 1.0000 2.0000 0.0000 Constraint 229 939 0.8000 1.0000 2.0000 0.0000 Constraint 229 931 0.8000 1.0000 2.0000 0.0000 Constraint 229 924 0.8000 1.0000 2.0000 0.0000 Constraint 229 915 0.8000 1.0000 2.0000 0.0000 Constraint 229 907 0.8000 1.0000 2.0000 0.0000 Constraint 229 900 0.8000 1.0000 2.0000 0.0000 Constraint 229 892 0.8000 1.0000 2.0000 0.0000 Constraint 229 884 0.8000 1.0000 2.0000 0.0000 Constraint 229 852 0.8000 1.0000 2.0000 0.0000 Constraint 229 841 0.8000 1.0000 2.0000 0.0000 Constraint 229 833 0.8000 1.0000 2.0000 0.0000 Constraint 229 822 0.8000 1.0000 2.0000 0.0000 Constraint 229 814 0.8000 1.0000 2.0000 0.0000 Constraint 229 805 0.8000 1.0000 2.0000 0.0000 Constraint 229 794 0.8000 1.0000 2.0000 0.0000 Constraint 229 789 0.8000 1.0000 2.0000 0.0000 Constraint 229 781 0.8000 1.0000 2.0000 0.0000 Constraint 229 773 0.8000 1.0000 2.0000 0.0000 Constraint 229 762 0.8000 1.0000 2.0000 0.0000 Constraint 229 756 0.8000 1.0000 2.0000 0.0000 Constraint 229 742 0.8000 1.0000 2.0000 0.0000 Constraint 229 728 0.8000 1.0000 2.0000 0.0000 Constraint 229 723 0.8000 1.0000 2.0000 0.0000 Constraint 229 716 0.8000 1.0000 2.0000 0.0000 Constraint 229 700 0.8000 1.0000 2.0000 0.0000 Constraint 229 691 0.8000 1.0000 2.0000 0.0000 Constraint 229 683 0.8000 1.0000 2.0000 0.0000 Constraint 229 669 0.8000 1.0000 2.0000 0.0000 Constraint 229 660 0.8000 1.0000 2.0000 0.0000 Constraint 229 641 0.8000 1.0000 2.0000 0.0000 Constraint 229 632 0.8000 1.0000 2.0000 0.0000 Constraint 229 624 0.8000 1.0000 2.0000 0.0000 Constraint 229 618 0.8000 1.0000 2.0000 0.0000 Constraint 229 610 0.8000 1.0000 2.0000 0.0000 Constraint 229 602 0.8000 1.0000 2.0000 0.0000 Constraint 229 596 0.8000 1.0000 2.0000 0.0000 Constraint 229 585 0.8000 1.0000 2.0000 0.0000 Constraint 229 579 0.8000 1.0000 2.0000 0.0000 Constraint 229 570 0.8000 1.0000 2.0000 0.0000 Constraint 229 562 0.8000 1.0000 2.0000 0.0000 Constraint 229 551 0.8000 1.0000 2.0000 0.0000 Constraint 229 544 0.8000 1.0000 2.0000 0.0000 Constraint 229 532 0.8000 1.0000 2.0000 0.0000 Constraint 229 522 0.8000 1.0000 2.0000 0.0000 Constraint 229 515 0.8000 1.0000 2.0000 0.0000 Constraint 229 510 0.8000 1.0000 2.0000 0.0000 Constraint 229 499 0.8000 1.0000 2.0000 0.0000 Constraint 229 488 0.8000 1.0000 2.0000 0.0000 Constraint 229 481 0.8000 1.0000 2.0000 0.0000 Constraint 229 472 0.8000 1.0000 2.0000 0.0000 Constraint 229 464 0.8000 1.0000 2.0000 0.0000 Constraint 229 446 0.8000 1.0000 2.0000 0.0000 Constraint 229 439 0.8000 1.0000 2.0000 0.0000 Constraint 229 431 0.8000 1.0000 2.0000 0.0000 Constraint 229 417 0.8000 1.0000 2.0000 0.0000 Constraint 229 408 0.8000 1.0000 2.0000 0.0000 Constraint 229 402 0.8000 1.0000 2.0000 0.0000 Constraint 229 394 0.8000 1.0000 2.0000 0.0000 Constraint 229 386 0.8000 1.0000 2.0000 0.0000 Constraint 229 380 0.8000 1.0000 2.0000 0.0000 Constraint 229 362 0.8000 1.0000 2.0000 0.0000 Constraint 229 351 0.8000 1.0000 2.0000 0.0000 Constraint 229 343 0.8000 1.0000 2.0000 0.0000 Constraint 229 317 0.8000 1.0000 2.0000 0.0000 Constraint 229 309 0.8000 1.0000 2.0000 0.0000 Constraint 229 297 0.8000 1.0000 2.0000 0.0000 Constraint 229 291 0.8000 1.0000 2.0000 0.0000 Constraint 229 282 0.8000 1.0000 2.0000 0.0000 Constraint 229 275 0.8000 1.0000 2.0000 0.0000 Constraint 229 266 0.8000 1.0000 2.0000 0.0000 Constraint 229 257 0.8000 1.0000 2.0000 0.0000 Constraint 229 249 0.8000 1.0000 2.0000 0.0000 Constraint 229 237 0.8000 1.0000 2.0000 0.0000 Constraint 222 1476 0.8000 1.0000 2.0000 0.0000 Constraint 222 1467 0.8000 1.0000 2.0000 0.0000 Constraint 222 1459 0.8000 1.0000 2.0000 0.0000 Constraint 222 1451 0.8000 1.0000 2.0000 0.0000 Constraint 222 1442 0.8000 1.0000 2.0000 0.0000 Constraint 222 1430 0.8000 1.0000 2.0000 0.0000 Constraint 222 1421 0.8000 1.0000 2.0000 0.0000 Constraint 222 1413 0.8000 1.0000 2.0000 0.0000 Constraint 222 1402 0.8000 1.0000 2.0000 0.0000 Constraint 222 1395 0.8000 1.0000 2.0000 0.0000 Constraint 222 1386 0.8000 1.0000 2.0000 0.0000 Constraint 222 1381 0.8000 1.0000 2.0000 0.0000 Constraint 222 1373 0.8000 1.0000 2.0000 0.0000 Constraint 222 1362 0.8000 1.0000 2.0000 0.0000 Constraint 222 1354 0.8000 1.0000 2.0000 0.0000 Constraint 222 1347 0.8000 1.0000 2.0000 0.0000 Constraint 222 1339 0.8000 1.0000 2.0000 0.0000 Constraint 222 1329 0.8000 1.0000 2.0000 0.0000 Constraint 222 1318 0.8000 1.0000 2.0000 0.0000 Constraint 222 1306 0.8000 1.0000 2.0000 0.0000 Constraint 222 1288 0.8000 1.0000 2.0000 0.0000 Constraint 222 1272 0.8000 1.0000 2.0000 0.0000 Constraint 222 1264 0.8000 1.0000 2.0000 0.0000 Constraint 222 1235 0.8000 1.0000 2.0000 0.0000 Constraint 222 1225 0.8000 1.0000 2.0000 0.0000 Constraint 222 1213 0.8000 1.0000 2.0000 0.0000 Constraint 222 1208 0.8000 1.0000 2.0000 0.0000 Constraint 222 1201 0.8000 1.0000 2.0000 0.0000 Constraint 222 1192 0.8000 1.0000 2.0000 0.0000 Constraint 222 1186 0.8000 1.0000 2.0000 0.0000 Constraint 222 1174 0.8000 1.0000 2.0000 0.0000 Constraint 222 1168 0.8000 1.0000 2.0000 0.0000 Constraint 222 1159 0.8000 1.0000 2.0000 0.0000 Constraint 222 1150 0.8000 1.0000 2.0000 0.0000 Constraint 222 1144 0.8000 1.0000 2.0000 0.0000 Constraint 222 1133 0.8000 1.0000 2.0000 0.0000 Constraint 222 1124 0.8000 1.0000 2.0000 0.0000 Constraint 222 1106 0.8000 1.0000 2.0000 0.0000 Constraint 222 1095 0.8000 1.0000 2.0000 0.0000 Constraint 222 1087 0.8000 1.0000 2.0000 0.0000 Constraint 222 1075 0.8000 1.0000 2.0000 0.0000 Constraint 222 1066 0.8000 1.0000 2.0000 0.0000 Constraint 222 1051 0.8000 1.0000 2.0000 0.0000 Constraint 222 1039 0.8000 1.0000 2.0000 0.0000 Constraint 222 1031 0.8000 1.0000 2.0000 0.0000 Constraint 222 1024 0.8000 1.0000 2.0000 0.0000 Constraint 222 1015 0.8000 1.0000 2.0000 0.0000 Constraint 222 1007 0.8000 1.0000 2.0000 0.0000 Constraint 222 998 0.8000 1.0000 2.0000 0.0000 Constraint 222 967 0.8000 1.0000 2.0000 0.0000 Constraint 222 958 0.8000 1.0000 2.0000 0.0000 Constraint 222 951 0.8000 1.0000 2.0000 0.0000 Constraint 222 944 0.8000 1.0000 2.0000 0.0000 Constraint 222 939 0.8000 1.0000 2.0000 0.0000 Constraint 222 931 0.8000 1.0000 2.0000 0.0000 Constraint 222 924 0.8000 1.0000 2.0000 0.0000 Constraint 222 915 0.8000 1.0000 2.0000 0.0000 Constraint 222 907 0.8000 1.0000 2.0000 0.0000 Constraint 222 900 0.8000 1.0000 2.0000 0.0000 Constraint 222 892 0.8000 1.0000 2.0000 0.0000 Constraint 222 884 0.8000 1.0000 2.0000 0.0000 Constraint 222 871 0.8000 1.0000 2.0000 0.0000 Constraint 222 864 0.8000 1.0000 2.0000 0.0000 Constraint 222 852 0.8000 1.0000 2.0000 0.0000 Constraint 222 841 0.8000 1.0000 2.0000 0.0000 Constraint 222 805 0.8000 1.0000 2.0000 0.0000 Constraint 222 794 0.8000 1.0000 2.0000 0.0000 Constraint 222 789 0.8000 1.0000 2.0000 0.0000 Constraint 222 723 0.8000 1.0000 2.0000 0.0000 Constraint 222 716 0.8000 1.0000 2.0000 0.0000 Constraint 222 700 0.8000 1.0000 2.0000 0.0000 Constraint 222 691 0.8000 1.0000 2.0000 0.0000 Constraint 222 683 0.8000 1.0000 2.0000 0.0000 Constraint 222 674 0.8000 1.0000 2.0000 0.0000 Constraint 222 669 0.8000 1.0000 2.0000 0.0000 Constraint 222 660 0.8000 1.0000 2.0000 0.0000 Constraint 222 649 0.8000 1.0000 2.0000 0.0000 Constraint 222 641 0.8000 1.0000 2.0000 0.0000 Constraint 222 618 0.8000 1.0000 2.0000 0.0000 Constraint 222 610 0.8000 1.0000 2.0000 0.0000 Constraint 222 602 0.8000 1.0000 2.0000 0.0000 Constraint 222 596 0.8000 1.0000 2.0000 0.0000 Constraint 222 585 0.8000 1.0000 2.0000 0.0000 Constraint 222 570 0.8000 1.0000 2.0000 0.0000 Constraint 222 510 0.8000 1.0000 2.0000 0.0000 Constraint 222 446 0.8000 1.0000 2.0000 0.0000 Constraint 222 439 0.8000 1.0000 2.0000 0.0000 Constraint 222 431 0.8000 1.0000 2.0000 0.0000 Constraint 222 422 0.8000 1.0000 2.0000 0.0000 Constraint 222 417 0.8000 1.0000 2.0000 0.0000 Constraint 222 408 0.8000 1.0000 2.0000 0.0000 Constraint 222 402 0.8000 1.0000 2.0000 0.0000 Constraint 222 394 0.8000 1.0000 2.0000 0.0000 Constraint 222 386 0.8000 1.0000 2.0000 0.0000 Constraint 222 380 0.8000 1.0000 2.0000 0.0000 Constraint 222 373 0.8000 1.0000 2.0000 0.0000 Constraint 222 351 0.8000 1.0000 2.0000 0.0000 Constraint 222 343 0.8000 1.0000 2.0000 0.0000 Constraint 222 335 0.8000 1.0000 2.0000 0.0000 Constraint 222 317 0.8000 1.0000 2.0000 0.0000 Constraint 222 309 0.8000 1.0000 2.0000 0.0000 Constraint 222 282 0.8000 1.0000 2.0000 0.0000 Constraint 222 275 0.8000 1.0000 2.0000 0.0000 Constraint 222 266 0.8000 1.0000 2.0000 0.0000 Constraint 222 257 0.8000 1.0000 2.0000 0.0000 Constraint 222 249 0.8000 1.0000 2.0000 0.0000 Constraint 222 237 0.8000 1.0000 2.0000 0.0000 Constraint 222 229 0.8000 1.0000 2.0000 0.0000 Constraint 214 1476 0.8000 1.0000 2.0000 0.0000 Constraint 214 1467 0.8000 1.0000 2.0000 0.0000 Constraint 214 1451 0.8000 1.0000 2.0000 0.0000 Constraint 214 1442 0.8000 1.0000 2.0000 0.0000 Constraint 214 1421 0.8000 1.0000 2.0000 0.0000 Constraint 214 1413 0.8000 1.0000 2.0000 0.0000 Constraint 214 1386 0.8000 1.0000 2.0000 0.0000 Constraint 214 1381 0.8000 1.0000 2.0000 0.0000 Constraint 214 1373 0.8000 1.0000 2.0000 0.0000 Constraint 214 1362 0.8000 1.0000 2.0000 0.0000 Constraint 214 1354 0.8000 1.0000 2.0000 0.0000 Constraint 214 1347 0.8000 1.0000 2.0000 0.0000 Constraint 214 1339 0.8000 1.0000 2.0000 0.0000 Constraint 214 1329 0.8000 1.0000 2.0000 0.0000 Constraint 214 1318 0.8000 1.0000 2.0000 0.0000 Constraint 214 1306 0.8000 1.0000 2.0000 0.0000 Constraint 214 1295 0.8000 1.0000 2.0000 0.0000 Constraint 214 1288 0.8000 1.0000 2.0000 0.0000 Constraint 214 1281 0.8000 1.0000 2.0000 0.0000 Constraint 214 1272 0.8000 1.0000 2.0000 0.0000 Constraint 214 1264 0.8000 1.0000 2.0000 0.0000 Constraint 214 1244 0.8000 1.0000 2.0000 0.0000 Constraint 214 1235 0.8000 1.0000 2.0000 0.0000 Constraint 214 1208 0.8000 1.0000 2.0000 0.0000 Constraint 214 1201 0.8000 1.0000 2.0000 0.0000 Constraint 214 1186 0.8000 1.0000 2.0000 0.0000 Constraint 214 1174 0.8000 1.0000 2.0000 0.0000 Constraint 214 1168 0.8000 1.0000 2.0000 0.0000 Constraint 214 1159 0.8000 1.0000 2.0000 0.0000 Constraint 214 1150 0.8000 1.0000 2.0000 0.0000 Constraint 214 1144 0.8000 1.0000 2.0000 0.0000 Constraint 214 1133 0.8000 1.0000 2.0000 0.0000 Constraint 214 1124 0.8000 1.0000 2.0000 0.0000 Constraint 214 1106 0.8000 1.0000 2.0000 0.0000 Constraint 214 1095 0.8000 1.0000 2.0000 0.0000 Constraint 214 1087 0.8000 1.0000 2.0000 0.0000 Constraint 214 1066 0.8000 1.0000 2.0000 0.0000 Constraint 214 1015 0.8000 1.0000 2.0000 0.0000 Constraint 214 1007 0.8000 1.0000 2.0000 0.0000 Constraint 214 981 0.8000 1.0000 2.0000 0.0000 Constraint 214 967 0.8000 1.0000 2.0000 0.0000 Constraint 214 958 0.8000 1.0000 2.0000 0.0000 Constraint 214 944 0.8000 1.0000 2.0000 0.0000 Constraint 214 939 0.8000 1.0000 2.0000 0.0000 Constraint 214 924 0.8000 1.0000 2.0000 0.0000 Constraint 214 915 0.8000 1.0000 2.0000 0.0000 Constraint 214 907 0.8000 1.0000 2.0000 0.0000 Constraint 214 900 0.8000 1.0000 2.0000 0.0000 Constraint 214 892 0.8000 1.0000 2.0000 0.0000 Constraint 214 884 0.8000 1.0000 2.0000 0.0000 Constraint 214 814 0.8000 1.0000 2.0000 0.0000 Constraint 214 794 0.8000 1.0000 2.0000 0.0000 Constraint 214 789 0.8000 1.0000 2.0000 0.0000 Constraint 214 773 0.8000 1.0000 2.0000 0.0000 Constraint 214 762 0.8000 1.0000 2.0000 0.0000 Constraint 214 756 0.8000 1.0000 2.0000 0.0000 Constraint 214 716 0.8000 1.0000 2.0000 0.0000 Constraint 214 700 0.8000 1.0000 2.0000 0.0000 Constraint 214 691 0.8000 1.0000 2.0000 0.0000 Constraint 214 669 0.8000 1.0000 2.0000 0.0000 Constraint 214 660 0.8000 1.0000 2.0000 0.0000 Constraint 214 641 0.8000 1.0000 2.0000 0.0000 Constraint 214 618 0.8000 1.0000 2.0000 0.0000 Constraint 214 610 0.8000 1.0000 2.0000 0.0000 Constraint 214 579 0.8000 1.0000 2.0000 0.0000 Constraint 214 544 0.8000 1.0000 2.0000 0.0000 Constraint 214 510 0.8000 1.0000 2.0000 0.0000 Constraint 214 431 0.8000 1.0000 2.0000 0.0000 Constraint 214 422 0.8000 1.0000 2.0000 0.0000 Constraint 214 417 0.8000 1.0000 2.0000 0.0000 Constraint 214 408 0.8000 1.0000 2.0000 0.0000 Constraint 214 402 0.8000 1.0000 2.0000 0.0000 Constraint 214 386 0.8000 1.0000 2.0000 0.0000 Constraint 214 335 0.8000 1.0000 2.0000 0.0000 Constraint 214 275 0.8000 1.0000 2.0000 0.0000 Constraint 214 266 0.8000 1.0000 2.0000 0.0000 Constraint 214 257 0.8000 1.0000 2.0000 0.0000 Constraint 214 249 0.8000 1.0000 2.0000 0.0000 Constraint 214 237 0.8000 1.0000 2.0000 0.0000 Constraint 214 229 0.8000 1.0000 2.0000 0.0000 Constraint 214 222 0.8000 1.0000 2.0000 0.0000 Constraint 205 1476 0.8000 1.0000 2.0000 0.0000 Constraint 205 1467 0.8000 1.0000 2.0000 0.0000 Constraint 205 1459 0.8000 1.0000 2.0000 0.0000 Constraint 205 1451 0.8000 1.0000 2.0000 0.0000 Constraint 205 1442 0.8000 1.0000 2.0000 0.0000 Constraint 205 1421 0.8000 1.0000 2.0000 0.0000 Constraint 205 1413 0.8000 1.0000 2.0000 0.0000 Constraint 205 1395 0.8000 1.0000 2.0000 0.0000 Constraint 205 1386 0.8000 1.0000 2.0000 0.0000 Constraint 205 1381 0.8000 1.0000 2.0000 0.0000 Constraint 205 1373 0.8000 1.0000 2.0000 0.0000 Constraint 205 1362 0.8000 1.0000 2.0000 0.0000 Constraint 205 1354 0.8000 1.0000 2.0000 0.0000 Constraint 205 1347 0.8000 1.0000 2.0000 0.0000 Constraint 205 1339 0.8000 1.0000 2.0000 0.0000 Constraint 205 1329 0.8000 1.0000 2.0000 0.0000 Constraint 205 1318 0.8000 1.0000 2.0000 0.0000 Constraint 205 1306 0.8000 1.0000 2.0000 0.0000 Constraint 205 1295 0.8000 1.0000 2.0000 0.0000 Constraint 205 1288 0.8000 1.0000 2.0000 0.0000 Constraint 205 1281 0.8000 1.0000 2.0000 0.0000 Constraint 205 1272 0.8000 1.0000 2.0000 0.0000 Constraint 205 1264 0.8000 1.0000 2.0000 0.0000 Constraint 205 1244 0.8000 1.0000 2.0000 0.0000 Constraint 205 1235 0.8000 1.0000 2.0000 0.0000 Constraint 205 1208 0.8000 1.0000 2.0000 0.0000 Constraint 205 1186 0.8000 1.0000 2.0000 0.0000 Constraint 205 1168 0.8000 1.0000 2.0000 0.0000 Constraint 205 1159 0.8000 1.0000 2.0000 0.0000 Constraint 205 1150 0.8000 1.0000 2.0000 0.0000 Constraint 205 1144 0.8000 1.0000 2.0000 0.0000 Constraint 205 1133 0.8000 1.0000 2.0000 0.0000 Constraint 205 1124 0.8000 1.0000 2.0000 0.0000 Constraint 205 1039 0.8000 1.0000 2.0000 0.0000 Constraint 205 1031 0.8000 1.0000 2.0000 0.0000 Constraint 205 1024 0.8000 1.0000 2.0000 0.0000 Constraint 205 1015 0.8000 1.0000 2.0000 0.0000 Constraint 205 1007 0.8000 1.0000 2.0000 0.0000 Constraint 205 990 0.8000 1.0000 2.0000 0.0000 Constraint 205 944 0.8000 1.0000 2.0000 0.0000 Constraint 205 939 0.8000 1.0000 2.0000 0.0000 Constraint 205 924 0.8000 1.0000 2.0000 0.0000 Constraint 205 915 0.8000 1.0000 2.0000 0.0000 Constraint 205 907 0.8000 1.0000 2.0000 0.0000 Constraint 205 892 0.8000 1.0000 2.0000 0.0000 Constraint 205 884 0.8000 1.0000 2.0000 0.0000 Constraint 205 833 0.8000 1.0000 2.0000 0.0000 Constraint 205 822 0.8000 1.0000 2.0000 0.0000 Constraint 205 814 0.8000 1.0000 2.0000 0.0000 Constraint 205 805 0.8000 1.0000 2.0000 0.0000 Constraint 205 794 0.8000 1.0000 2.0000 0.0000 Constraint 205 789 0.8000 1.0000 2.0000 0.0000 Constraint 205 781 0.8000 1.0000 2.0000 0.0000 Constraint 205 773 0.8000 1.0000 2.0000 0.0000 Constraint 205 762 0.8000 1.0000 2.0000 0.0000 Constraint 205 756 0.8000 1.0000 2.0000 0.0000 Constraint 205 742 0.8000 1.0000 2.0000 0.0000 Constraint 205 691 0.8000 1.0000 2.0000 0.0000 Constraint 205 669 0.8000 1.0000 2.0000 0.0000 Constraint 205 660 0.8000 1.0000 2.0000 0.0000 Constraint 205 649 0.8000 1.0000 2.0000 0.0000 Constraint 205 641 0.8000 1.0000 2.0000 0.0000 Constraint 205 618 0.8000 1.0000 2.0000 0.0000 Constraint 205 610 0.8000 1.0000 2.0000 0.0000 Constraint 205 579 0.8000 1.0000 2.0000 0.0000 Constraint 205 551 0.8000 1.0000 2.0000 0.0000 Constraint 205 544 0.8000 1.0000 2.0000 0.0000 Constraint 205 532 0.8000 1.0000 2.0000 0.0000 Constraint 205 515 0.8000 1.0000 2.0000 0.0000 Constraint 205 510 0.8000 1.0000 2.0000 0.0000 Constraint 205 488 0.8000 1.0000 2.0000 0.0000 Constraint 205 481 0.8000 1.0000 2.0000 0.0000 Constraint 205 472 0.8000 1.0000 2.0000 0.0000 Constraint 205 446 0.8000 1.0000 2.0000 0.0000 Constraint 205 439 0.8000 1.0000 2.0000 0.0000 Constraint 205 417 0.8000 1.0000 2.0000 0.0000 Constraint 205 408 0.8000 1.0000 2.0000 0.0000 Constraint 205 402 0.8000 1.0000 2.0000 0.0000 Constraint 205 394 0.8000 1.0000 2.0000 0.0000 Constraint 205 386 0.8000 1.0000 2.0000 0.0000 Constraint 205 380 0.8000 1.0000 2.0000 0.0000 Constraint 205 351 0.8000 1.0000 2.0000 0.0000 Constraint 205 317 0.8000 1.0000 2.0000 0.0000 Constraint 205 309 0.8000 1.0000 2.0000 0.0000 Constraint 205 297 0.8000 1.0000 2.0000 0.0000 Constraint 205 291 0.8000 1.0000 2.0000 0.0000 Constraint 205 282 0.8000 1.0000 2.0000 0.0000 Constraint 205 266 0.8000 1.0000 2.0000 0.0000 Constraint 205 257 0.8000 1.0000 2.0000 0.0000 Constraint 205 249 0.8000 1.0000 2.0000 0.0000 Constraint 205 237 0.8000 1.0000 2.0000 0.0000 Constraint 205 229 0.8000 1.0000 2.0000 0.0000 Constraint 205 222 0.8000 1.0000 2.0000 0.0000 Constraint 205 214 0.8000 1.0000 2.0000 0.0000 Constraint 196 1476 0.8000 1.0000 2.0000 0.0000 Constraint 196 1467 0.8000 1.0000 2.0000 0.0000 Constraint 196 1459 0.8000 1.0000 2.0000 0.0000 Constraint 196 1451 0.8000 1.0000 2.0000 0.0000 Constraint 196 1442 0.8000 1.0000 2.0000 0.0000 Constraint 196 1430 0.8000 1.0000 2.0000 0.0000 Constraint 196 1421 0.8000 1.0000 2.0000 0.0000 Constraint 196 1413 0.8000 1.0000 2.0000 0.0000 Constraint 196 1402 0.8000 1.0000 2.0000 0.0000 Constraint 196 1395 0.8000 1.0000 2.0000 0.0000 Constraint 196 1386 0.8000 1.0000 2.0000 0.0000 Constraint 196 1381 0.8000 1.0000 2.0000 0.0000 Constraint 196 1373 0.8000 1.0000 2.0000 0.0000 Constraint 196 1362 0.8000 1.0000 2.0000 0.0000 Constraint 196 1354 0.8000 1.0000 2.0000 0.0000 Constraint 196 1347 0.8000 1.0000 2.0000 0.0000 Constraint 196 1339 0.8000 1.0000 2.0000 0.0000 Constraint 196 1329 0.8000 1.0000 2.0000 0.0000 Constraint 196 1318 0.8000 1.0000 2.0000 0.0000 Constraint 196 1306 0.8000 1.0000 2.0000 0.0000 Constraint 196 1295 0.8000 1.0000 2.0000 0.0000 Constraint 196 1288 0.8000 1.0000 2.0000 0.0000 Constraint 196 1281 0.8000 1.0000 2.0000 0.0000 Constraint 196 1272 0.8000 1.0000 2.0000 0.0000 Constraint 196 1264 0.8000 1.0000 2.0000 0.0000 Constraint 196 1256 0.8000 1.0000 2.0000 0.0000 Constraint 196 1235 0.8000 1.0000 2.0000 0.0000 Constraint 196 1225 0.8000 1.0000 2.0000 0.0000 Constraint 196 1213 0.8000 1.0000 2.0000 0.0000 Constraint 196 1208 0.8000 1.0000 2.0000 0.0000 Constraint 196 1201 0.8000 1.0000 2.0000 0.0000 Constraint 196 1192 0.8000 1.0000 2.0000 0.0000 Constraint 196 1186 0.8000 1.0000 2.0000 0.0000 Constraint 196 1174 0.8000 1.0000 2.0000 0.0000 Constraint 196 1168 0.8000 1.0000 2.0000 0.0000 Constraint 196 1159 0.8000 1.0000 2.0000 0.0000 Constraint 196 1150 0.8000 1.0000 2.0000 0.0000 Constraint 196 1133 0.8000 1.0000 2.0000 0.0000 Constraint 196 1124 0.8000 1.0000 2.0000 0.0000 Constraint 196 1087 0.8000 1.0000 2.0000 0.0000 Constraint 196 1066 0.8000 1.0000 2.0000 0.0000 Constraint 196 1051 0.8000 1.0000 2.0000 0.0000 Constraint 196 1039 0.8000 1.0000 2.0000 0.0000 Constraint 196 1031 0.8000 1.0000 2.0000 0.0000 Constraint 196 1024 0.8000 1.0000 2.0000 0.0000 Constraint 196 1015 0.8000 1.0000 2.0000 0.0000 Constraint 196 1007 0.8000 1.0000 2.0000 0.0000 Constraint 196 998 0.8000 1.0000 2.0000 0.0000 Constraint 196 990 0.8000 1.0000 2.0000 0.0000 Constraint 196 981 0.8000 1.0000 2.0000 0.0000 Constraint 196 967 0.8000 1.0000 2.0000 0.0000 Constraint 196 958 0.8000 1.0000 2.0000 0.0000 Constraint 196 951 0.8000 1.0000 2.0000 0.0000 Constraint 196 939 0.8000 1.0000 2.0000 0.0000 Constraint 196 931 0.8000 1.0000 2.0000 0.0000 Constraint 196 924 0.8000 1.0000 2.0000 0.0000 Constraint 196 915 0.8000 1.0000 2.0000 0.0000 Constraint 196 907 0.8000 1.0000 2.0000 0.0000 Constraint 196 900 0.8000 1.0000 2.0000 0.0000 Constraint 196 892 0.8000 1.0000 2.0000 0.0000 Constraint 196 884 0.8000 1.0000 2.0000 0.0000 Constraint 196 871 0.8000 1.0000 2.0000 0.0000 Constraint 196 864 0.8000 1.0000 2.0000 0.0000 Constraint 196 852 0.8000 1.0000 2.0000 0.0000 Constraint 196 841 0.8000 1.0000 2.0000 0.0000 Constraint 196 822 0.8000 1.0000 2.0000 0.0000 Constraint 196 814 0.8000 1.0000 2.0000 0.0000 Constraint 196 805 0.8000 1.0000 2.0000 0.0000 Constraint 196 794 0.8000 1.0000 2.0000 0.0000 Constraint 196 789 0.8000 1.0000 2.0000 0.0000 Constraint 196 781 0.8000 1.0000 2.0000 0.0000 Constraint 196 773 0.8000 1.0000 2.0000 0.0000 Constraint 196 762 0.8000 1.0000 2.0000 0.0000 Constraint 196 723 0.8000 1.0000 2.0000 0.0000 Constraint 196 691 0.8000 1.0000 2.0000 0.0000 Constraint 196 683 0.8000 1.0000 2.0000 0.0000 Constraint 196 669 0.8000 1.0000 2.0000 0.0000 Constraint 196 660 0.8000 1.0000 2.0000 0.0000 Constraint 196 649 0.8000 1.0000 2.0000 0.0000 Constraint 196 632 0.8000 1.0000 2.0000 0.0000 Constraint 196 618 0.8000 1.0000 2.0000 0.0000 Constraint 196 610 0.8000 1.0000 2.0000 0.0000 Constraint 196 522 0.8000 1.0000 2.0000 0.0000 Constraint 196 515 0.8000 1.0000 2.0000 0.0000 Constraint 196 472 0.8000 1.0000 2.0000 0.0000 Constraint 196 464 0.8000 1.0000 2.0000 0.0000 Constraint 196 446 0.8000 1.0000 2.0000 0.0000 Constraint 196 439 0.8000 1.0000 2.0000 0.0000 Constraint 196 431 0.8000 1.0000 2.0000 0.0000 Constraint 196 422 0.8000 1.0000 2.0000 0.0000 Constraint 196 417 0.8000 1.0000 2.0000 0.0000 Constraint 196 408 0.8000 1.0000 2.0000 0.0000 Constraint 196 386 0.8000 1.0000 2.0000 0.0000 Constraint 196 380 0.8000 1.0000 2.0000 0.0000 Constraint 196 351 0.8000 1.0000 2.0000 0.0000 Constraint 196 343 0.8000 1.0000 2.0000 0.0000 Constraint 196 335 0.8000 1.0000 2.0000 0.0000 Constraint 196 309 0.8000 1.0000 2.0000 0.0000 Constraint 196 297 0.8000 1.0000 2.0000 0.0000 Constraint 196 282 0.8000 1.0000 2.0000 0.0000 Constraint 196 257 0.8000 1.0000 2.0000 0.0000 Constraint 196 249 0.8000 1.0000 2.0000 0.0000 Constraint 196 237 0.8000 1.0000 2.0000 0.0000 Constraint 196 229 0.8000 1.0000 2.0000 0.0000 Constraint 196 222 0.8000 1.0000 2.0000 0.0000 Constraint 196 214 0.8000 1.0000 2.0000 0.0000 Constraint 196 205 0.8000 1.0000 2.0000 0.0000 Constraint 185 1476 0.8000 1.0000 2.0000 0.0000 Constraint 185 1467 0.8000 1.0000 2.0000 0.0000 Constraint 185 1459 0.8000 1.0000 2.0000 0.0000 Constraint 185 1451 0.8000 1.0000 2.0000 0.0000 Constraint 185 1442 0.8000 1.0000 2.0000 0.0000 Constraint 185 1430 0.8000 1.0000 2.0000 0.0000 Constraint 185 1421 0.8000 1.0000 2.0000 0.0000 Constraint 185 1413 0.8000 1.0000 2.0000 0.0000 Constraint 185 1402 0.8000 1.0000 2.0000 0.0000 Constraint 185 1395 0.8000 1.0000 2.0000 0.0000 Constraint 185 1386 0.8000 1.0000 2.0000 0.0000 Constraint 185 1381 0.8000 1.0000 2.0000 0.0000 Constraint 185 1373 0.8000 1.0000 2.0000 0.0000 Constraint 185 1362 0.8000 1.0000 2.0000 0.0000 Constraint 185 1354 0.8000 1.0000 2.0000 0.0000 Constraint 185 1347 0.8000 1.0000 2.0000 0.0000 Constraint 185 1339 0.8000 1.0000 2.0000 0.0000 Constraint 185 1329 0.8000 1.0000 2.0000 0.0000 Constraint 185 1318 0.8000 1.0000 2.0000 0.0000 Constraint 185 1306 0.8000 1.0000 2.0000 0.0000 Constraint 185 1295 0.8000 1.0000 2.0000 0.0000 Constraint 185 1288 0.8000 1.0000 2.0000 0.0000 Constraint 185 1281 0.8000 1.0000 2.0000 0.0000 Constraint 185 1272 0.8000 1.0000 2.0000 0.0000 Constraint 185 1264 0.8000 1.0000 2.0000 0.0000 Constraint 185 1235 0.8000 1.0000 2.0000 0.0000 Constraint 185 1225 0.8000 1.0000 2.0000 0.0000 Constraint 185 1201 0.8000 1.0000 2.0000 0.0000 Constraint 185 1192 0.8000 1.0000 2.0000 0.0000 Constraint 185 1186 0.8000 1.0000 2.0000 0.0000 Constraint 185 1174 0.8000 1.0000 2.0000 0.0000 Constraint 185 1168 0.8000 1.0000 2.0000 0.0000 Constraint 185 1150 0.8000 1.0000 2.0000 0.0000 Constraint 185 1133 0.8000 1.0000 2.0000 0.0000 Constraint 185 1106 0.8000 1.0000 2.0000 0.0000 Constraint 185 1095 0.8000 1.0000 2.0000 0.0000 Constraint 185 1087 0.8000 1.0000 2.0000 0.0000 Constraint 185 1075 0.8000 1.0000 2.0000 0.0000 Constraint 185 1066 0.8000 1.0000 2.0000 0.0000 Constraint 185 1039 0.8000 1.0000 2.0000 0.0000 Constraint 185 1031 0.8000 1.0000 2.0000 0.0000 Constraint 185 1024 0.8000 1.0000 2.0000 0.0000 Constraint 185 1015 0.8000 1.0000 2.0000 0.0000 Constraint 185 1007 0.8000 1.0000 2.0000 0.0000 Constraint 185 998 0.8000 1.0000 2.0000 0.0000 Constraint 185 981 0.8000 1.0000 2.0000 0.0000 Constraint 185 958 0.8000 1.0000 2.0000 0.0000 Constraint 185 939 0.8000 1.0000 2.0000 0.0000 Constraint 185 931 0.8000 1.0000 2.0000 0.0000 Constraint 185 924 0.8000 1.0000 2.0000 0.0000 Constraint 185 915 0.8000 1.0000 2.0000 0.0000 Constraint 185 907 0.8000 1.0000 2.0000 0.0000 Constraint 185 900 0.8000 1.0000 2.0000 0.0000 Constraint 185 892 0.8000 1.0000 2.0000 0.0000 Constraint 185 884 0.8000 1.0000 2.0000 0.0000 Constraint 185 871 0.8000 1.0000 2.0000 0.0000 Constraint 185 864 0.8000 1.0000 2.0000 0.0000 Constraint 185 852 0.8000 1.0000 2.0000 0.0000 Constraint 185 841 0.8000 1.0000 2.0000 0.0000 Constraint 185 822 0.8000 1.0000 2.0000 0.0000 Constraint 185 814 0.8000 1.0000 2.0000 0.0000 Constraint 185 794 0.8000 1.0000 2.0000 0.0000 Constraint 185 789 0.8000 1.0000 2.0000 0.0000 Constraint 185 773 0.8000 1.0000 2.0000 0.0000 Constraint 185 742 0.8000 1.0000 2.0000 0.0000 Constraint 185 716 0.8000 1.0000 2.0000 0.0000 Constraint 185 660 0.8000 1.0000 2.0000 0.0000 Constraint 185 649 0.8000 1.0000 2.0000 0.0000 Constraint 185 641 0.8000 1.0000 2.0000 0.0000 Constraint 185 632 0.8000 1.0000 2.0000 0.0000 Constraint 185 618 0.8000 1.0000 2.0000 0.0000 Constraint 185 610 0.8000 1.0000 2.0000 0.0000 Constraint 185 596 0.8000 1.0000 2.0000 0.0000 Constraint 185 472 0.8000 1.0000 2.0000 0.0000 Constraint 185 439 0.8000 1.0000 2.0000 0.0000 Constraint 185 431 0.8000 1.0000 2.0000 0.0000 Constraint 185 422 0.8000 1.0000 2.0000 0.0000 Constraint 185 417 0.8000 1.0000 2.0000 0.0000 Constraint 185 408 0.8000 1.0000 2.0000 0.0000 Constraint 185 402 0.8000 1.0000 2.0000 0.0000 Constraint 185 394 0.8000 1.0000 2.0000 0.0000 Constraint 185 386 0.8000 1.0000 2.0000 0.0000 Constraint 185 380 0.8000 1.0000 2.0000 0.0000 Constraint 185 249 0.8000 1.0000 2.0000 0.0000 Constraint 185 237 0.8000 1.0000 2.0000 0.0000 Constraint 185 229 0.8000 1.0000 2.0000 0.0000 Constraint 185 222 0.8000 1.0000 2.0000 0.0000 Constraint 185 214 0.8000 1.0000 2.0000 0.0000 Constraint 185 205 0.8000 1.0000 2.0000 0.0000 Constraint 185 196 0.8000 1.0000 2.0000 0.0000 Constraint 177 1476 0.8000 1.0000 2.0000 0.0000 Constraint 177 1467 0.8000 1.0000 2.0000 0.0000 Constraint 177 1459 0.8000 1.0000 2.0000 0.0000 Constraint 177 1451 0.8000 1.0000 2.0000 0.0000 Constraint 177 1442 0.8000 1.0000 2.0000 0.0000 Constraint 177 1421 0.8000 1.0000 2.0000 0.0000 Constraint 177 1413 0.8000 1.0000 2.0000 0.0000 Constraint 177 1386 0.8000 1.0000 2.0000 0.0000 Constraint 177 1381 0.8000 1.0000 2.0000 0.0000 Constraint 177 1373 0.8000 1.0000 2.0000 0.0000 Constraint 177 1362 0.8000 1.0000 2.0000 0.0000 Constraint 177 1354 0.8000 1.0000 2.0000 0.0000 Constraint 177 1347 0.8000 1.0000 2.0000 0.0000 Constraint 177 1339 0.8000 1.0000 2.0000 0.0000 Constraint 177 1329 0.8000 1.0000 2.0000 0.0000 Constraint 177 1318 0.8000 1.0000 2.0000 0.0000 Constraint 177 1306 0.8000 1.0000 2.0000 0.0000 Constraint 177 1295 0.8000 1.0000 2.0000 0.0000 Constraint 177 1288 0.8000 1.0000 2.0000 0.0000 Constraint 177 1281 0.8000 1.0000 2.0000 0.0000 Constraint 177 1272 0.8000 1.0000 2.0000 0.0000 Constraint 177 1244 0.8000 1.0000 2.0000 0.0000 Constraint 177 1235 0.8000 1.0000 2.0000 0.0000 Constraint 177 1208 0.8000 1.0000 2.0000 0.0000 Constraint 177 1201 0.8000 1.0000 2.0000 0.0000 Constraint 177 1186 0.8000 1.0000 2.0000 0.0000 Constraint 177 1168 0.8000 1.0000 2.0000 0.0000 Constraint 177 1159 0.8000 1.0000 2.0000 0.0000 Constraint 177 1150 0.8000 1.0000 2.0000 0.0000 Constraint 177 1144 0.8000 1.0000 2.0000 0.0000 Constraint 177 1133 0.8000 1.0000 2.0000 0.0000 Constraint 177 1124 0.8000 1.0000 2.0000 0.0000 Constraint 177 1095 0.8000 1.0000 2.0000 0.0000 Constraint 177 1015 0.8000 1.0000 2.0000 0.0000 Constraint 177 973 0.8000 1.0000 2.0000 0.0000 Constraint 177 944 0.8000 1.0000 2.0000 0.0000 Constraint 177 939 0.8000 1.0000 2.0000 0.0000 Constraint 177 915 0.8000 1.0000 2.0000 0.0000 Constraint 177 892 0.8000 1.0000 2.0000 0.0000 Constraint 177 871 0.8000 1.0000 2.0000 0.0000 Constraint 177 773 0.8000 1.0000 2.0000 0.0000 Constraint 177 762 0.8000 1.0000 2.0000 0.0000 Constraint 177 756 0.8000 1.0000 2.0000 0.0000 Constraint 177 742 0.8000 1.0000 2.0000 0.0000 Constraint 177 723 0.8000 1.0000 2.0000 0.0000 Constraint 177 716 0.8000 1.0000 2.0000 0.0000 Constraint 177 700 0.8000 1.0000 2.0000 0.0000 Constraint 177 691 0.8000 1.0000 2.0000 0.0000 Constraint 177 669 0.8000 1.0000 2.0000 0.0000 Constraint 177 660 0.8000 1.0000 2.0000 0.0000 Constraint 177 632 0.8000 1.0000 2.0000 0.0000 Constraint 177 618 0.8000 1.0000 2.0000 0.0000 Constraint 177 562 0.8000 1.0000 2.0000 0.0000 Constraint 177 510 0.8000 1.0000 2.0000 0.0000 Constraint 177 439 0.8000 1.0000 2.0000 0.0000 Constraint 177 431 0.8000 1.0000 2.0000 0.0000 Constraint 177 417 0.8000 1.0000 2.0000 0.0000 Constraint 177 408 0.8000 1.0000 2.0000 0.0000 Constraint 177 402 0.8000 1.0000 2.0000 0.0000 Constraint 177 394 0.8000 1.0000 2.0000 0.0000 Constraint 177 386 0.8000 1.0000 2.0000 0.0000 Constraint 177 237 0.8000 1.0000 2.0000 0.0000 Constraint 177 229 0.8000 1.0000 2.0000 0.0000 Constraint 177 222 0.8000 1.0000 2.0000 0.0000 Constraint 177 214 0.8000 1.0000 2.0000 0.0000 Constraint 177 205 0.8000 1.0000 2.0000 0.0000 Constraint 177 196 0.8000 1.0000 2.0000 0.0000 Constraint 177 185 0.8000 1.0000 2.0000 0.0000 Constraint 168 1476 0.8000 1.0000 2.0000 0.0000 Constraint 168 1467 0.8000 1.0000 2.0000 0.0000 Constraint 168 1459 0.8000 1.0000 2.0000 0.0000 Constraint 168 1451 0.8000 1.0000 2.0000 0.0000 Constraint 168 1442 0.8000 1.0000 2.0000 0.0000 Constraint 168 1430 0.8000 1.0000 2.0000 0.0000 Constraint 168 1421 0.8000 1.0000 2.0000 0.0000 Constraint 168 1413 0.8000 1.0000 2.0000 0.0000 Constraint 168 1395 0.8000 1.0000 2.0000 0.0000 Constraint 168 1386 0.8000 1.0000 2.0000 0.0000 Constraint 168 1381 0.8000 1.0000 2.0000 0.0000 Constraint 168 1373 0.8000 1.0000 2.0000 0.0000 Constraint 168 1362 0.8000 1.0000 2.0000 0.0000 Constraint 168 1354 0.8000 1.0000 2.0000 0.0000 Constraint 168 1347 0.8000 1.0000 2.0000 0.0000 Constraint 168 1339 0.8000 1.0000 2.0000 0.0000 Constraint 168 1329 0.8000 1.0000 2.0000 0.0000 Constraint 168 1318 0.8000 1.0000 2.0000 0.0000 Constraint 168 1306 0.8000 1.0000 2.0000 0.0000 Constraint 168 1295 0.8000 1.0000 2.0000 0.0000 Constraint 168 1288 0.8000 1.0000 2.0000 0.0000 Constraint 168 1281 0.8000 1.0000 2.0000 0.0000 Constraint 168 1272 0.8000 1.0000 2.0000 0.0000 Constraint 168 1264 0.8000 1.0000 2.0000 0.0000 Constraint 168 1256 0.8000 1.0000 2.0000 0.0000 Constraint 168 1244 0.8000 1.0000 2.0000 0.0000 Constraint 168 1213 0.8000 1.0000 2.0000 0.0000 Constraint 168 1208 0.8000 1.0000 2.0000 0.0000 Constraint 168 1201 0.8000 1.0000 2.0000 0.0000 Constraint 168 1186 0.8000 1.0000 2.0000 0.0000 Constraint 168 1168 0.8000 1.0000 2.0000 0.0000 Constraint 168 1159 0.8000 1.0000 2.0000 0.0000 Constraint 168 1150 0.8000 1.0000 2.0000 0.0000 Constraint 168 1144 0.8000 1.0000 2.0000 0.0000 Constraint 168 1133 0.8000 1.0000 2.0000 0.0000 Constraint 168 1124 0.8000 1.0000 2.0000 0.0000 Constraint 168 1087 0.8000 1.0000 2.0000 0.0000 Constraint 168 1075 0.8000 1.0000 2.0000 0.0000 Constraint 168 1039 0.8000 1.0000 2.0000 0.0000 Constraint 168 1031 0.8000 1.0000 2.0000 0.0000 Constraint 168 1024 0.8000 1.0000 2.0000 0.0000 Constraint 168 1015 0.8000 1.0000 2.0000 0.0000 Constraint 168 1007 0.8000 1.0000 2.0000 0.0000 Constraint 168 998 0.8000 1.0000 2.0000 0.0000 Constraint 168 990 0.8000 1.0000 2.0000 0.0000 Constraint 168 973 0.8000 1.0000 2.0000 0.0000 Constraint 168 958 0.8000 1.0000 2.0000 0.0000 Constraint 168 951 0.8000 1.0000 2.0000 0.0000 Constraint 168 944 0.8000 1.0000 2.0000 0.0000 Constraint 168 939 0.8000 1.0000 2.0000 0.0000 Constraint 168 931 0.8000 1.0000 2.0000 0.0000 Constraint 168 924 0.8000 1.0000 2.0000 0.0000 Constraint 168 915 0.8000 1.0000 2.0000 0.0000 Constraint 168 907 0.8000 1.0000 2.0000 0.0000 Constraint 168 892 0.8000 1.0000 2.0000 0.0000 Constraint 168 884 0.8000 1.0000 2.0000 0.0000 Constraint 168 871 0.8000 1.0000 2.0000 0.0000 Constraint 168 864 0.8000 1.0000 2.0000 0.0000 Constraint 168 852 0.8000 1.0000 2.0000 0.0000 Constraint 168 841 0.8000 1.0000 2.0000 0.0000 Constraint 168 794 0.8000 1.0000 2.0000 0.0000 Constraint 168 781 0.8000 1.0000 2.0000 0.0000 Constraint 168 773 0.8000 1.0000 2.0000 0.0000 Constraint 168 762 0.8000 1.0000 2.0000 0.0000 Constraint 168 756 0.8000 1.0000 2.0000 0.0000 Constraint 168 723 0.8000 1.0000 2.0000 0.0000 Constraint 168 716 0.8000 1.0000 2.0000 0.0000 Constraint 168 700 0.8000 1.0000 2.0000 0.0000 Constraint 168 691 0.8000 1.0000 2.0000 0.0000 Constraint 168 683 0.8000 1.0000 2.0000 0.0000 Constraint 168 674 0.8000 1.0000 2.0000 0.0000 Constraint 168 669 0.8000 1.0000 2.0000 0.0000 Constraint 168 660 0.8000 1.0000 2.0000 0.0000 Constraint 168 649 0.8000 1.0000 2.0000 0.0000 Constraint 168 632 0.8000 1.0000 2.0000 0.0000 Constraint 168 624 0.8000 1.0000 2.0000 0.0000 Constraint 168 618 0.8000 1.0000 2.0000 0.0000 Constraint 168 610 0.8000 1.0000 2.0000 0.0000 Constraint 168 602 0.8000 1.0000 2.0000 0.0000 Constraint 168 596 0.8000 1.0000 2.0000 0.0000 Constraint 168 585 0.8000 1.0000 2.0000 0.0000 Constraint 168 579 0.8000 1.0000 2.0000 0.0000 Constraint 168 562 0.8000 1.0000 2.0000 0.0000 Constraint 168 551 0.8000 1.0000 2.0000 0.0000 Constraint 168 515 0.8000 1.0000 2.0000 0.0000 Constraint 168 510 0.8000 1.0000 2.0000 0.0000 Constraint 168 472 0.8000 1.0000 2.0000 0.0000 Constraint 168 446 0.8000 1.0000 2.0000 0.0000 Constraint 168 439 0.8000 1.0000 2.0000 0.0000 Constraint 168 431 0.8000 1.0000 2.0000 0.0000 Constraint 168 422 0.8000 1.0000 2.0000 0.0000 Constraint 168 417 0.8000 1.0000 2.0000 0.0000 Constraint 168 408 0.8000 1.0000 2.0000 0.0000 Constraint 168 402 0.8000 1.0000 2.0000 0.0000 Constraint 168 394 0.8000 1.0000 2.0000 0.0000 Constraint 168 386 0.8000 1.0000 2.0000 0.0000 Constraint 168 380 0.8000 1.0000 2.0000 0.0000 Constraint 168 373 0.8000 1.0000 2.0000 0.0000 Constraint 168 335 0.8000 1.0000 2.0000 0.0000 Constraint 168 325 0.8000 1.0000 2.0000 0.0000 Constraint 168 317 0.8000 1.0000 2.0000 0.0000 Constraint 168 309 0.8000 1.0000 2.0000 0.0000 Constraint 168 297 0.8000 1.0000 2.0000 0.0000 Constraint 168 291 0.8000 1.0000 2.0000 0.0000 Constraint 168 282 0.8000 1.0000 2.0000 0.0000 Constraint 168 275 0.8000 1.0000 2.0000 0.0000 Constraint 168 266 0.8000 1.0000 2.0000 0.0000 Constraint 168 237 0.8000 1.0000 2.0000 0.0000 Constraint 168 229 0.8000 1.0000 2.0000 0.0000 Constraint 168 222 0.8000 1.0000 2.0000 0.0000 Constraint 168 214 0.8000 1.0000 2.0000 0.0000 Constraint 168 205 0.8000 1.0000 2.0000 0.0000 Constraint 168 196 0.8000 1.0000 2.0000 0.0000 Constraint 168 185 0.8000 1.0000 2.0000 0.0000 Constraint 168 177 0.8000 1.0000 2.0000 0.0000 Constraint 163 1476 0.8000 1.0000 2.0000 0.0000 Constraint 163 1467 0.8000 1.0000 2.0000 0.0000 Constraint 163 1459 0.8000 1.0000 2.0000 0.0000 Constraint 163 1451 0.8000 1.0000 2.0000 0.0000 Constraint 163 1442 0.8000 1.0000 2.0000 0.0000 Constraint 163 1430 0.8000 1.0000 2.0000 0.0000 Constraint 163 1421 0.8000 1.0000 2.0000 0.0000 Constraint 163 1413 0.8000 1.0000 2.0000 0.0000 Constraint 163 1402 0.8000 1.0000 2.0000 0.0000 Constraint 163 1395 0.8000 1.0000 2.0000 0.0000 Constraint 163 1386 0.8000 1.0000 2.0000 0.0000 Constraint 163 1381 0.8000 1.0000 2.0000 0.0000 Constraint 163 1373 0.8000 1.0000 2.0000 0.0000 Constraint 163 1362 0.8000 1.0000 2.0000 0.0000 Constraint 163 1354 0.8000 1.0000 2.0000 0.0000 Constraint 163 1347 0.8000 1.0000 2.0000 0.0000 Constraint 163 1339 0.8000 1.0000 2.0000 0.0000 Constraint 163 1329 0.8000 1.0000 2.0000 0.0000 Constraint 163 1318 0.8000 1.0000 2.0000 0.0000 Constraint 163 1306 0.8000 1.0000 2.0000 0.0000 Constraint 163 1295 0.8000 1.0000 2.0000 0.0000 Constraint 163 1288 0.8000 1.0000 2.0000 0.0000 Constraint 163 1281 0.8000 1.0000 2.0000 0.0000 Constraint 163 1272 0.8000 1.0000 2.0000 0.0000 Constraint 163 1264 0.8000 1.0000 2.0000 0.0000 Constraint 163 1256 0.8000 1.0000 2.0000 0.0000 Constraint 163 1225 0.8000 1.0000 2.0000 0.0000 Constraint 163 1201 0.8000 1.0000 2.0000 0.0000 Constraint 163 1192 0.8000 1.0000 2.0000 0.0000 Constraint 163 1186 0.8000 1.0000 2.0000 0.0000 Constraint 163 1174 0.8000 1.0000 2.0000 0.0000 Constraint 163 1168 0.8000 1.0000 2.0000 0.0000 Constraint 163 1150 0.8000 1.0000 2.0000 0.0000 Constraint 163 1144 0.8000 1.0000 2.0000 0.0000 Constraint 163 1133 0.8000 1.0000 2.0000 0.0000 Constraint 163 1124 0.8000 1.0000 2.0000 0.0000 Constraint 163 1106 0.8000 1.0000 2.0000 0.0000 Constraint 163 1095 0.8000 1.0000 2.0000 0.0000 Constraint 163 1087 0.8000 1.0000 2.0000 0.0000 Constraint 163 1075 0.8000 1.0000 2.0000 0.0000 Constraint 163 1066 0.8000 1.0000 2.0000 0.0000 Constraint 163 1051 0.8000 1.0000 2.0000 0.0000 Constraint 163 1039 0.8000 1.0000 2.0000 0.0000 Constraint 163 1031 0.8000 1.0000 2.0000 0.0000 Constraint 163 1024 0.8000 1.0000 2.0000 0.0000 Constraint 163 1015 0.8000 1.0000 2.0000 0.0000 Constraint 163 1007 0.8000 1.0000 2.0000 0.0000 Constraint 163 998 0.8000 1.0000 2.0000 0.0000 Constraint 163 990 0.8000 1.0000 2.0000 0.0000 Constraint 163 981 0.8000 1.0000 2.0000 0.0000 Constraint 163 973 0.8000 1.0000 2.0000 0.0000 Constraint 163 967 0.8000 1.0000 2.0000 0.0000 Constraint 163 958 0.8000 1.0000 2.0000 0.0000 Constraint 163 951 0.8000 1.0000 2.0000 0.0000 Constraint 163 939 0.8000 1.0000 2.0000 0.0000 Constraint 163 931 0.8000 1.0000 2.0000 0.0000 Constraint 163 907 0.8000 1.0000 2.0000 0.0000 Constraint 163 900 0.8000 1.0000 2.0000 0.0000 Constraint 163 892 0.8000 1.0000 2.0000 0.0000 Constraint 163 884 0.8000 1.0000 2.0000 0.0000 Constraint 163 871 0.8000 1.0000 2.0000 0.0000 Constraint 163 864 0.8000 1.0000 2.0000 0.0000 Constraint 163 805 0.8000 1.0000 2.0000 0.0000 Constraint 163 794 0.8000 1.0000 2.0000 0.0000 Constraint 163 789 0.8000 1.0000 2.0000 0.0000 Constraint 163 781 0.8000 1.0000 2.0000 0.0000 Constraint 163 773 0.8000 1.0000 2.0000 0.0000 Constraint 163 762 0.8000 1.0000 2.0000 0.0000 Constraint 163 756 0.8000 1.0000 2.0000 0.0000 Constraint 163 742 0.8000 1.0000 2.0000 0.0000 Constraint 163 728 0.8000 1.0000 2.0000 0.0000 Constraint 163 691 0.8000 1.0000 2.0000 0.0000 Constraint 163 683 0.8000 1.0000 2.0000 0.0000 Constraint 163 669 0.8000 1.0000 2.0000 0.0000 Constraint 163 660 0.8000 1.0000 2.0000 0.0000 Constraint 163 632 0.8000 1.0000 2.0000 0.0000 Constraint 163 624 0.8000 1.0000 2.0000 0.0000 Constraint 163 618 0.8000 1.0000 2.0000 0.0000 Constraint 163 610 0.8000 1.0000 2.0000 0.0000 Constraint 163 602 0.8000 1.0000 2.0000 0.0000 Constraint 163 596 0.8000 1.0000 2.0000 0.0000 Constraint 163 579 0.8000 1.0000 2.0000 0.0000 Constraint 163 562 0.8000 1.0000 2.0000 0.0000 Constraint 163 551 0.8000 1.0000 2.0000 0.0000 Constraint 163 544 0.8000 1.0000 2.0000 0.0000 Constraint 163 522 0.8000 1.0000 2.0000 0.0000 Constraint 163 472 0.8000 1.0000 2.0000 0.0000 Constraint 163 446 0.8000 1.0000 2.0000 0.0000 Constraint 163 439 0.8000 1.0000 2.0000 0.0000 Constraint 163 431 0.8000 1.0000 2.0000 0.0000 Constraint 163 422 0.8000 1.0000 2.0000 0.0000 Constraint 163 417 0.8000 1.0000 2.0000 0.0000 Constraint 163 408 0.8000 1.0000 2.0000 0.0000 Constraint 163 402 0.8000 1.0000 2.0000 0.0000 Constraint 163 394 0.8000 1.0000 2.0000 0.0000 Constraint 163 380 0.8000 1.0000 2.0000 0.0000 Constraint 163 335 0.8000 1.0000 2.0000 0.0000 Constraint 163 325 0.8000 1.0000 2.0000 0.0000 Constraint 163 317 0.8000 1.0000 2.0000 0.0000 Constraint 163 309 0.8000 1.0000 2.0000 0.0000 Constraint 163 282 0.8000 1.0000 2.0000 0.0000 Constraint 163 266 0.8000 1.0000 2.0000 0.0000 Constraint 163 237 0.8000 1.0000 2.0000 0.0000 Constraint 163 229 0.8000 1.0000 2.0000 0.0000 Constraint 163 222 0.8000 1.0000 2.0000 0.0000 Constraint 163 214 0.8000 1.0000 2.0000 0.0000 Constraint 163 205 0.8000 1.0000 2.0000 0.0000 Constraint 163 196 0.8000 1.0000 2.0000 0.0000 Constraint 163 185 0.8000 1.0000 2.0000 0.0000 Constraint 163 177 0.8000 1.0000 2.0000 0.0000 Constraint 163 168 0.8000 1.0000 2.0000 0.0000 Constraint 155 1476 0.8000 1.0000 2.0000 0.0000 Constraint 155 1467 0.8000 1.0000 2.0000 0.0000 Constraint 155 1459 0.8000 1.0000 2.0000 0.0000 Constraint 155 1451 0.8000 1.0000 2.0000 0.0000 Constraint 155 1442 0.8000 1.0000 2.0000 0.0000 Constraint 155 1430 0.8000 1.0000 2.0000 0.0000 Constraint 155 1421 0.8000 1.0000 2.0000 0.0000 Constraint 155 1413 0.8000 1.0000 2.0000 0.0000 Constraint 155 1402 0.8000 1.0000 2.0000 0.0000 Constraint 155 1395 0.8000 1.0000 2.0000 0.0000 Constraint 155 1386 0.8000 1.0000 2.0000 0.0000 Constraint 155 1381 0.8000 1.0000 2.0000 0.0000 Constraint 155 1373 0.8000 1.0000 2.0000 0.0000 Constraint 155 1362 0.8000 1.0000 2.0000 0.0000 Constraint 155 1354 0.8000 1.0000 2.0000 0.0000 Constraint 155 1347 0.8000 1.0000 2.0000 0.0000 Constraint 155 1339 0.8000 1.0000 2.0000 0.0000 Constraint 155 1329 0.8000 1.0000 2.0000 0.0000 Constraint 155 1318 0.8000 1.0000 2.0000 0.0000 Constraint 155 1306 0.8000 1.0000 2.0000 0.0000 Constraint 155 1295 0.8000 1.0000 2.0000 0.0000 Constraint 155 1288 0.8000 1.0000 2.0000 0.0000 Constraint 155 1281 0.8000 1.0000 2.0000 0.0000 Constraint 155 1272 0.8000 1.0000 2.0000 0.0000 Constraint 155 1264 0.8000 1.0000 2.0000 0.0000 Constraint 155 1256 0.8000 1.0000 2.0000 0.0000 Constraint 155 1235 0.8000 1.0000 2.0000 0.0000 Constraint 155 1201 0.8000 1.0000 2.0000 0.0000 Constraint 155 1192 0.8000 1.0000 2.0000 0.0000 Constraint 155 1168 0.8000 1.0000 2.0000 0.0000 Constraint 155 1159 0.8000 1.0000 2.0000 0.0000 Constraint 155 1150 0.8000 1.0000 2.0000 0.0000 Constraint 155 1133 0.8000 1.0000 2.0000 0.0000 Constraint 155 1124 0.8000 1.0000 2.0000 0.0000 Constraint 155 1095 0.8000 1.0000 2.0000 0.0000 Constraint 155 1087 0.8000 1.0000 2.0000 0.0000 Constraint 155 1075 0.8000 1.0000 2.0000 0.0000 Constraint 155 1066 0.8000 1.0000 2.0000 0.0000 Constraint 155 1051 0.8000 1.0000 2.0000 0.0000 Constraint 155 1039 0.8000 1.0000 2.0000 0.0000 Constraint 155 1031 0.8000 1.0000 2.0000 0.0000 Constraint 155 1024 0.8000 1.0000 2.0000 0.0000 Constraint 155 1015 0.8000 1.0000 2.0000 0.0000 Constraint 155 1007 0.8000 1.0000 2.0000 0.0000 Constraint 155 998 0.8000 1.0000 2.0000 0.0000 Constraint 155 990 0.8000 1.0000 2.0000 0.0000 Constraint 155 981 0.8000 1.0000 2.0000 0.0000 Constraint 155 973 0.8000 1.0000 2.0000 0.0000 Constraint 155 967 0.8000 1.0000 2.0000 0.0000 Constraint 155 958 0.8000 1.0000 2.0000 0.0000 Constraint 155 951 0.8000 1.0000 2.0000 0.0000 Constraint 155 944 0.8000 1.0000 2.0000 0.0000 Constraint 155 939 0.8000 1.0000 2.0000 0.0000 Constraint 155 931 0.8000 1.0000 2.0000 0.0000 Constraint 155 892 0.8000 1.0000 2.0000 0.0000 Constraint 155 884 0.8000 1.0000 2.0000 0.0000 Constraint 155 871 0.8000 1.0000 2.0000 0.0000 Constraint 155 864 0.8000 1.0000 2.0000 0.0000 Constraint 155 841 0.8000 1.0000 2.0000 0.0000 Constraint 155 833 0.8000 1.0000 2.0000 0.0000 Constraint 155 789 0.8000 1.0000 2.0000 0.0000 Constraint 155 762 0.8000 1.0000 2.0000 0.0000 Constraint 155 756 0.8000 1.0000 2.0000 0.0000 Constraint 155 728 0.8000 1.0000 2.0000 0.0000 Constraint 155 723 0.8000 1.0000 2.0000 0.0000 Constraint 155 716 0.8000 1.0000 2.0000 0.0000 Constraint 155 691 0.8000 1.0000 2.0000 0.0000 Constraint 155 683 0.8000 1.0000 2.0000 0.0000 Constraint 155 660 0.8000 1.0000 2.0000 0.0000 Constraint 155 649 0.8000 1.0000 2.0000 0.0000 Constraint 155 632 0.8000 1.0000 2.0000 0.0000 Constraint 155 579 0.8000 1.0000 2.0000 0.0000 Constraint 155 570 0.8000 1.0000 2.0000 0.0000 Constraint 155 562 0.8000 1.0000 2.0000 0.0000 Constraint 155 544 0.8000 1.0000 2.0000 0.0000 Constraint 155 522 0.8000 1.0000 2.0000 0.0000 Constraint 155 439 0.8000 1.0000 2.0000 0.0000 Constraint 155 417 0.8000 1.0000 2.0000 0.0000 Constraint 155 408 0.8000 1.0000 2.0000 0.0000 Constraint 155 402 0.8000 1.0000 2.0000 0.0000 Constraint 155 386 0.8000 1.0000 2.0000 0.0000 Constraint 155 380 0.8000 1.0000 2.0000 0.0000 Constraint 155 266 0.8000 1.0000 2.0000 0.0000 Constraint 155 222 0.8000 1.0000 2.0000 0.0000 Constraint 155 214 0.8000 1.0000 2.0000 0.0000 Constraint 155 205 0.8000 1.0000 2.0000 0.0000 Constraint 155 196 0.8000 1.0000 2.0000 0.0000 Constraint 155 185 0.8000 1.0000 2.0000 0.0000 Constraint 155 177 0.8000 1.0000 2.0000 0.0000 Constraint 155 168 0.8000 1.0000 2.0000 0.0000 Constraint 155 163 0.8000 1.0000 2.0000 0.0000 Constraint 148 1476 0.8000 1.0000 2.0000 0.0000 Constraint 148 1467 0.8000 1.0000 2.0000 0.0000 Constraint 148 1459 0.8000 1.0000 2.0000 0.0000 Constraint 148 1451 0.8000 1.0000 2.0000 0.0000 Constraint 148 1442 0.8000 1.0000 2.0000 0.0000 Constraint 148 1430 0.8000 1.0000 2.0000 0.0000 Constraint 148 1421 0.8000 1.0000 2.0000 0.0000 Constraint 148 1413 0.8000 1.0000 2.0000 0.0000 Constraint 148 1402 0.8000 1.0000 2.0000 0.0000 Constraint 148 1395 0.8000 1.0000 2.0000 0.0000 Constraint 148 1386 0.8000 1.0000 2.0000 0.0000 Constraint 148 1381 0.8000 1.0000 2.0000 0.0000 Constraint 148 1373 0.8000 1.0000 2.0000 0.0000 Constraint 148 1362 0.8000 1.0000 2.0000 0.0000 Constraint 148 1354 0.8000 1.0000 2.0000 0.0000 Constraint 148 1347 0.8000 1.0000 2.0000 0.0000 Constraint 148 1339 0.8000 1.0000 2.0000 0.0000 Constraint 148 1329 0.8000 1.0000 2.0000 0.0000 Constraint 148 1318 0.8000 1.0000 2.0000 0.0000 Constraint 148 1306 0.8000 1.0000 2.0000 0.0000 Constraint 148 1295 0.8000 1.0000 2.0000 0.0000 Constraint 148 1288 0.8000 1.0000 2.0000 0.0000 Constraint 148 1281 0.8000 1.0000 2.0000 0.0000 Constraint 148 1272 0.8000 1.0000 2.0000 0.0000 Constraint 148 1264 0.8000 1.0000 2.0000 0.0000 Constraint 148 1256 0.8000 1.0000 2.0000 0.0000 Constraint 148 1244 0.8000 1.0000 2.0000 0.0000 Constraint 148 1235 0.8000 1.0000 2.0000 0.0000 Constraint 148 1225 0.8000 1.0000 2.0000 0.0000 Constraint 148 1213 0.8000 1.0000 2.0000 0.0000 Constraint 148 1208 0.8000 1.0000 2.0000 0.0000 Constraint 148 1201 0.8000 1.0000 2.0000 0.0000 Constraint 148 1192 0.8000 1.0000 2.0000 0.0000 Constraint 148 1174 0.8000 1.0000 2.0000 0.0000 Constraint 148 1168 0.8000 1.0000 2.0000 0.0000 Constraint 148 1144 0.8000 1.0000 2.0000 0.0000 Constraint 148 1133 0.8000 1.0000 2.0000 0.0000 Constraint 148 1124 0.8000 1.0000 2.0000 0.0000 Constraint 148 1095 0.8000 1.0000 2.0000 0.0000 Constraint 148 1087 0.8000 1.0000 2.0000 0.0000 Constraint 148 1075 0.8000 1.0000 2.0000 0.0000 Constraint 148 1066 0.8000 1.0000 2.0000 0.0000 Constraint 148 1051 0.8000 1.0000 2.0000 0.0000 Constraint 148 1039 0.8000 1.0000 2.0000 0.0000 Constraint 148 1031 0.8000 1.0000 2.0000 0.0000 Constraint 148 1024 0.8000 1.0000 2.0000 0.0000 Constraint 148 1015 0.8000 1.0000 2.0000 0.0000 Constraint 148 1007 0.8000 1.0000 2.0000 0.0000 Constraint 148 998 0.8000 1.0000 2.0000 0.0000 Constraint 148 990 0.8000 1.0000 2.0000 0.0000 Constraint 148 981 0.8000 1.0000 2.0000 0.0000 Constraint 148 973 0.8000 1.0000 2.0000 0.0000 Constraint 148 967 0.8000 1.0000 2.0000 0.0000 Constraint 148 958 0.8000 1.0000 2.0000 0.0000 Constraint 148 951 0.8000 1.0000 2.0000 0.0000 Constraint 148 944 0.8000 1.0000 2.0000 0.0000 Constraint 148 939 0.8000 1.0000 2.0000 0.0000 Constraint 148 931 0.8000 1.0000 2.0000 0.0000 Constraint 148 915 0.8000 1.0000 2.0000 0.0000 Constraint 148 892 0.8000 1.0000 2.0000 0.0000 Constraint 148 884 0.8000 1.0000 2.0000 0.0000 Constraint 148 841 0.8000 1.0000 2.0000 0.0000 Constraint 148 833 0.8000 1.0000 2.0000 0.0000 Constraint 148 789 0.8000 1.0000 2.0000 0.0000 Constraint 148 781 0.8000 1.0000 2.0000 0.0000 Constraint 148 773 0.8000 1.0000 2.0000 0.0000 Constraint 148 762 0.8000 1.0000 2.0000 0.0000 Constraint 148 756 0.8000 1.0000 2.0000 0.0000 Constraint 148 742 0.8000 1.0000 2.0000 0.0000 Constraint 148 728 0.8000 1.0000 2.0000 0.0000 Constraint 148 723 0.8000 1.0000 2.0000 0.0000 Constraint 148 716 0.8000 1.0000 2.0000 0.0000 Constraint 148 708 0.8000 1.0000 2.0000 0.0000 Constraint 148 700 0.8000 1.0000 2.0000 0.0000 Constraint 148 691 0.8000 1.0000 2.0000 0.0000 Constraint 148 683 0.8000 1.0000 2.0000 0.0000 Constraint 148 660 0.8000 1.0000 2.0000 0.0000 Constraint 148 632 0.8000 1.0000 2.0000 0.0000 Constraint 148 624 0.8000 1.0000 2.0000 0.0000 Constraint 148 596 0.8000 1.0000 2.0000 0.0000 Constraint 148 585 0.8000 1.0000 2.0000 0.0000 Constraint 148 579 0.8000 1.0000 2.0000 0.0000 Constraint 148 570 0.8000 1.0000 2.0000 0.0000 Constraint 148 562 0.8000 1.0000 2.0000 0.0000 Constraint 148 551 0.8000 1.0000 2.0000 0.0000 Constraint 148 544 0.8000 1.0000 2.0000 0.0000 Constraint 148 532 0.8000 1.0000 2.0000 0.0000 Constraint 148 515 0.8000 1.0000 2.0000 0.0000 Constraint 148 510 0.8000 1.0000 2.0000 0.0000 Constraint 148 488 0.8000 1.0000 2.0000 0.0000 Constraint 148 481 0.8000 1.0000 2.0000 0.0000 Constraint 148 472 0.8000 1.0000 2.0000 0.0000 Constraint 148 464 0.8000 1.0000 2.0000 0.0000 Constraint 148 446 0.8000 1.0000 2.0000 0.0000 Constraint 148 439 0.8000 1.0000 2.0000 0.0000 Constraint 148 431 0.8000 1.0000 2.0000 0.0000 Constraint 148 422 0.8000 1.0000 2.0000 0.0000 Constraint 148 417 0.8000 1.0000 2.0000 0.0000 Constraint 148 408 0.8000 1.0000 2.0000 0.0000 Constraint 148 402 0.8000 1.0000 2.0000 0.0000 Constraint 148 394 0.8000 1.0000 2.0000 0.0000 Constraint 148 386 0.8000 1.0000 2.0000 0.0000 Constraint 148 380 0.8000 1.0000 2.0000 0.0000 Constraint 148 373 0.8000 1.0000 2.0000 0.0000 Constraint 148 351 0.8000 1.0000 2.0000 0.0000 Constraint 148 343 0.8000 1.0000 2.0000 0.0000 Constraint 148 325 0.8000 1.0000 2.0000 0.0000 Constraint 148 309 0.8000 1.0000 2.0000 0.0000 Constraint 148 297 0.8000 1.0000 2.0000 0.0000 Constraint 148 282 0.8000 1.0000 2.0000 0.0000 Constraint 148 275 0.8000 1.0000 2.0000 0.0000 Constraint 148 266 0.8000 1.0000 2.0000 0.0000 Constraint 148 257 0.8000 1.0000 2.0000 0.0000 Constraint 148 222 0.8000 1.0000 2.0000 0.0000 Constraint 148 214 0.8000 1.0000 2.0000 0.0000 Constraint 148 205 0.8000 1.0000 2.0000 0.0000 Constraint 148 196 0.8000 1.0000 2.0000 0.0000 Constraint 148 185 0.8000 1.0000 2.0000 0.0000 Constraint 148 177 0.8000 1.0000 2.0000 0.0000 Constraint 148 168 0.8000 1.0000 2.0000 0.0000 Constraint 148 163 0.8000 1.0000 2.0000 0.0000 Constraint 148 155 0.8000 1.0000 2.0000 0.0000 Constraint 141 1476 0.8000 1.0000 2.0000 0.0000 Constraint 141 1467 0.8000 1.0000 2.0000 0.0000 Constraint 141 1459 0.8000 1.0000 2.0000 0.0000 Constraint 141 1413 0.8000 1.0000 2.0000 0.0000 Constraint 141 1402 0.8000 1.0000 2.0000 0.0000 Constraint 141 1395 0.8000 1.0000 2.0000 0.0000 Constraint 141 1386 0.8000 1.0000 2.0000 0.0000 Constraint 141 1381 0.8000 1.0000 2.0000 0.0000 Constraint 141 1373 0.8000 1.0000 2.0000 0.0000 Constraint 141 1362 0.8000 1.0000 2.0000 0.0000 Constraint 141 1354 0.8000 1.0000 2.0000 0.0000 Constraint 141 1347 0.8000 1.0000 2.0000 0.0000 Constraint 141 1339 0.8000 1.0000 2.0000 0.0000 Constraint 141 1329 0.8000 1.0000 2.0000 0.0000 Constraint 141 1318 0.8000 1.0000 2.0000 0.0000 Constraint 141 1306 0.8000 1.0000 2.0000 0.0000 Constraint 141 1295 0.8000 1.0000 2.0000 0.0000 Constraint 141 1288 0.8000 1.0000 2.0000 0.0000 Constraint 141 1281 0.8000 1.0000 2.0000 0.0000 Constraint 141 1272 0.8000 1.0000 2.0000 0.0000 Constraint 141 1264 0.8000 1.0000 2.0000 0.0000 Constraint 141 1256 0.8000 1.0000 2.0000 0.0000 Constraint 141 1244 0.8000 1.0000 2.0000 0.0000 Constraint 141 1235 0.8000 1.0000 2.0000 0.0000 Constraint 141 1225 0.8000 1.0000 2.0000 0.0000 Constraint 141 1213 0.8000 1.0000 2.0000 0.0000 Constraint 141 1201 0.8000 1.0000 2.0000 0.0000 Constraint 141 1192 0.8000 1.0000 2.0000 0.0000 Constraint 141 1186 0.8000 1.0000 2.0000 0.0000 Constraint 141 1174 0.8000 1.0000 2.0000 0.0000 Constraint 141 1168 0.8000 1.0000 2.0000 0.0000 Constraint 141 1159 0.8000 1.0000 2.0000 0.0000 Constraint 141 1150 0.8000 1.0000 2.0000 0.0000 Constraint 141 1133 0.8000 1.0000 2.0000 0.0000 Constraint 141 1124 0.8000 1.0000 2.0000 0.0000 Constraint 141 1106 0.8000 1.0000 2.0000 0.0000 Constraint 141 1095 0.8000 1.0000 2.0000 0.0000 Constraint 141 1087 0.8000 1.0000 2.0000 0.0000 Constraint 141 1075 0.8000 1.0000 2.0000 0.0000 Constraint 141 1066 0.8000 1.0000 2.0000 0.0000 Constraint 141 1039 0.8000 1.0000 2.0000 0.0000 Constraint 141 1031 0.8000 1.0000 2.0000 0.0000 Constraint 141 1024 0.8000 1.0000 2.0000 0.0000 Constraint 141 1015 0.8000 1.0000 2.0000 0.0000 Constraint 141 1007 0.8000 1.0000 2.0000 0.0000 Constraint 141 998 0.8000 1.0000 2.0000 0.0000 Constraint 141 981 0.8000 1.0000 2.0000 0.0000 Constraint 141 973 0.8000 1.0000 2.0000 0.0000 Constraint 141 951 0.8000 1.0000 2.0000 0.0000 Constraint 141 944 0.8000 1.0000 2.0000 0.0000 Constraint 141 939 0.8000 1.0000 2.0000 0.0000 Constraint 141 924 0.8000 1.0000 2.0000 0.0000 Constraint 141 915 0.8000 1.0000 2.0000 0.0000 Constraint 141 900 0.8000 1.0000 2.0000 0.0000 Constraint 141 884 0.8000 1.0000 2.0000 0.0000 Constraint 141 833 0.8000 1.0000 2.0000 0.0000 Constraint 141 814 0.8000 1.0000 2.0000 0.0000 Constraint 141 789 0.8000 1.0000 2.0000 0.0000 Constraint 141 773 0.8000 1.0000 2.0000 0.0000 Constraint 141 762 0.8000 1.0000 2.0000 0.0000 Constraint 141 756 0.8000 1.0000 2.0000 0.0000 Constraint 141 742 0.8000 1.0000 2.0000 0.0000 Constraint 141 728 0.8000 1.0000 2.0000 0.0000 Constraint 141 723 0.8000 1.0000 2.0000 0.0000 Constraint 141 716 0.8000 1.0000 2.0000 0.0000 Constraint 141 708 0.8000 1.0000 2.0000 0.0000 Constraint 141 700 0.8000 1.0000 2.0000 0.0000 Constraint 141 691 0.8000 1.0000 2.0000 0.0000 Constraint 141 683 0.8000 1.0000 2.0000 0.0000 Constraint 141 674 0.8000 1.0000 2.0000 0.0000 Constraint 141 669 0.8000 1.0000 2.0000 0.0000 Constraint 141 660 0.8000 1.0000 2.0000 0.0000 Constraint 141 632 0.8000 1.0000 2.0000 0.0000 Constraint 141 610 0.8000 1.0000 2.0000 0.0000 Constraint 141 602 0.8000 1.0000 2.0000 0.0000 Constraint 141 596 0.8000 1.0000 2.0000 0.0000 Constraint 141 585 0.8000 1.0000 2.0000 0.0000 Constraint 141 579 0.8000 1.0000 2.0000 0.0000 Constraint 141 562 0.8000 1.0000 2.0000 0.0000 Constraint 141 551 0.8000 1.0000 2.0000 0.0000 Constraint 141 544 0.8000 1.0000 2.0000 0.0000 Constraint 141 510 0.8000 1.0000 2.0000 0.0000 Constraint 141 499 0.8000 1.0000 2.0000 0.0000 Constraint 141 472 0.8000 1.0000 2.0000 0.0000 Constraint 141 464 0.8000 1.0000 2.0000 0.0000 Constraint 141 439 0.8000 1.0000 2.0000 0.0000 Constraint 141 431 0.8000 1.0000 2.0000 0.0000 Constraint 141 417 0.8000 1.0000 2.0000 0.0000 Constraint 141 408 0.8000 1.0000 2.0000 0.0000 Constraint 141 402 0.8000 1.0000 2.0000 0.0000 Constraint 141 394 0.8000 1.0000 2.0000 0.0000 Constraint 141 386 0.8000 1.0000 2.0000 0.0000 Constraint 141 380 0.8000 1.0000 2.0000 0.0000 Constraint 141 373 0.8000 1.0000 2.0000 0.0000 Constraint 141 362 0.8000 1.0000 2.0000 0.0000 Constraint 141 325 0.8000 1.0000 2.0000 0.0000 Constraint 141 297 0.8000 1.0000 2.0000 0.0000 Constraint 141 266 0.8000 1.0000 2.0000 0.0000 Constraint 141 257 0.8000 1.0000 2.0000 0.0000 Constraint 141 249 0.8000 1.0000 2.0000 0.0000 Constraint 141 222 0.8000 1.0000 2.0000 0.0000 Constraint 141 214 0.8000 1.0000 2.0000 0.0000 Constraint 141 205 0.8000 1.0000 2.0000 0.0000 Constraint 141 196 0.8000 1.0000 2.0000 0.0000 Constraint 141 185 0.8000 1.0000 2.0000 0.0000 Constraint 141 177 0.8000 1.0000 2.0000 0.0000 Constraint 141 168 0.8000 1.0000 2.0000 0.0000 Constraint 141 163 0.8000 1.0000 2.0000 0.0000 Constraint 141 155 0.8000 1.0000 2.0000 0.0000 Constraint 141 148 0.8000 1.0000 2.0000 0.0000 Constraint 132 1476 0.8000 1.0000 2.0000 0.0000 Constraint 132 1467 0.8000 1.0000 2.0000 0.0000 Constraint 132 1459 0.8000 1.0000 2.0000 0.0000 Constraint 132 1451 0.8000 1.0000 2.0000 0.0000 Constraint 132 1442 0.8000 1.0000 2.0000 0.0000 Constraint 132 1413 0.8000 1.0000 2.0000 0.0000 Constraint 132 1402 0.8000 1.0000 2.0000 0.0000 Constraint 132 1395 0.8000 1.0000 2.0000 0.0000 Constraint 132 1386 0.8000 1.0000 2.0000 0.0000 Constraint 132 1381 0.8000 1.0000 2.0000 0.0000 Constraint 132 1373 0.8000 1.0000 2.0000 0.0000 Constraint 132 1362 0.8000 1.0000 2.0000 0.0000 Constraint 132 1354 0.8000 1.0000 2.0000 0.0000 Constraint 132 1347 0.8000 1.0000 2.0000 0.0000 Constraint 132 1339 0.8000 1.0000 2.0000 0.0000 Constraint 132 1329 0.8000 1.0000 2.0000 0.0000 Constraint 132 1318 0.8000 1.0000 2.0000 0.0000 Constraint 132 1306 0.8000 1.0000 2.0000 0.0000 Constraint 132 1295 0.8000 1.0000 2.0000 0.0000 Constraint 132 1288 0.8000 1.0000 2.0000 0.0000 Constraint 132 1281 0.8000 1.0000 2.0000 0.0000 Constraint 132 1272 0.8000 1.0000 2.0000 0.0000 Constraint 132 1264 0.8000 1.0000 2.0000 0.0000 Constraint 132 1256 0.8000 1.0000 2.0000 0.0000 Constraint 132 1244 0.8000 1.0000 2.0000 0.0000 Constraint 132 1235 0.8000 1.0000 2.0000 0.0000 Constraint 132 1225 0.8000 1.0000 2.0000 0.0000 Constraint 132 1213 0.8000 1.0000 2.0000 0.0000 Constraint 132 1192 0.8000 1.0000 2.0000 0.0000 Constraint 132 1168 0.8000 1.0000 2.0000 0.0000 Constraint 132 1159 0.8000 1.0000 2.0000 0.0000 Constraint 132 1150 0.8000 1.0000 2.0000 0.0000 Constraint 132 1144 0.8000 1.0000 2.0000 0.0000 Constraint 132 1133 0.8000 1.0000 2.0000 0.0000 Constraint 132 1124 0.8000 1.0000 2.0000 0.0000 Constraint 132 1106 0.8000 1.0000 2.0000 0.0000 Constraint 132 1095 0.8000 1.0000 2.0000 0.0000 Constraint 132 1087 0.8000 1.0000 2.0000 0.0000 Constraint 132 1075 0.8000 1.0000 2.0000 0.0000 Constraint 132 1066 0.8000 1.0000 2.0000 0.0000 Constraint 132 1051 0.8000 1.0000 2.0000 0.0000 Constraint 132 1039 0.8000 1.0000 2.0000 0.0000 Constraint 132 1031 0.8000 1.0000 2.0000 0.0000 Constraint 132 1024 0.8000 1.0000 2.0000 0.0000 Constraint 132 1015 0.8000 1.0000 2.0000 0.0000 Constraint 132 1007 0.8000 1.0000 2.0000 0.0000 Constraint 132 998 0.8000 1.0000 2.0000 0.0000 Constraint 132 990 0.8000 1.0000 2.0000 0.0000 Constraint 132 981 0.8000 1.0000 2.0000 0.0000 Constraint 132 973 0.8000 1.0000 2.0000 0.0000 Constraint 132 967 0.8000 1.0000 2.0000 0.0000 Constraint 132 958 0.8000 1.0000 2.0000 0.0000 Constraint 132 951 0.8000 1.0000 2.0000 0.0000 Constraint 132 944 0.8000 1.0000 2.0000 0.0000 Constraint 132 939 0.8000 1.0000 2.0000 0.0000 Constraint 132 931 0.8000 1.0000 2.0000 0.0000 Constraint 132 924 0.8000 1.0000 2.0000 0.0000 Constraint 132 915 0.8000 1.0000 2.0000 0.0000 Constraint 132 907 0.8000 1.0000 2.0000 0.0000 Constraint 132 900 0.8000 1.0000 2.0000 0.0000 Constraint 132 892 0.8000 1.0000 2.0000 0.0000 Constraint 132 884 0.8000 1.0000 2.0000 0.0000 Constraint 132 833 0.8000 1.0000 2.0000 0.0000 Constraint 132 822 0.8000 1.0000 2.0000 0.0000 Constraint 132 814 0.8000 1.0000 2.0000 0.0000 Constraint 132 794 0.8000 1.0000 2.0000 0.0000 Constraint 132 789 0.8000 1.0000 2.0000 0.0000 Constraint 132 773 0.8000 1.0000 2.0000 0.0000 Constraint 132 762 0.8000 1.0000 2.0000 0.0000 Constraint 132 756 0.8000 1.0000 2.0000 0.0000 Constraint 132 742 0.8000 1.0000 2.0000 0.0000 Constraint 132 728 0.8000 1.0000 2.0000 0.0000 Constraint 132 723 0.8000 1.0000 2.0000 0.0000 Constraint 132 716 0.8000 1.0000 2.0000 0.0000 Constraint 132 708 0.8000 1.0000 2.0000 0.0000 Constraint 132 700 0.8000 1.0000 2.0000 0.0000 Constraint 132 691 0.8000 1.0000 2.0000 0.0000 Constraint 132 683 0.8000 1.0000 2.0000 0.0000 Constraint 132 674 0.8000 1.0000 2.0000 0.0000 Constraint 132 669 0.8000 1.0000 2.0000 0.0000 Constraint 132 660 0.8000 1.0000 2.0000 0.0000 Constraint 132 632 0.8000 1.0000 2.0000 0.0000 Constraint 132 610 0.8000 1.0000 2.0000 0.0000 Constraint 132 602 0.8000 1.0000 2.0000 0.0000 Constraint 132 596 0.8000 1.0000 2.0000 0.0000 Constraint 132 585 0.8000 1.0000 2.0000 0.0000 Constraint 132 579 0.8000 1.0000 2.0000 0.0000 Constraint 132 570 0.8000 1.0000 2.0000 0.0000 Constraint 132 562 0.8000 1.0000 2.0000 0.0000 Constraint 132 551 0.8000 1.0000 2.0000 0.0000 Constraint 132 544 0.8000 1.0000 2.0000 0.0000 Constraint 132 532 0.8000 1.0000 2.0000 0.0000 Constraint 132 522 0.8000 1.0000 2.0000 0.0000 Constraint 132 515 0.8000 1.0000 2.0000 0.0000 Constraint 132 510 0.8000 1.0000 2.0000 0.0000 Constraint 132 499 0.8000 1.0000 2.0000 0.0000 Constraint 132 488 0.8000 1.0000 2.0000 0.0000 Constraint 132 481 0.8000 1.0000 2.0000 0.0000 Constraint 132 472 0.8000 1.0000 2.0000 0.0000 Constraint 132 464 0.8000 1.0000 2.0000 0.0000 Constraint 132 446 0.8000 1.0000 2.0000 0.0000 Constraint 132 439 0.8000 1.0000 2.0000 0.0000 Constraint 132 431 0.8000 1.0000 2.0000 0.0000 Constraint 132 422 0.8000 1.0000 2.0000 0.0000 Constraint 132 417 0.8000 1.0000 2.0000 0.0000 Constraint 132 408 0.8000 1.0000 2.0000 0.0000 Constraint 132 402 0.8000 1.0000 2.0000 0.0000 Constraint 132 386 0.8000 1.0000 2.0000 0.0000 Constraint 132 380 0.8000 1.0000 2.0000 0.0000 Constraint 132 325 0.8000 1.0000 2.0000 0.0000 Constraint 132 282 0.8000 1.0000 2.0000 0.0000 Constraint 132 266 0.8000 1.0000 2.0000 0.0000 Constraint 132 249 0.8000 1.0000 2.0000 0.0000 Constraint 132 237 0.8000 1.0000 2.0000 0.0000 Constraint 132 222 0.8000 1.0000 2.0000 0.0000 Constraint 132 205 0.8000 1.0000 2.0000 0.0000 Constraint 132 196 0.8000 1.0000 2.0000 0.0000 Constraint 132 185 0.8000 1.0000 2.0000 0.0000 Constraint 132 177 0.8000 1.0000 2.0000 0.0000 Constraint 132 168 0.8000 1.0000 2.0000 0.0000 Constraint 132 163 0.8000 1.0000 2.0000 0.0000 Constraint 132 155 0.8000 1.0000 2.0000 0.0000 Constraint 132 148 0.8000 1.0000 2.0000 0.0000 Constraint 132 141 0.8000 1.0000 2.0000 0.0000 Constraint 124 1476 0.8000 1.0000 2.0000 0.0000 Constraint 124 1467 0.8000 1.0000 2.0000 0.0000 Constraint 124 1459 0.8000 1.0000 2.0000 0.0000 Constraint 124 1451 0.8000 1.0000 2.0000 0.0000 Constraint 124 1442 0.8000 1.0000 2.0000 0.0000 Constraint 124 1430 0.8000 1.0000 2.0000 0.0000 Constraint 124 1421 0.8000 1.0000 2.0000 0.0000 Constraint 124 1413 0.8000 1.0000 2.0000 0.0000 Constraint 124 1402 0.8000 1.0000 2.0000 0.0000 Constraint 124 1395 0.8000 1.0000 2.0000 0.0000 Constraint 124 1386 0.8000 1.0000 2.0000 0.0000 Constraint 124 1381 0.8000 1.0000 2.0000 0.0000 Constraint 124 1373 0.8000 1.0000 2.0000 0.0000 Constraint 124 1362 0.8000 1.0000 2.0000 0.0000 Constraint 124 1354 0.8000 1.0000 2.0000 0.0000 Constraint 124 1339 0.8000 1.0000 2.0000 0.0000 Constraint 124 1329 0.8000 1.0000 2.0000 0.0000 Constraint 124 1318 0.8000 1.0000 2.0000 0.0000 Constraint 124 1306 0.8000 1.0000 2.0000 0.0000 Constraint 124 1295 0.8000 1.0000 2.0000 0.0000 Constraint 124 1288 0.8000 1.0000 2.0000 0.0000 Constraint 124 1281 0.8000 1.0000 2.0000 0.0000 Constraint 124 1272 0.8000 1.0000 2.0000 0.0000 Constraint 124 1264 0.8000 1.0000 2.0000 0.0000 Constraint 124 1256 0.8000 1.0000 2.0000 0.0000 Constraint 124 1244 0.8000 1.0000 2.0000 0.0000 Constraint 124 1235 0.8000 1.0000 2.0000 0.0000 Constraint 124 1213 0.8000 1.0000 2.0000 0.0000 Constraint 124 1208 0.8000 1.0000 2.0000 0.0000 Constraint 124 1192 0.8000 1.0000 2.0000 0.0000 Constraint 124 1168 0.8000 1.0000 2.0000 0.0000 Constraint 124 1159 0.8000 1.0000 2.0000 0.0000 Constraint 124 1150 0.8000 1.0000 2.0000 0.0000 Constraint 124 1144 0.8000 1.0000 2.0000 0.0000 Constraint 124 1133 0.8000 1.0000 2.0000 0.0000 Constraint 124 1124 0.8000 1.0000 2.0000 0.0000 Constraint 124 1106 0.8000 1.0000 2.0000 0.0000 Constraint 124 1095 0.8000 1.0000 2.0000 0.0000 Constraint 124 1087 0.8000 1.0000 2.0000 0.0000 Constraint 124 1075 0.8000 1.0000 2.0000 0.0000 Constraint 124 1051 0.8000 1.0000 2.0000 0.0000 Constraint 124 1039 0.8000 1.0000 2.0000 0.0000 Constraint 124 1031 0.8000 1.0000 2.0000 0.0000 Constraint 124 1024 0.8000 1.0000 2.0000 0.0000 Constraint 124 1007 0.8000 1.0000 2.0000 0.0000 Constraint 124 998 0.8000 1.0000 2.0000 0.0000 Constraint 124 973 0.8000 1.0000 2.0000 0.0000 Constraint 124 967 0.8000 1.0000 2.0000 0.0000 Constraint 124 958 0.8000 1.0000 2.0000 0.0000 Constraint 124 951 0.8000 1.0000 2.0000 0.0000 Constraint 124 944 0.8000 1.0000 2.0000 0.0000 Constraint 124 939 0.8000 1.0000 2.0000 0.0000 Constraint 124 931 0.8000 1.0000 2.0000 0.0000 Constraint 124 924 0.8000 1.0000 2.0000 0.0000 Constraint 124 915 0.8000 1.0000 2.0000 0.0000 Constraint 124 907 0.8000 1.0000 2.0000 0.0000 Constraint 124 900 0.8000 1.0000 2.0000 0.0000 Constraint 124 892 0.8000 1.0000 2.0000 0.0000 Constraint 124 884 0.8000 1.0000 2.0000 0.0000 Constraint 124 871 0.8000 1.0000 2.0000 0.0000 Constraint 124 833 0.8000 1.0000 2.0000 0.0000 Constraint 124 805 0.8000 1.0000 2.0000 0.0000 Constraint 124 773 0.8000 1.0000 2.0000 0.0000 Constraint 124 762 0.8000 1.0000 2.0000 0.0000 Constraint 124 756 0.8000 1.0000 2.0000 0.0000 Constraint 124 742 0.8000 1.0000 2.0000 0.0000 Constraint 124 728 0.8000 1.0000 2.0000 0.0000 Constraint 124 723 0.8000 1.0000 2.0000 0.0000 Constraint 124 716 0.8000 1.0000 2.0000 0.0000 Constraint 124 708 0.8000 1.0000 2.0000 0.0000 Constraint 124 700 0.8000 1.0000 2.0000 0.0000 Constraint 124 691 0.8000 1.0000 2.0000 0.0000 Constraint 124 683 0.8000 1.0000 2.0000 0.0000 Constraint 124 669 0.8000 1.0000 2.0000 0.0000 Constraint 124 660 0.8000 1.0000 2.0000 0.0000 Constraint 124 641 0.8000 1.0000 2.0000 0.0000 Constraint 124 632 0.8000 1.0000 2.0000 0.0000 Constraint 124 596 0.8000 1.0000 2.0000 0.0000 Constraint 124 585 0.8000 1.0000 2.0000 0.0000 Constraint 124 579 0.8000 1.0000 2.0000 0.0000 Constraint 124 570 0.8000 1.0000 2.0000 0.0000 Constraint 124 562 0.8000 1.0000 2.0000 0.0000 Constraint 124 544 0.8000 1.0000 2.0000 0.0000 Constraint 124 532 0.8000 1.0000 2.0000 0.0000 Constraint 124 515 0.8000 1.0000 2.0000 0.0000 Constraint 124 510 0.8000 1.0000 2.0000 0.0000 Constraint 124 499 0.8000 1.0000 2.0000 0.0000 Constraint 124 488 0.8000 1.0000 2.0000 0.0000 Constraint 124 481 0.8000 1.0000 2.0000 0.0000 Constraint 124 472 0.8000 1.0000 2.0000 0.0000 Constraint 124 455 0.8000 1.0000 2.0000 0.0000 Constraint 124 446 0.8000 1.0000 2.0000 0.0000 Constraint 124 439 0.8000 1.0000 2.0000 0.0000 Constraint 124 431 0.8000 1.0000 2.0000 0.0000 Constraint 124 422 0.8000 1.0000 2.0000 0.0000 Constraint 124 417 0.8000 1.0000 2.0000 0.0000 Constraint 124 408 0.8000 1.0000 2.0000 0.0000 Constraint 124 402 0.8000 1.0000 2.0000 0.0000 Constraint 124 380 0.8000 1.0000 2.0000 0.0000 Constraint 124 282 0.8000 1.0000 2.0000 0.0000 Constraint 124 266 0.8000 1.0000 2.0000 0.0000 Constraint 124 237 0.8000 1.0000 2.0000 0.0000 Constraint 124 229 0.8000 1.0000 2.0000 0.0000 Constraint 124 222 0.8000 1.0000 2.0000 0.0000 Constraint 124 214 0.8000 1.0000 2.0000 0.0000 Constraint 124 205 0.8000 1.0000 2.0000 0.0000 Constraint 124 196 0.8000 1.0000 2.0000 0.0000 Constraint 124 185 0.8000 1.0000 2.0000 0.0000 Constraint 124 177 0.8000 1.0000 2.0000 0.0000 Constraint 124 168 0.8000 1.0000 2.0000 0.0000 Constraint 124 163 0.8000 1.0000 2.0000 0.0000 Constraint 124 155 0.8000 1.0000 2.0000 0.0000 Constraint 124 148 0.8000 1.0000 2.0000 0.0000 Constraint 124 141 0.8000 1.0000 2.0000 0.0000 Constraint 124 132 0.8000 1.0000 2.0000 0.0000 Constraint 115 1476 0.8000 1.0000 2.0000 0.0000 Constraint 115 1467 0.8000 1.0000 2.0000 0.0000 Constraint 115 1459 0.8000 1.0000 2.0000 0.0000 Constraint 115 1451 0.8000 1.0000 2.0000 0.0000 Constraint 115 1442 0.8000 1.0000 2.0000 0.0000 Constraint 115 1430 0.8000 1.0000 2.0000 0.0000 Constraint 115 1421 0.8000 1.0000 2.0000 0.0000 Constraint 115 1413 0.8000 1.0000 2.0000 0.0000 Constraint 115 1402 0.8000 1.0000 2.0000 0.0000 Constraint 115 1395 0.8000 1.0000 2.0000 0.0000 Constraint 115 1386 0.8000 1.0000 2.0000 0.0000 Constraint 115 1381 0.8000 1.0000 2.0000 0.0000 Constraint 115 1373 0.8000 1.0000 2.0000 0.0000 Constraint 115 1362 0.8000 1.0000 2.0000 0.0000 Constraint 115 1354 0.8000 1.0000 2.0000 0.0000 Constraint 115 1347 0.8000 1.0000 2.0000 0.0000 Constraint 115 1339 0.8000 1.0000 2.0000 0.0000 Constraint 115 1329 0.8000 1.0000 2.0000 0.0000 Constraint 115 1318 0.8000 1.0000 2.0000 0.0000 Constraint 115 1306 0.8000 1.0000 2.0000 0.0000 Constraint 115 1295 0.8000 1.0000 2.0000 0.0000 Constraint 115 1288 0.8000 1.0000 2.0000 0.0000 Constraint 115 1281 0.8000 1.0000 2.0000 0.0000 Constraint 115 1272 0.8000 1.0000 2.0000 0.0000 Constraint 115 1264 0.8000 1.0000 2.0000 0.0000 Constraint 115 1256 0.8000 1.0000 2.0000 0.0000 Constraint 115 1244 0.8000 1.0000 2.0000 0.0000 Constraint 115 1235 0.8000 1.0000 2.0000 0.0000 Constraint 115 1225 0.8000 1.0000 2.0000 0.0000 Constraint 115 1213 0.8000 1.0000 2.0000 0.0000 Constraint 115 1208 0.8000 1.0000 2.0000 0.0000 Constraint 115 1201 0.8000 1.0000 2.0000 0.0000 Constraint 115 1192 0.8000 1.0000 2.0000 0.0000 Constraint 115 1168 0.8000 1.0000 2.0000 0.0000 Constraint 115 1159 0.8000 1.0000 2.0000 0.0000 Constraint 115 1150 0.8000 1.0000 2.0000 0.0000 Constraint 115 1144 0.8000 1.0000 2.0000 0.0000 Constraint 115 1133 0.8000 1.0000 2.0000 0.0000 Constraint 115 1124 0.8000 1.0000 2.0000 0.0000 Constraint 115 1106 0.8000 1.0000 2.0000 0.0000 Constraint 115 1095 0.8000 1.0000 2.0000 0.0000 Constraint 115 1087 0.8000 1.0000 2.0000 0.0000 Constraint 115 1075 0.8000 1.0000 2.0000 0.0000 Constraint 115 1066 0.8000 1.0000 2.0000 0.0000 Constraint 115 1051 0.8000 1.0000 2.0000 0.0000 Constraint 115 1039 0.8000 1.0000 2.0000 0.0000 Constraint 115 1031 0.8000 1.0000 2.0000 0.0000 Constraint 115 1024 0.8000 1.0000 2.0000 0.0000 Constraint 115 1015 0.8000 1.0000 2.0000 0.0000 Constraint 115 1007 0.8000 1.0000 2.0000 0.0000 Constraint 115 998 0.8000 1.0000 2.0000 0.0000 Constraint 115 990 0.8000 1.0000 2.0000 0.0000 Constraint 115 981 0.8000 1.0000 2.0000 0.0000 Constraint 115 973 0.8000 1.0000 2.0000 0.0000 Constraint 115 967 0.8000 1.0000 2.0000 0.0000 Constraint 115 958 0.8000 1.0000 2.0000 0.0000 Constraint 115 951 0.8000 1.0000 2.0000 0.0000 Constraint 115 944 0.8000 1.0000 2.0000 0.0000 Constraint 115 939 0.8000 1.0000 2.0000 0.0000 Constraint 115 931 0.8000 1.0000 2.0000 0.0000 Constraint 115 924 0.8000 1.0000 2.0000 0.0000 Constraint 115 915 0.8000 1.0000 2.0000 0.0000 Constraint 115 907 0.8000 1.0000 2.0000 0.0000 Constraint 115 900 0.8000 1.0000 2.0000 0.0000 Constraint 115 892 0.8000 1.0000 2.0000 0.0000 Constraint 115 884 0.8000 1.0000 2.0000 0.0000 Constraint 115 814 0.8000 1.0000 2.0000 0.0000 Constraint 115 805 0.8000 1.0000 2.0000 0.0000 Constraint 115 762 0.8000 1.0000 2.0000 0.0000 Constraint 115 756 0.8000 1.0000 2.0000 0.0000 Constraint 115 723 0.8000 1.0000 2.0000 0.0000 Constraint 115 716 0.8000 1.0000 2.0000 0.0000 Constraint 115 708 0.8000 1.0000 2.0000 0.0000 Constraint 115 700 0.8000 1.0000 2.0000 0.0000 Constraint 115 691 0.8000 1.0000 2.0000 0.0000 Constraint 115 683 0.8000 1.0000 2.0000 0.0000 Constraint 115 674 0.8000 1.0000 2.0000 0.0000 Constraint 115 669 0.8000 1.0000 2.0000 0.0000 Constraint 115 660 0.8000 1.0000 2.0000 0.0000 Constraint 115 649 0.8000 1.0000 2.0000 0.0000 Constraint 115 641 0.8000 1.0000 2.0000 0.0000 Constraint 115 632 0.8000 1.0000 2.0000 0.0000 Constraint 115 610 0.8000 1.0000 2.0000 0.0000 Constraint 115 596 0.8000 1.0000 2.0000 0.0000 Constraint 115 585 0.8000 1.0000 2.0000 0.0000 Constraint 115 570 0.8000 1.0000 2.0000 0.0000 Constraint 115 544 0.8000 1.0000 2.0000 0.0000 Constraint 115 532 0.8000 1.0000 2.0000 0.0000 Constraint 115 510 0.8000 1.0000 2.0000 0.0000 Constraint 115 499 0.8000 1.0000 2.0000 0.0000 Constraint 115 488 0.8000 1.0000 2.0000 0.0000 Constraint 115 481 0.8000 1.0000 2.0000 0.0000 Constraint 115 472 0.8000 1.0000 2.0000 0.0000 Constraint 115 464 0.8000 1.0000 2.0000 0.0000 Constraint 115 455 0.8000 1.0000 2.0000 0.0000 Constraint 115 446 0.8000 1.0000 2.0000 0.0000 Constraint 115 439 0.8000 1.0000 2.0000 0.0000 Constraint 115 431 0.8000 1.0000 2.0000 0.0000 Constraint 115 422 0.8000 1.0000 2.0000 0.0000 Constraint 115 417 0.8000 1.0000 2.0000 0.0000 Constraint 115 408 0.8000 1.0000 2.0000 0.0000 Constraint 115 380 0.8000 1.0000 2.0000 0.0000 Constraint 115 291 0.8000 1.0000 2.0000 0.0000 Constraint 115 282 0.8000 1.0000 2.0000 0.0000 Constraint 115 275 0.8000 1.0000 2.0000 0.0000 Constraint 115 266 0.8000 1.0000 2.0000 0.0000 Constraint 115 237 0.8000 1.0000 2.0000 0.0000 Constraint 115 229 0.8000 1.0000 2.0000 0.0000 Constraint 115 222 0.8000 1.0000 2.0000 0.0000 Constraint 115 205 0.8000 1.0000 2.0000 0.0000 Constraint 115 196 0.8000 1.0000 2.0000 0.0000 Constraint 115 177 0.8000 1.0000 2.0000 0.0000 Constraint 115 168 0.8000 1.0000 2.0000 0.0000 Constraint 115 163 0.8000 1.0000 2.0000 0.0000 Constraint 115 155 0.8000 1.0000 2.0000 0.0000 Constraint 115 148 0.8000 1.0000 2.0000 0.0000 Constraint 115 141 0.8000 1.0000 2.0000 0.0000 Constraint 115 132 0.8000 1.0000 2.0000 0.0000 Constraint 115 124 0.8000 1.0000 2.0000 0.0000 Constraint 100 1476 0.8000 1.0000 2.0000 0.0000 Constraint 100 1467 0.8000 1.0000 2.0000 0.0000 Constraint 100 1459 0.8000 1.0000 2.0000 0.0000 Constraint 100 1451 0.8000 1.0000 2.0000 0.0000 Constraint 100 1442 0.8000 1.0000 2.0000 0.0000 Constraint 100 1430 0.8000 1.0000 2.0000 0.0000 Constraint 100 1421 0.8000 1.0000 2.0000 0.0000 Constraint 100 1413 0.8000 1.0000 2.0000 0.0000 Constraint 100 1402 0.8000 1.0000 2.0000 0.0000 Constraint 100 1395 0.8000 1.0000 2.0000 0.0000 Constraint 100 1386 0.8000 1.0000 2.0000 0.0000 Constraint 100 1381 0.8000 1.0000 2.0000 0.0000 Constraint 100 1373 0.8000 1.0000 2.0000 0.0000 Constraint 100 1362 0.8000 1.0000 2.0000 0.0000 Constraint 100 1354 0.8000 1.0000 2.0000 0.0000 Constraint 100 1339 0.8000 1.0000 2.0000 0.0000 Constraint 100 1329 0.8000 1.0000 2.0000 0.0000 Constraint 100 1318 0.8000 1.0000 2.0000 0.0000 Constraint 100 1306 0.8000 1.0000 2.0000 0.0000 Constraint 100 1295 0.8000 1.0000 2.0000 0.0000 Constraint 100 1288 0.8000 1.0000 2.0000 0.0000 Constraint 100 1281 0.8000 1.0000 2.0000 0.0000 Constraint 100 1272 0.8000 1.0000 2.0000 0.0000 Constraint 100 1264 0.8000 1.0000 2.0000 0.0000 Constraint 100 1256 0.8000 1.0000 2.0000 0.0000 Constraint 100 1244 0.8000 1.0000 2.0000 0.0000 Constraint 100 1235 0.8000 1.0000 2.0000 0.0000 Constraint 100 1225 0.8000 1.0000 2.0000 0.0000 Constraint 100 1213 0.8000 1.0000 2.0000 0.0000 Constraint 100 1208 0.8000 1.0000 2.0000 0.0000 Constraint 100 1201 0.8000 1.0000 2.0000 0.0000 Constraint 100 1192 0.8000 1.0000 2.0000 0.0000 Constraint 100 1186 0.8000 1.0000 2.0000 0.0000 Constraint 100 1174 0.8000 1.0000 2.0000 0.0000 Constraint 100 1168 0.8000 1.0000 2.0000 0.0000 Constraint 100 1159 0.8000 1.0000 2.0000 0.0000 Constraint 100 1150 0.8000 1.0000 2.0000 0.0000 Constraint 100 1144 0.8000 1.0000 2.0000 0.0000 Constraint 100 1106 0.8000 1.0000 2.0000 0.0000 Constraint 100 1095 0.8000 1.0000 2.0000 0.0000 Constraint 100 1087 0.8000 1.0000 2.0000 0.0000 Constraint 100 1075 0.8000 1.0000 2.0000 0.0000 Constraint 100 1051 0.8000 1.0000 2.0000 0.0000 Constraint 100 1039 0.8000 1.0000 2.0000 0.0000 Constraint 100 1031 0.8000 1.0000 2.0000 0.0000 Constraint 100 1024 0.8000 1.0000 2.0000 0.0000 Constraint 100 1015 0.8000 1.0000 2.0000 0.0000 Constraint 100 1007 0.8000 1.0000 2.0000 0.0000 Constraint 100 998 0.8000 1.0000 2.0000 0.0000 Constraint 100 990 0.8000 1.0000 2.0000 0.0000 Constraint 100 981 0.8000 1.0000 2.0000 0.0000 Constraint 100 973 0.8000 1.0000 2.0000 0.0000 Constraint 100 967 0.8000 1.0000 2.0000 0.0000 Constraint 100 958 0.8000 1.0000 2.0000 0.0000 Constraint 100 951 0.8000 1.0000 2.0000 0.0000 Constraint 100 944 0.8000 1.0000 2.0000 0.0000 Constraint 100 939 0.8000 1.0000 2.0000 0.0000 Constraint 100 931 0.8000 1.0000 2.0000 0.0000 Constraint 100 924 0.8000 1.0000 2.0000 0.0000 Constraint 100 915 0.8000 1.0000 2.0000 0.0000 Constraint 100 907 0.8000 1.0000 2.0000 0.0000 Constraint 100 900 0.8000 1.0000 2.0000 0.0000 Constraint 100 892 0.8000 1.0000 2.0000 0.0000 Constraint 100 884 0.8000 1.0000 2.0000 0.0000 Constraint 100 871 0.8000 1.0000 2.0000 0.0000 Constraint 100 852 0.8000 1.0000 2.0000 0.0000 Constraint 100 841 0.8000 1.0000 2.0000 0.0000 Constraint 100 833 0.8000 1.0000 2.0000 0.0000 Constraint 100 822 0.8000 1.0000 2.0000 0.0000 Constraint 100 805 0.8000 1.0000 2.0000 0.0000 Constraint 100 794 0.8000 1.0000 2.0000 0.0000 Constraint 100 789 0.8000 1.0000 2.0000 0.0000 Constraint 100 762 0.8000 1.0000 2.0000 0.0000 Constraint 100 756 0.8000 1.0000 2.0000 0.0000 Constraint 100 742 0.8000 1.0000 2.0000 0.0000 Constraint 100 728 0.8000 1.0000 2.0000 0.0000 Constraint 100 723 0.8000 1.0000 2.0000 0.0000 Constraint 100 716 0.8000 1.0000 2.0000 0.0000 Constraint 100 708 0.8000 1.0000 2.0000 0.0000 Constraint 100 700 0.8000 1.0000 2.0000 0.0000 Constraint 100 691 0.8000 1.0000 2.0000 0.0000 Constraint 100 683 0.8000 1.0000 2.0000 0.0000 Constraint 100 660 0.8000 1.0000 2.0000 0.0000 Constraint 100 632 0.8000 1.0000 2.0000 0.0000 Constraint 100 602 0.8000 1.0000 2.0000 0.0000 Constraint 100 570 0.8000 1.0000 2.0000 0.0000 Constraint 100 562 0.8000 1.0000 2.0000 0.0000 Constraint 100 551 0.8000 1.0000 2.0000 0.0000 Constraint 100 544 0.8000 1.0000 2.0000 0.0000 Constraint 100 532 0.8000 1.0000 2.0000 0.0000 Constraint 100 522 0.8000 1.0000 2.0000 0.0000 Constraint 100 510 0.8000 1.0000 2.0000 0.0000 Constraint 100 499 0.8000 1.0000 2.0000 0.0000 Constraint 100 488 0.8000 1.0000 2.0000 0.0000 Constraint 100 481 0.8000 1.0000 2.0000 0.0000 Constraint 100 472 0.8000 1.0000 2.0000 0.0000 Constraint 100 464 0.8000 1.0000 2.0000 0.0000 Constraint 100 455 0.8000 1.0000 2.0000 0.0000 Constraint 100 446 0.8000 1.0000 2.0000 0.0000 Constraint 100 439 0.8000 1.0000 2.0000 0.0000 Constraint 100 431 0.8000 1.0000 2.0000 0.0000 Constraint 100 422 0.8000 1.0000 2.0000 0.0000 Constraint 100 417 0.8000 1.0000 2.0000 0.0000 Constraint 100 394 0.8000 1.0000 2.0000 0.0000 Constraint 100 351 0.8000 1.0000 2.0000 0.0000 Constraint 100 266 0.8000 1.0000 2.0000 0.0000 Constraint 100 257 0.8000 1.0000 2.0000 0.0000 Constraint 100 222 0.8000 1.0000 2.0000 0.0000 Constraint 100 205 0.8000 1.0000 2.0000 0.0000 Constraint 100 196 0.8000 1.0000 2.0000 0.0000 Constraint 100 168 0.8000 1.0000 2.0000 0.0000 Constraint 100 163 0.8000 1.0000 2.0000 0.0000 Constraint 100 155 0.8000 1.0000 2.0000 0.0000 Constraint 100 148 0.8000 1.0000 2.0000 0.0000 Constraint 100 141 0.8000 1.0000 2.0000 0.0000 Constraint 100 132 0.8000 1.0000 2.0000 0.0000 Constraint 100 124 0.8000 1.0000 2.0000 0.0000 Constraint 100 115 0.8000 1.0000 2.0000 0.0000 Constraint 92 1476 0.8000 1.0000 2.0000 0.0000 Constraint 92 1467 0.8000 1.0000 2.0000 0.0000 Constraint 92 1459 0.8000 1.0000 2.0000 0.0000 Constraint 92 1451 0.8000 1.0000 2.0000 0.0000 Constraint 92 1442 0.8000 1.0000 2.0000 0.0000 Constraint 92 1430 0.8000 1.0000 2.0000 0.0000 Constraint 92 1421 0.8000 1.0000 2.0000 0.0000 Constraint 92 1413 0.8000 1.0000 2.0000 0.0000 Constraint 92 1402 0.8000 1.0000 2.0000 0.0000 Constraint 92 1395 0.8000 1.0000 2.0000 0.0000 Constraint 92 1386 0.8000 1.0000 2.0000 0.0000 Constraint 92 1381 0.8000 1.0000 2.0000 0.0000 Constraint 92 1373 0.8000 1.0000 2.0000 0.0000 Constraint 92 1362 0.8000 1.0000 2.0000 0.0000 Constraint 92 1354 0.8000 1.0000 2.0000 0.0000 Constraint 92 1347 0.8000 1.0000 2.0000 0.0000 Constraint 92 1339 0.8000 1.0000 2.0000 0.0000 Constraint 92 1329 0.8000 1.0000 2.0000 0.0000 Constraint 92 1318 0.8000 1.0000 2.0000 0.0000 Constraint 92 1306 0.8000 1.0000 2.0000 0.0000 Constraint 92 1295 0.8000 1.0000 2.0000 0.0000 Constraint 92 1288 0.8000 1.0000 2.0000 0.0000 Constraint 92 1281 0.8000 1.0000 2.0000 0.0000 Constraint 92 1272 0.8000 1.0000 2.0000 0.0000 Constraint 92 1264 0.8000 1.0000 2.0000 0.0000 Constraint 92 1256 0.8000 1.0000 2.0000 0.0000 Constraint 92 1201 0.8000 1.0000 2.0000 0.0000 Constraint 92 1192 0.8000 1.0000 2.0000 0.0000 Constraint 92 1186 0.8000 1.0000 2.0000 0.0000 Constraint 92 1174 0.8000 1.0000 2.0000 0.0000 Constraint 92 1168 0.8000 1.0000 2.0000 0.0000 Constraint 92 1159 0.8000 1.0000 2.0000 0.0000 Constraint 92 1150 0.8000 1.0000 2.0000 0.0000 Constraint 92 1144 0.8000 1.0000 2.0000 0.0000 Constraint 92 1133 0.8000 1.0000 2.0000 0.0000 Constraint 92 1124 0.8000 1.0000 2.0000 0.0000 Constraint 92 1106 0.8000 1.0000 2.0000 0.0000 Constraint 92 1095 0.8000 1.0000 2.0000 0.0000 Constraint 92 1087 0.8000 1.0000 2.0000 0.0000 Constraint 92 1075 0.8000 1.0000 2.0000 0.0000 Constraint 92 1066 0.8000 1.0000 2.0000 0.0000 Constraint 92 1051 0.8000 1.0000 2.0000 0.0000 Constraint 92 1039 0.8000 1.0000 2.0000 0.0000 Constraint 92 1031 0.8000 1.0000 2.0000 0.0000 Constraint 92 1024 0.8000 1.0000 2.0000 0.0000 Constraint 92 1015 0.8000 1.0000 2.0000 0.0000 Constraint 92 1007 0.8000 1.0000 2.0000 0.0000 Constraint 92 998 0.8000 1.0000 2.0000 0.0000 Constraint 92 973 0.8000 1.0000 2.0000 0.0000 Constraint 92 967 0.8000 1.0000 2.0000 0.0000 Constraint 92 958 0.8000 1.0000 2.0000 0.0000 Constraint 92 951 0.8000 1.0000 2.0000 0.0000 Constraint 92 944 0.8000 1.0000 2.0000 0.0000 Constraint 92 939 0.8000 1.0000 2.0000 0.0000 Constraint 92 931 0.8000 1.0000 2.0000 0.0000 Constraint 92 915 0.8000 1.0000 2.0000 0.0000 Constraint 92 907 0.8000 1.0000 2.0000 0.0000 Constraint 92 900 0.8000 1.0000 2.0000 0.0000 Constraint 92 892 0.8000 1.0000 2.0000 0.0000 Constraint 92 884 0.8000 1.0000 2.0000 0.0000 Constraint 92 871 0.8000 1.0000 2.0000 0.0000 Constraint 92 864 0.8000 1.0000 2.0000 0.0000 Constraint 92 852 0.8000 1.0000 2.0000 0.0000 Constraint 92 841 0.8000 1.0000 2.0000 0.0000 Constraint 92 833 0.8000 1.0000 2.0000 0.0000 Constraint 92 822 0.8000 1.0000 2.0000 0.0000 Constraint 92 814 0.8000 1.0000 2.0000 0.0000 Constraint 92 805 0.8000 1.0000 2.0000 0.0000 Constraint 92 781 0.8000 1.0000 2.0000 0.0000 Constraint 92 773 0.8000 1.0000 2.0000 0.0000 Constraint 92 762 0.8000 1.0000 2.0000 0.0000 Constraint 92 723 0.8000 1.0000 2.0000 0.0000 Constraint 92 716 0.8000 1.0000 2.0000 0.0000 Constraint 92 708 0.8000 1.0000 2.0000 0.0000 Constraint 92 700 0.8000 1.0000 2.0000 0.0000 Constraint 92 691 0.8000 1.0000 2.0000 0.0000 Constraint 92 669 0.8000 1.0000 2.0000 0.0000 Constraint 92 660 0.8000 1.0000 2.0000 0.0000 Constraint 92 641 0.8000 1.0000 2.0000 0.0000 Constraint 92 632 0.8000 1.0000 2.0000 0.0000 Constraint 92 624 0.8000 1.0000 2.0000 0.0000 Constraint 92 570 0.8000 1.0000 2.0000 0.0000 Constraint 92 562 0.8000 1.0000 2.0000 0.0000 Constraint 92 551 0.8000 1.0000 2.0000 0.0000 Constraint 92 544 0.8000 1.0000 2.0000 0.0000 Constraint 92 532 0.8000 1.0000 2.0000 0.0000 Constraint 92 522 0.8000 1.0000 2.0000 0.0000 Constraint 92 515 0.8000 1.0000 2.0000 0.0000 Constraint 92 510 0.8000 1.0000 2.0000 0.0000 Constraint 92 499 0.8000 1.0000 2.0000 0.0000 Constraint 92 488 0.8000 1.0000 2.0000 0.0000 Constraint 92 472 0.8000 1.0000 2.0000 0.0000 Constraint 92 417 0.8000 1.0000 2.0000 0.0000 Constraint 92 394 0.8000 1.0000 2.0000 0.0000 Constraint 92 362 0.8000 1.0000 2.0000 0.0000 Constraint 92 266 0.8000 1.0000 2.0000 0.0000 Constraint 92 257 0.8000 1.0000 2.0000 0.0000 Constraint 92 222 0.8000 1.0000 2.0000 0.0000 Constraint 92 214 0.8000 1.0000 2.0000 0.0000 Constraint 92 196 0.8000 1.0000 2.0000 0.0000 Constraint 92 185 0.8000 1.0000 2.0000 0.0000 Constraint 92 163 0.8000 1.0000 2.0000 0.0000 Constraint 92 148 0.8000 1.0000 2.0000 0.0000 Constraint 92 141 0.8000 1.0000 2.0000 0.0000 Constraint 92 132 0.8000 1.0000 2.0000 0.0000 Constraint 92 124 0.8000 1.0000 2.0000 0.0000 Constraint 92 115 0.8000 1.0000 2.0000 0.0000 Constraint 92 100 0.8000 1.0000 2.0000 0.0000 Constraint 84 1476 0.8000 1.0000 2.0000 0.0000 Constraint 84 1467 0.8000 1.0000 2.0000 0.0000 Constraint 84 1459 0.8000 1.0000 2.0000 0.0000 Constraint 84 1451 0.8000 1.0000 2.0000 0.0000 Constraint 84 1442 0.8000 1.0000 2.0000 0.0000 Constraint 84 1430 0.8000 1.0000 2.0000 0.0000 Constraint 84 1421 0.8000 1.0000 2.0000 0.0000 Constraint 84 1413 0.8000 1.0000 2.0000 0.0000 Constraint 84 1402 0.8000 1.0000 2.0000 0.0000 Constraint 84 1395 0.8000 1.0000 2.0000 0.0000 Constraint 84 1386 0.8000 1.0000 2.0000 0.0000 Constraint 84 1381 0.8000 1.0000 2.0000 0.0000 Constraint 84 1373 0.8000 1.0000 2.0000 0.0000 Constraint 84 1362 0.8000 1.0000 2.0000 0.0000 Constraint 84 1354 0.8000 1.0000 2.0000 0.0000 Constraint 84 1339 0.8000 1.0000 2.0000 0.0000 Constraint 84 1329 0.8000 1.0000 2.0000 0.0000 Constraint 84 1318 0.8000 1.0000 2.0000 0.0000 Constraint 84 1306 0.8000 1.0000 2.0000 0.0000 Constraint 84 1295 0.8000 1.0000 2.0000 0.0000 Constraint 84 1288 0.8000 1.0000 2.0000 0.0000 Constraint 84 1281 0.8000 1.0000 2.0000 0.0000 Constraint 84 1272 0.8000 1.0000 2.0000 0.0000 Constraint 84 1264 0.8000 1.0000 2.0000 0.0000 Constraint 84 1256 0.8000 1.0000 2.0000 0.0000 Constraint 84 1244 0.8000 1.0000 2.0000 0.0000 Constraint 84 1235 0.8000 1.0000 2.0000 0.0000 Constraint 84 1225 0.8000 1.0000 2.0000 0.0000 Constraint 84 1201 0.8000 1.0000 2.0000 0.0000 Constraint 84 1192 0.8000 1.0000 2.0000 0.0000 Constraint 84 1186 0.8000 1.0000 2.0000 0.0000 Constraint 84 1174 0.8000 1.0000 2.0000 0.0000 Constraint 84 1168 0.8000 1.0000 2.0000 0.0000 Constraint 84 1159 0.8000 1.0000 2.0000 0.0000 Constraint 84 1150 0.8000 1.0000 2.0000 0.0000 Constraint 84 1144 0.8000 1.0000 2.0000 0.0000 Constraint 84 1133 0.8000 1.0000 2.0000 0.0000 Constraint 84 1124 0.8000 1.0000 2.0000 0.0000 Constraint 84 1106 0.8000 1.0000 2.0000 0.0000 Constraint 84 1095 0.8000 1.0000 2.0000 0.0000 Constraint 84 1087 0.8000 1.0000 2.0000 0.0000 Constraint 84 1075 0.8000 1.0000 2.0000 0.0000 Constraint 84 1051 0.8000 1.0000 2.0000 0.0000 Constraint 84 1039 0.8000 1.0000 2.0000 0.0000 Constraint 84 1031 0.8000 1.0000 2.0000 0.0000 Constraint 84 1024 0.8000 1.0000 2.0000 0.0000 Constraint 84 1015 0.8000 1.0000 2.0000 0.0000 Constraint 84 1007 0.8000 1.0000 2.0000 0.0000 Constraint 84 998 0.8000 1.0000 2.0000 0.0000 Constraint 84 990 0.8000 1.0000 2.0000 0.0000 Constraint 84 981 0.8000 1.0000 2.0000 0.0000 Constraint 84 973 0.8000 1.0000 2.0000 0.0000 Constraint 84 967 0.8000 1.0000 2.0000 0.0000 Constraint 84 958 0.8000 1.0000 2.0000 0.0000 Constraint 84 939 0.8000 1.0000 2.0000 0.0000 Constraint 84 931 0.8000 1.0000 2.0000 0.0000 Constraint 84 924 0.8000 1.0000 2.0000 0.0000 Constraint 84 915 0.8000 1.0000 2.0000 0.0000 Constraint 84 907 0.8000 1.0000 2.0000 0.0000 Constraint 84 900 0.8000 1.0000 2.0000 0.0000 Constraint 84 892 0.8000 1.0000 2.0000 0.0000 Constraint 84 884 0.8000 1.0000 2.0000 0.0000 Constraint 84 871 0.8000 1.0000 2.0000 0.0000 Constraint 84 833 0.8000 1.0000 2.0000 0.0000 Constraint 84 822 0.8000 1.0000 2.0000 0.0000 Constraint 84 814 0.8000 1.0000 2.0000 0.0000 Constraint 84 805 0.8000 1.0000 2.0000 0.0000 Constraint 84 794 0.8000 1.0000 2.0000 0.0000 Constraint 84 789 0.8000 1.0000 2.0000 0.0000 Constraint 84 781 0.8000 1.0000 2.0000 0.0000 Constraint 84 773 0.8000 1.0000 2.0000 0.0000 Constraint 84 762 0.8000 1.0000 2.0000 0.0000 Constraint 84 756 0.8000 1.0000 2.0000 0.0000 Constraint 84 742 0.8000 1.0000 2.0000 0.0000 Constraint 84 723 0.8000 1.0000 2.0000 0.0000 Constraint 84 716 0.8000 1.0000 2.0000 0.0000 Constraint 84 708 0.8000 1.0000 2.0000 0.0000 Constraint 84 700 0.8000 1.0000 2.0000 0.0000 Constraint 84 691 0.8000 1.0000 2.0000 0.0000 Constraint 84 683 0.8000 1.0000 2.0000 0.0000 Constraint 84 669 0.8000 1.0000 2.0000 0.0000 Constraint 84 660 0.8000 1.0000 2.0000 0.0000 Constraint 84 641 0.8000 1.0000 2.0000 0.0000 Constraint 84 632 0.8000 1.0000 2.0000 0.0000 Constraint 84 570 0.8000 1.0000 2.0000 0.0000 Constraint 84 562 0.8000 1.0000 2.0000 0.0000 Constraint 84 551 0.8000 1.0000 2.0000 0.0000 Constraint 84 544 0.8000 1.0000 2.0000 0.0000 Constraint 84 532 0.8000 1.0000 2.0000 0.0000 Constraint 84 515 0.8000 1.0000 2.0000 0.0000 Constraint 84 510 0.8000 1.0000 2.0000 0.0000 Constraint 84 499 0.8000 1.0000 2.0000 0.0000 Constraint 84 481 0.8000 1.0000 2.0000 0.0000 Constraint 84 472 0.8000 1.0000 2.0000 0.0000 Constraint 84 446 0.8000 1.0000 2.0000 0.0000 Constraint 84 439 0.8000 1.0000 2.0000 0.0000 Constraint 84 417 0.8000 1.0000 2.0000 0.0000 Constraint 84 408 0.8000 1.0000 2.0000 0.0000 Constraint 84 291 0.8000 1.0000 2.0000 0.0000 Constraint 84 257 0.8000 1.0000 2.0000 0.0000 Constraint 84 222 0.8000 1.0000 2.0000 0.0000 Constraint 84 196 0.8000 1.0000 2.0000 0.0000 Constraint 84 185 0.8000 1.0000 2.0000 0.0000 Constraint 84 163 0.8000 1.0000 2.0000 0.0000 Constraint 84 141 0.8000 1.0000 2.0000 0.0000 Constraint 84 132 0.8000 1.0000 2.0000 0.0000 Constraint 84 124 0.8000 1.0000 2.0000 0.0000 Constraint 84 115 0.8000 1.0000 2.0000 0.0000 Constraint 84 100 0.8000 1.0000 2.0000 0.0000 Constraint 84 92 0.8000 1.0000 2.0000 0.0000 Constraint 69 1476 0.8000 1.0000 2.0000 0.0000 Constraint 69 1467 0.8000 1.0000 2.0000 0.0000 Constraint 69 1459 0.8000 1.0000 2.0000 0.0000 Constraint 69 1451 0.8000 1.0000 2.0000 0.0000 Constraint 69 1442 0.8000 1.0000 2.0000 0.0000 Constraint 69 1430 0.8000 1.0000 2.0000 0.0000 Constraint 69 1421 0.8000 1.0000 2.0000 0.0000 Constraint 69 1413 0.8000 1.0000 2.0000 0.0000 Constraint 69 1402 0.8000 1.0000 2.0000 0.0000 Constraint 69 1395 0.8000 1.0000 2.0000 0.0000 Constraint 69 1386 0.8000 1.0000 2.0000 0.0000 Constraint 69 1381 0.8000 1.0000 2.0000 0.0000 Constraint 69 1373 0.8000 1.0000 2.0000 0.0000 Constraint 69 1362 0.8000 1.0000 2.0000 0.0000 Constraint 69 1339 0.8000 1.0000 2.0000 0.0000 Constraint 69 1329 0.8000 1.0000 2.0000 0.0000 Constraint 69 1318 0.8000 1.0000 2.0000 0.0000 Constraint 69 1306 0.8000 1.0000 2.0000 0.0000 Constraint 69 1295 0.8000 1.0000 2.0000 0.0000 Constraint 69 1288 0.8000 1.0000 2.0000 0.0000 Constraint 69 1281 0.8000 1.0000 2.0000 0.0000 Constraint 69 1272 0.8000 1.0000 2.0000 0.0000 Constraint 69 1264 0.8000 1.0000 2.0000 0.0000 Constraint 69 1256 0.8000 1.0000 2.0000 0.0000 Constraint 69 1244 0.8000 1.0000 2.0000 0.0000 Constraint 69 1235 0.8000 1.0000 2.0000 0.0000 Constraint 69 1225 0.8000 1.0000 2.0000 0.0000 Constraint 69 1213 0.8000 1.0000 2.0000 0.0000 Constraint 69 1208 0.8000 1.0000 2.0000 0.0000 Constraint 69 1201 0.8000 1.0000 2.0000 0.0000 Constraint 69 1192 0.8000 1.0000 2.0000 0.0000 Constraint 69 1186 0.8000 1.0000 2.0000 0.0000 Constraint 69 1174 0.8000 1.0000 2.0000 0.0000 Constraint 69 1168 0.8000 1.0000 2.0000 0.0000 Constraint 69 1159 0.8000 1.0000 2.0000 0.0000 Constraint 69 1150 0.8000 1.0000 2.0000 0.0000 Constraint 69 1133 0.8000 1.0000 2.0000 0.0000 Constraint 69 1124 0.8000 1.0000 2.0000 0.0000 Constraint 69 1106 0.8000 1.0000 2.0000 0.0000 Constraint 69 1051 0.8000 1.0000 2.0000 0.0000 Constraint 69 1039 0.8000 1.0000 2.0000 0.0000 Constraint 69 1015 0.8000 1.0000 2.0000 0.0000 Constraint 69 1007 0.8000 1.0000 2.0000 0.0000 Constraint 69 998 0.8000 1.0000 2.0000 0.0000 Constraint 69 990 0.8000 1.0000 2.0000 0.0000 Constraint 69 981 0.8000 1.0000 2.0000 0.0000 Constraint 69 973 0.8000 1.0000 2.0000 0.0000 Constraint 69 967 0.8000 1.0000 2.0000 0.0000 Constraint 69 958 0.8000 1.0000 2.0000 0.0000 Constraint 69 951 0.8000 1.0000 2.0000 0.0000 Constraint 69 944 0.8000 1.0000 2.0000 0.0000 Constraint 69 939 0.8000 1.0000 2.0000 0.0000 Constraint 69 931 0.8000 1.0000 2.0000 0.0000 Constraint 69 915 0.8000 1.0000 2.0000 0.0000 Constraint 69 907 0.8000 1.0000 2.0000 0.0000 Constraint 69 900 0.8000 1.0000 2.0000 0.0000 Constraint 69 892 0.8000 1.0000 2.0000 0.0000 Constraint 69 884 0.8000 1.0000 2.0000 0.0000 Constraint 69 841 0.8000 1.0000 2.0000 0.0000 Constraint 69 833 0.8000 1.0000 2.0000 0.0000 Constraint 69 822 0.8000 1.0000 2.0000 0.0000 Constraint 69 814 0.8000 1.0000 2.0000 0.0000 Constraint 69 805 0.8000 1.0000 2.0000 0.0000 Constraint 69 794 0.8000 1.0000 2.0000 0.0000 Constraint 69 789 0.8000 1.0000 2.0000 0.0000 Constraint 69 781 0.8000 1.0000 2.0000 0.0000 Constraint 69 773 0.8000 1.0000 2.0000 0.0000 Constraint 69 762 0.8000 1.0000 2.0000 0.0000 Constraint 69 756 0.8000 1.0000 2.0000 0.0000 Constraint 69 742 0.8000 1.0000 2.0000 0.0000 Constraint 69 728 0.8000 1.0000 2.0000 0.0000 Constraint 69 723 0.8000 1.0000 2.0000 0.0000 Constraint 69 716 0.8000 1.0000 2.0000 0.0000 Constraint 69 708 0.8000 1.0000 2.0000 0.0000 Constraint 69 700 0.8000 1.0000 2.0000 0.0000 Constraint 69 691 0.8000 1.0000 2.0000 0.0000 Constraint 69 683 0.8000 1.0000 2.0000 0.0000 Constraint 69 669 0.8000 1.0000 2.0000 0.0000 Constraint 69 660 0.8000 1.0000 2.0000 0.0000 Constraint 69 649 0.8000 1.0000 2.0000 0.0000 Constraint 69 641 0.8000 1.0000 2.0000 0.0000 Constraint 69 632 0.8000 1.0000 2.0000 0.0000 Constraint 69 624 0.8000 1.0000 2.0000 0.0000 Constraint 69 579 0.8000 1.0000 2.0000 0.0000 Constraint 69 570 0.8000 1.0000 2.0000 0.0000 Constraint 69 562 0.8000 1.0000 2.0000 0.0000 Constraint 69 551 0.8000 1.0000 2.0000 0.0000 Constraint 69 544 0.8000 1.0000 2.0000 0.0000 Constraint 69 532 0.8000 1.0000 2.0000 0.0000 Constraint 69 515 0.8000 1.0000 2.0000 0.0000 Constraint 69 510 0.8000 1.0000 2.0000 0.0000 Constraint 69 499 0.8000 1.0000 2.0000 0.0000 Constraint 69 488 0.8000 1.0000 2.0000 0.0000 Constraint 69 481 0.8000 1.0000 2.0000 0.0000 Constraint 69 472 0.8000 1.0000 2.0000 0.0000 Constraint 69 455 0.8000 1.0000 2.0000 0.0000 Constraint 69 446 0.8000 1.0000 2.0000 0.0000 Constraint 69 422 0.8000 1.0000 2.0000 0.0000 Constraint 69 417 0.8000 1.0000 2.0000 0.0000 Constraint 69 386 0.8000 1.0000 2.0000 0.0000 Constraint 69 380 0.8000 1.0000 2.0000 0.0000 Constraint 69 229 0.8000 1.0000 2.0000 0.0000 Constraint 69 222 0.8000 1.0000 2.0000 0.0000 Constraint 69 196 0.8000 1.0000 2.0000 0.0000 Constraint 69 168 0.8000 1.0000 2.0000 0.0000 Constraint 69 163 0.8000 1.0000 2.0000 0.0000 Constraint 69 141 0.8000 1.0000 2.0000 0.0000 Constraint 69 124 0.8000 1.0000 2.0000 0.0000 Constraint 69 115 0.8000 1.0000 2.0000 0.0000 Constraint 69 100 0.8000 1.0000 2.0000 0.0000 Constraint 69 92 0.8000 1.0000 2.0000 0.0000 Constraint 69 84 0.8000 1.0000 2.0000 0.0000 Constraint 62 1476 0.8000 1.0000 2.0000 0.0000 Constraint 62 1467 0.8000 1.0000 2.0000 0.0000 Constraint 62 1459 0.8000 1.0000 2.0000 0.0000 Constraint 62 1451 0.8000 1.0000 2.0000 0.0000 Constraint 62 1442 0.8000 1.0000 2.0000 0.0000 Constraint 62 1430 0.8000 1.0000 2.0000 0.0000 Constraint 62 1421 0.8000 1.0000 2.0000 0.0000 Constraint 62 1413 0.8000 1.0000 2.0000 0.0000 Constraint 62 1402 0.8000 1.0000 2.0000 0.0000 Constraint 62 1395 0.8000 1.0000 2.0000 0.0000 Constraint 62 1386 0.8000 1.0000 2.0000 0.0000 Constraint 62 1381 0.8000 1.0000 2.0000 0.0000 Constraint 62 1373 0.8000 1.0000 2.0000 0.0000 Constraint 62 1362 0.8000 1.0000 2.0000 0.0000 Constraint 62 1354 0.8000 1.0000 2.0000 0.0000 Constraint 62 1347 0.8000 1.0000 2.0000 0.0000 Constraint 62 1339 0.8000 1.0000 2.0000 0.0000 Constraint 62 1329 0.8000 1.0000 2.0000 0.0000 Constraint 62 1318 0.8000 1.0000 2.0000 0.0000 Constraint 62 1306 0.8000 1.0000 2.0000 0.0000 Constraint 62 1295 0.8000 1.0000 2.0000 0.0000 Constraint 62 1288 0.8000 1.0000 2.0000 0.0000 Constraint 62 1281 0.8000 1.0000 2.0000 0.0000 Constraint 62 1272 0.8000 1.0000 2.0000 0.0000 Constraint 62 1264 0.8000 1.0000 2.0000 0.0000 Constraint 62 1256 0.8000 1.0000 2.0000 0.0000 Constraint 62 1244 0.8000 1.0000 2.0000 0.0000 Constraint 62 1235 0.8000 1.0000 2.0000 0.0000 Constraint 62 1225 0.8000 1.0000 2.0000 0.0000 Constraint 62 1213 0.8000 1.0000 2.0000 0.0000 Constraint 62 1208 0.8000 1.0000 2.0000 0.0000 Constraint 62 1201 0.8000 1.0000 2.0000 0.0000 Constraint 62 1192 0.8000 1.0000 2.0000 0.0000 Constraint 62 1186 0.8000 1.0000 2.0000 0.0000 Constraint 62 1174 0.8000 1.0000 2.0000 0.0000 Constraint 62 1168 0.8000 1.0000 2.0000 0.0000 Constraint 62 1159 0.8000 1.0000 2.0000 0.0000 Constraint 62 1150 0.8000 1.0000 2.0000 0.0000 Constraint 62 1144 0.8000 1.0000 2.0000 0.0000 Constraint 62 1133 0.8000 1.0000 2.0000 0.0000 Constraint 62 1124 0.8000 1.0000 2.0000 0.0000 Constraint 62 1106 0.8000 1.0000 2.0000 0.0000 Constraint 62 1075 0.8000 1.0000 2.0000 0.0000 Constraint 62 1066 0.8000 1.0000 2.0000 0.0000 Constraint 62 1015 0.8000 1.0000 2.0000 0.0000 Constraint 62 1007 0.8000 1.0000 2.0000 0.0000 Constraint 62 990 0.8000 1.0000 2.0000 0.0000 Constraint 62 981 0.8000 1.0000 2.0000 0.0000 Constraint 62 973 0.8000 1.0000 2.0000 0.0000 Constraint 62 967 0.8000 1.0000 2.0000 0.0000 Constraint 62 958 0.8000 1.0000 2.0000 0.0000 Constraint 62 944 0.8000 1.0000 2.0000 0.0000 Constraint 62 939 0.8000 1.0000 2.0000 0.0000 Constraint 62 931 0.8000 1.0000 2.0000 0.0000 Constraint 62 924 0.8000 1.0000 2.0000 0.0000 Constraint 62 915 0.8000 1.0000 2.0000 0.0000 Constraint 62 907 0.8000 1.0000 2.0000 0.0000 Constraint 62 900 0.8000 1.0000 2.0000 0.0000 Constraint 62 892 0.8000 1.0000 2.0000 0.0000 Constraint 62 884 0.8000 1.0000 2.0000 0.0000 Constraint 62 841 0.8000 1.0000 2.0000 0.0000 Constraint 62 833 0.8000 1.0000 2.0000 0.0000 Constraint 62 822 0.8000 1.0000 2.0000 0.0000 Constraint 62 814 0.8000 1.0000 2.0000 0.0000 Constraint 62 805 0.8000 1.0000 2.0000 0.0000 Constraint 62 789 0.8000 1.0000 2.0000 0.0000 Constraint 62 781 0.8000 1.0000 2.0000 0.0000 Constraint 62 773 0.8000 1.0000 2.0000 0.0000 Constraint 62 762 0.8000 1.0000 2.0000 0.0000 Constraint 62 756 0.8000 1.0000 2.0000 0.0000 Constraint 62 742 0.8000 1.0000 2.0000 0.0000 Constraint 62 728 0.8000 1.0000 2.0000 0.0000 Constraint 62 723 0.8000 1.0000 2.0000 0.0000 Constraint 62 716 0.8000 1.0000 2.0000 0.0000 Constraint 62 700 0.8000 1.0000 2.0000 0.0000 Constraint 62 691 0.8000 1.0000 2.0000 0.0000 Constraint 62 669 0.8000 1.0000 2.0000 0.0000 Constraint 62 660 0.8000 1.0000 2.0000 0.0000 Constraint 62 632 0.8000 1.0000 2.0000 0.0000 Constraint 62 570 0.8000 1.0000 2.0000 0.0000 Constraint 62 562 0.8000 1.0000 2.0000 0.0000 Constraint 62 544 0.8000 1.0000 2.0000 0.0000 Constraint 62 515 0.8000 1.0000 2.0000 0.0000 Constraint 62 510 0.8000 1.0000 2.0000 0.0000 Constraint 62 481 0.8000 1.0000 2.0000 0.0000 Constraint 62 472 0.8000 1.0000 2.0000 0.0000 Constraint 62 455 0.8000 1.0000 2.0000 0.0000 Constraint 62 446 0.8000 1.0000 2.0000 0.0000 Constraint 62 439 0.8000 1.0000 2.0000 0.0000 Constraint 62 417 0.8000 1.0000 2.0000 0.0000 Constraint 62 386 0.8000 1.0000 2.0000 0.0000 Constraint 62 380 0.8000 1.0000 2.0000 0.0000 Constraint 62 229 0.8000 1.0000 2.0000 0.0000 Constraint 62 222 0.8000 1.0000 2.0000 0.0000 Constraint 62 196 0.8000 1.0000 2.0000 0.0000 Constraint 62 168 0.8000 1.0000 2.0000 0.0000 Constraint 62 163 0.8000 1.0000 2.0000 0.0000 Constraint 62 115 0.8000 1.0000 2.0000 0.0000 Constraint 62 100 0.8000 1.0000 2.0000 0.0000 Constraint 62 92 0.8000 1.0000 2.0000 0.0000 Constraint 62 84 0.8000 1.0000 2.0000 0.0000 Constraint 62 69 0.8000 1.0000 2.0000 0.0000 Constraint 54 1476 0.8000 1.0000 2.0000 0.0000 Constraint 54 1467 0.8000 1.0000 2.0000 0.0000 Constraint 54 1459 0.8000 1.0000 2.0000 0.0000 Constraint 54 1451 0.8000 1.0000 2.0000 0.0000 Constraint 54 1442 0.8000 1.0000 2.0000 0.0000 Constraint 54 1421 0.8000 1.0000 2.0000 0.0000 Constraint 54 1413 0.8000 1.0000 2.0000 0.0000 Constraint 54 1402 0.8000 1.0000 2.0000 0.0000 Constraint 54 1386 0.8000 1.0000 2.0000 0.0000 Constraint 54 1381 0.8000 1.0000 2.0000 0.0000 Constraint 54 1373 0.8000 1.0000 2.0000 0.0000 Constraint 54 1362 0.8000 1.0000 2.0000 0.0000 Constraint 54 1347 0.8000 1.0000 2.0000 0.0000 Constraint 54 1339 0.8000 1.0000 2.0000 0.0000 Constraint 54 1329 0.8000 1.0000 2.0000 0.0000 Constraint 54 1318 0.8000 1.0000 2.0000 0.0000 Constraint 54 1306 0.8000 1.0000 2.0000 0.0000 Constraint 54 1295 0.8000 1.0000 2.0000 0.0000 Constraint 54 1288 0.8000 1.0000 2.0000 0.0000 Constraint 54 1281 0.8000 1.0000 2.0000 0.0000 Constraint 54 1272 0.8000 1.0000 2.0000 0.0000 Constraint 54 1264 0.8000 1.0000 2.0000 0.0000 Constraint 54 1244 0.8000 1.0000 2.0000 0.0000 Constraint 54 1235 0.8000 1.0000 2.0000 0.0000 Constraint 54 1225 0.8000 1.0000 2.0000 0.0000 Constraint 54 1208 0.8000 1.0000 2.0000 0.0000 Constraint 54 1201 0.8000 1.0000 2.0000 0.0000 Constraint 54 1192 0.8000 1.0000 2.0000 0.0000 Constraint 54 1186 0.8000 1.0000 2.0000 0.0000 Constraint 54 1174 0.8000 1.0000 2.0000 0.0000 Constraint 54 1168 0.8000 1.0000 2.0000 0.0000 Constraint 54 1159 0.8000 1.0000 2.0000 0.0000 Constraint 54 1150 0.8000 1.0000 2.0000 0.0000 Constraint 54 1133 0.8000 1.0000 2.0000 0.0000 Constraint 54 1124 0.8000 1.0000 2.0000 0.0000 Constraint 54 1075 0.8000 1.0000 2.0000 0.0000 Constraint 54 1066 0.8000 1.0000 2.0000 0.0000 Constraint 54 1015 0.8000 1.0000 2.0000 0.0000 Constraint 54 1007 0.8000 1.0000 2.0000 0.0000 Constraint 54 998 0.8000 1.0000 2.0000 0.0000 Constraint 54 990 0.8000 1.0000 2.0000 0.0000 Constraint 54 981 0.8000 1.0000 2.0000 0.0000 Constraint 54 967 0.8000 1.0000 2.0000 0.0000 Constraint 54 958 0.8000 1.0000 2.0000 0.0000 Constraint 54 939 0.8000 1.0000 2.0000 0.0000 Constraint 54 915 0.8000 1.0000 2.0000 0.0000 Constraint 54 907 0.8000 1.0000 2.0000 0.0000 Constraint 54 900 0.8000 1.0000 2.0000 0.0000 Constraint 54 892 0.8000 1.0000 2.0000 0.0000 Constraint 54 884 0.8000 1.0000 2.0000 0.0000 Constraint 54 871 0.8000 1.0000 2.0000 0.0000 Constraint 54 833 0.8000 1.0000 2.0000 0.0000 Constraint 54 822 0.8000 1.0000 2.0000 0.0000 Constraint 54 814 0.8000 1.0000 2.0000 0.0000 Constraint 54 805 0.8000 1.0000 2.0000 0.0000 Constraint 54 794 0.8000 1.0000 2.0000 0.0000 Constraint 54 789 0.8000 1.0000 2.0000 0.0000 Constraint 54 781 0.8000 1.0000 2.0000 0.0000 Constraint 54 773 0.8000 1.0000 2.0000 0.0000 Constraint 54 762 0.8000 1.0000 2.0000 0.0000 Constraint 54 756 0.8000 1.0000 2.0000 0.0000 Constraint 54 742 0.8000 1.0000 2.0000 0.0000 Constraint 54 728 0.8000 1.0000 2.0000 0.0000 Constraint 54 723 0.8000 1.0000 2.0000 0.0000 Constraint 54 716 0.8000 1.0000 2.0000 0.0000 Constraint 54 708 0.8000 1.0000 2.0000 0.0000 Constraint 54 700 0.8000 1.0000 2.0000 0.0000 Constraint 54 691 0.8000 1.0000 2.0000 0.0000 Constraint 54 683 0.8000 1.0000 2.0000 0.0000 Constraint 54 674 0.8000 1.0000 2.0000 0.0000 Constraint 54 669 0.8000 1.0000 2.0000 0.0000 Constraint 54 660 0.8000 1.0000 2.0000 0.0000 Constraint 54 641 0.8000 1.0000 2.0000 0.0000 Constraint 54 632 0.8000 1.0000 2.0000 0.0000 Constraint 54 570 0.8000 1.0000 2.0000 0.0000 Constraint 54 562 0.8000 1.0000 2.0000 0.0000 Constraint 54 551 0.8000 1.0000 2.0000 0.0000 Constraint 54 544 0.8000 1.0000 2.0000 0.0000 Constraint 54 532 0.8000 1.0000 2.0000 0.0000 Constraint 54 522 0.8000 1.0000 2.0000 0.0000 Constraint 54 515 0.8000 1.0000 2.0000 0.0000 Constraint 54 510 0.8000 1.0000 2.0000 0.0000 Constraint 54 499 0.8000 1.0000 2.0000 0.0000 Constraint 54 488 0.8000 1.0000 2.0000 0.0000 Constraint 54 481 0.8000 1.0000 2.0000 0.0000 Constraint 54 455 0.8000 1.0000 2.0000 0.0000 Constraint 54 446 0.8000 1.0000 2.0000 0.0000 Constraint 54 431 0.8000 1.0000 2.0000 0.0000 Constraint 54 422 0.8000 1.0000 2.0000 0.0000 Constraint 54 417 0.8000 1.0000 2.0000 0.0000 Constraint 54 408 0.8000 1.0000 2.0000 0.0000 Constraint 54 402 0.8000 1.0000 2.0000 0.0000 Constraint 54 394 0.8000 1.0000 2.0000 0.0000 Constraint 54 386 0.8000 1.0000 2.0000 0.0000 Constraint 54 380 0.8000 1.0000 2.0000 0.0000 Constraint 54 373 0.8000 1.0000 2.0000 0.0000 Constraint 54 362 0.8000 1.0000 2.0000 0.0000 Constraint 54 351 0.8000 1.0000 2.0000 0.0000 Constraint 54 229 0.8000 1.0000 2.0000 0.0000 Constraint 54 222 0.8000 1.0000 2.0000 0.0000 Constraint 54 205 0.8000 1.0000 2.0000 0.0000 Constraint 54 196 0.8000 1.0000 2.0000 0.0000 Constraint 54 168 0.8000 1.0000 2.0000 0.0000 Constraint 54 163 0.8000 1.0000 2.0000 0.0000 Constraint 54 148 0.8000 1.0000 2.0000 0.0000 Constraint 54 141 0.8000 1.0000 2.0000 0.0000 Constraint 54 100 0.8000 1.0000 2.0000 0.0000 Constraint 54 92 0.8000 1.0000 2.0000 0.0000 Constraint 54 84 0.8000 1.0000 2.0000 0.0000 Constraint 54 69 0.8000 1.0000 2.0000 0.0000 Constraint 54 62 0.8000 1.0000 2.0000 0.0000 Constraint 46 1476 0.8000 1.0000 2.0000 0.0000 Constraint 46 1467 0.8000 1.0000 2.0000 0.0000 Constraint 46 1459 0.8000 1.0000 2.0000 0.0000 Constraint 46 1451 0.8000 1.0000 2.0000 0.0000 Constraint 46 1442 0.8000 1.0000 2.0000 0.0000 Constraint 46 1430 0.8000 1.0000 2.0000 0.0000 Constraint 46 1421 0.8000 1.0000 2.0000 0.0000 Constraint 46 1413 0.8000 1.0000 2.0000 0.0000 Constraint 46 1402 0.8000 1.0000 2.0000 0.0000 Constraint 46 1395 0.8000 1.0000 2.0000 0.0000 Constraint 46 1386 0.8000 1.0000 2.0000 0.0000 Constraint 46 1381 0.8000 1.0000 2.0000 0.0000 Constraint 46 1373 0.8000 1.0000 2.0000 0.0000 Constraint 46 1362 0.8000 1.0000 2.0000 0.0000 Constraint 46 1354 0.8000 1.0000 2.0000 0.0000 Constraint 46 1347 0.8000 1.0000 2.0000 0.0000 Constraint 46 1339 0.8000 1.0000 2.0000 0.0000 Constraint 46 1329 0.8000 1.0000 2.0000 0.0000 Constraint 46 1318 0.8000 1.0000 2.0000 0.0000 Constraint 46 1306 0.8000 1.0000 2.0000 0.0000 Constraint 46 1295 0.8000 1.0000 2.0000 0.0000 Constraint 46 1288 0.8000 1.0000 2.0000 0.0000 Constraint 46 1281 0.8000 1.0000 2.0000 0.0000 Constraint 46 1272 0.8000 1.0000 2.0000 0.0000 Constraint 46 1264 0.8000 1.0000 2.0000 0.0000 Constraint 46 1256 0.8000 1.0000 2.0000 0.0000 Constraint 46 1244 0.8000 1.0000 2.0000 0.0000 Constraint 46 1235 0.8000 1.0000 2.0000 0.0000 Constraint 46 1225 0.8000 1.0000 2.0000 0.0000 Constraint 46 1213 0.8000 1.0000 2.0000 0.0000 Constraint 46 1208 0.8000 1.0000 2.0000 0.0000 Constraint 46 1201 0.8000 1.0000 2.0000 0.0000 Constraint 46 1192 0.8000 1.0000 2.0000 0.0000 Constraint 46 1186 0.8000 1.0000 2.0000 0.0000 Constraint 46 1174 0.8000 1.0000 2.0000 0.0000 Constraint 46 1168 0.8000 1.0000 2.0000 0.0000 Constraint 46 1159 0.8000 1.0000 2.0000 0.0000 Constraint 46 1150 0.8000 1.0000 2.0000 0.0000 Constraint 46 1144 0.8000 1.0000 2.0000 0.0000 Constraint 46 1133 0.8000 1.0000 2.0000 0.0000 Constraint 46 1124 0.8000 1.0000 2.0000 0.0000 Constraint 46 1095 0.8000 1.0000 2.0000 0.0000 Constraint 46 1087 0.8000 1.0000 2.0000 0.0000 Constraint 46 1075 0.8000 1.0000 2.0000 0.0000 Constraint 46 1066 0.8000 1.0000 2.0000 0.0000 Constraint 46 1024 0.8000 1.0000 2.0000 0.0000 Constraint 46 1015 0.8000 1.0000 2.0000 0.0000 Constraint 46 1007 0.8000 1.0000 2.0000 0.0000 Constraint 46 990 0.8000 1.0000 2.0000 0.0000 Constraint 46 981 0.8000 1.0000 2.0000 0.0000 Constraint 46 973 0.8000 1.0000 2.0000 0.0000 Constraint 46 967 0.8000 1.0000 2.0000 0.0000 Constraint 46 958 0.8000 1.0000 2.0000 0.0000 Constraint 46 951 0.8000 1.0000 2.0000 0.0000 Constraint 46 944 0.8000 1.0000 2.0000 0.0000 Constraint 46 939 0.8000 1.0000 2.0000 0.0000 Constraint 46 931 0.8000 1.0000 2.0000 0.0000 Constraint 46 924 0.8000 1.0000 2.0000 0.0000 Constraint 46 915 0.8000 1.0000 2.0000 0.0000 Constraint 46 907 0.8000 1.0000 2.0000 0.0000 Constraint 46 900 0.8000 1.0000 2.0000 0.0000 Constraint 46 892 0.8000 1.0000 2.0000 0.0000 Constraint 46 884 0.8000 1.0000 2.0000 0.0000 Constraint 46 871 0.8000 1.0000 2.0000 0.0000 Constraint 46 833 0.8000 1.0000 2.0000 0.0000 Constraint 46 814 0.8000 1.0000 2.0000 0.0000 Constraint 46 794 0.8000 1.0000 2.0000 0.0000 Constraint 46 789 0.8000 1.0000 2.0000 0.0000 Constraint 46 781 0.8000 1.0000 2.0000 0.0000 Constraint 46 773 0.8000 1.0000 2.0000 0.0000 Constraint 46 762 0.8000 1.0000 2.0000 0.0000 Constraint 46 756 0.8000 1.0000 2.0000 0.0000 Constraint 46 742 0.8000 1.0000 2.0000 0.0000 Constraint 46 728 0.8000 1.0000 2.0000 0.0000 Constraint 46 723 0.8000 1.0000 2.0000 0.0000 Constraint 46 716 0.8000 1.0000 2.0000 0.0000 Constraint 46 708 0.8000 1.0000 2.0000 0.0000 Constraint 46 700 0.8000 1.0000 2.0000 0.0000 Constraint 46 691 0.8000 1.0000 2.0000 0.0000 Constraint 46 669 0.8000 1.0000 2.0000 0.0000 Constraint 46 660 0.8000 1.0000 2.0000 0.0000 Constraint 46 641 0.8000 1.0000 2.0000 0.0000 Constraint 46 632 0.8000 1.0000 2.0000 0.0000 Constraint 46 624 0.8000 1.0000 2.0000 0.0000 Constraint 46 618 0.8000 1.0000 2.0000 0.0000 Constraint 46 562 0.8000 1.0000 2.0000 0.0000 Constraint 46 544 0.8000 1.0000 2.0000 0.0000 Constraint 46 532 0.8000 1.0000 2.0000 0.0000 Constraint 46 522 0.8000 1.0000 2.0000 0.0000 Constraint 46 515 0.8000 1.0000 2.0000 0.0000 Constraint 46 510 0.8000 1.0000 2.0000 0.0000 Constraint 46 499 0.8000 1.0000 2.0000 0.0000 Constraint 46 481 0.8000 1.0000 2.0000 0.0000 Constraint 46 472 0.8000 1.0000 2.0000 0.0000 Constraint 46 446 0.8000 1.0000 2.0000 0.0000 Constraint 46 439 0.8000 1.0000 2.0000 0.0000 Constraint 46 422 0.8000 1.0000 2.0000 0.0000 Constraint 46 417 0.8000 1.0000 2.0000 0.0000 Constraint 46 408 0.8000 1.0000 2.0000 0.0000 Constraint 46 402 0.8000 1.0000 2.0000 0.0000 Constraint 46 394 0.8000 1.0000 2.0000 0.0000 Constraint 46 386 0.8000 1.0000 2.0000 0.0000 Constraint 46 380 0.8000 1.0000 2.0000 0.0000 Constraint 46 373 0.8000 1.0000 2.0000 0.0000 Constraint 46 362 0.8000 1.0000 2.0000 0.0000 Constraint 46 351 0.8000 1.0000 2.0000 0.0000 Constraint 46 335 0.8000 1.0000 2.0000 0.0000 Constraint 46 325 0.8000 1.0000 2.0000 0.0000 Constraint 46 229 0.8000 1.0000 2.0000 0.0000 Constraint 46 222 0.8000 1.0000 2.0000 0.0000 Constraint 46 205 0.8000 1.0000 2.0000 0.0000 Constraint 46 196 0.8000 1.0000 2.0000 0.0000 Constraint 46 185 0.8000 1.0000 2.0000 0.0000 Constraint 46 168 0.8000 1.0000 2.0000 0.0000 Constraint 46 163 0.8000 1.0000 2.0000 0.0000 Constraint 46 148 0.8000 1.0000 2.0000 0.0000 Constraint 46 141 0.8000 1.0000 2.0000 0.0000 Constraint 46 132 0.8000 1.0000 2.0000 0.0000 Constraint 46 124 0.8000 1.0000 2.0000 0.0000 Constraint 46 115 0.8000 1.0000 2.0000 0.0000 Constraint 46 100 0.8000 1.0000 2.0000 0.0000 Constraint 46 92 0.8000 1.0000 2.0000 0.0000 Constraint 46 84 0.8000 1.0000 2.0000 0.0000 Constraint 46 69 0.8000 1.0000 2.0000 0.0000 Constraint 46 62 0.8000 1.0000 2.0000 0.0000 Constraint 46 54 0.8000 1.0000 2.0000 0.0000 Constraint 41 1476 0.8000 1.0000 2.0000 0.0000 Constraint 41 1467 0.8000 1.0000 2.0000 0.0000 Constraint 41 1451 0.8000 1.0000 2.0000 0.0000 Constraint 41 1442 0.8000 1.0000 2.0000 0.0000 Constraint 41 1421 0.8000 1.0000 2.0000 0.0000 Constraint 41 1413 0.8000 1.0000 2.0000 0.0000 Constraint 41 1402 0.8000 1.0000 2.0000 0.0000 Constraint 41 1395 0.8000 1.0000 2.0000 0.0000 Constraint 41 1386 0.8000 1.0000 2.0000 0.0000 Constraint 41 1381 0.8000 1.0000 2.0000 0.0000 Constraint 41 1373 0.8000 1.0000 2.0000 0.0000 Constraint 41 1347 0.8000 1.0000 2.0000 0.0000 Constraint 41 1339 0.8000 1.0000 2.0000 0.0000 Constraint 41 1329 0.8000 1.0000 2.0000 0.0000 Constraint 41 1318 0.8000 1.0000 2.0000 0.0000 Constraint 41 1306 0.8000 1.0000 2.0000 0.0000 Constraint 41 1295 0.8000 1.0000 2.0000 0.0000 Constraint 41 1288 0.8000 1.0000 2.0000 0.0000 Constraint 41 1281 0.8000 1.0000 2.0000 0.0000 Constraint 41 1272 0.8000 1.0000 2.0000 0.0000 Constraint 41 1264 0.8000 1.0000 2.0000 0.0000 Constraint 41 1244 0.8000 1.0000 2.0000 0.0000 Constraint 41 1235 0.8000 1.0000 2.0000 0.0000 Constraint 41 1225 0.8000 1.0000 2.0000 0.0000 Constraint 41 1208 0.8000 1.0000 2.0000 0.0000 Constraint 41 1201 0.8000 1.0000 2.0000 0.0000 Constraint 41 1192 0.8000 1.0000 2.0000 0.0000 Constraint 41 1186 0.8000 1.0000 2.0000 0.0000 Constraint 41 1174 0.8000 1.0000 2.0000 0.0000 Constraint 41 1168 0.8000 1.0000 2.0000 0.0000 Constraint 41 1159 0.8000 1.0000 2.0000 0.0000 Constraint 41 1150 0.8000 1.0000 2.0000 0.0000 Constraint 41 1144 0.8000 1.0000 2.0000 0.0000 Constraint 41 1133 0.8000 1.0000 2.0000 0.0000 Constraint 41 1124 0.8000 1.0000 2.0000 0.0000 Constraint 41 1106 0.8000 1.0000 2.0000 0.0000 Constraint 41 1095 0.8000 1.0000 2.0000 0.0000 Constraint 41 1087 0.8000 1.0000 2.0000 0.0000 Constraint 41 1075 0.8000 1.0000 2.0000 0.0000 Constraint 41 1066 0.8000 1.0000 2.0000 0.0000 Constraint 41 1024 0.8000 1.0000 2.0000 0.0000 Constraint 41 1015 0.8000 1.0000 2.0000 0.0000 Constraint 41 1007 0.8000 1.0000 2.0000 0.0000 Constraint 41 998 0.8000 1.0000 2.0000 0.0000 Constraint 41 990 0.8000 1.0000 2.0000 0.0000 Constraint 41 967 0.8000 1.0000 2.0000 0.0000 Constraint 41 958 0.8000 1.0000 2.0000 0.0000 Constraint 41 944 0.8000 1.0000 2.0000 0.0000 Constraint 41 939 0.8000 1.0000 2.0000 0.0000 Constraint 41 931 0.8000 1.0000 2.0000 0.0000 Constraint 41 924 0.8000 1.0000 2.0000 0.0000 Constraint 41 915 0.8000 1.0000 2.0000 0.0000 Constraint 41 907 0.8000 1.0000 2.0000 0.0000 Constraint 41 900 0.8000 1.0000 2.0000 0.0000 Constraint 41 892 0.8000 1.0000 2.0000 0.0000 Constraint 41 884 0.8000 1.0000 2.0000 0.0000 Constraint 41 871 0.8000 1.0000 2.0000 0.0000 Constraint 41 864 0.8000 1.0000 2.0000 0.0000 Constraint 41 852 0.8000 1.0000 2.0000 0.0000 Constraint 41 814 0.8000 1.0000 2.0000 0.0000 Constraint 41 794 0.8000 1.0000 2.0000 0.0000 Constraint 41 789 0.8000 1.0000 2.0000 0.0000 Constraint 41 773 0.8000 1.0000 2.0000 0.0000 Constraint 41 762 0.8000 1.0000 2.0000 0.0000 Constraint 41 756 0.8000 1.0000 2.0000 0.0000 Constraint 41 742 0.8000 1.0000 2.0000 0.0000 Constraint 41 728 0.8000 1.0000 2.0000 0.0000 Constraint 41 723 0.8000 1.0000 2.0000 0.0000 Constraint 41 716 0.8000 1.0000 2.0000 0.0000 Constraint 41 708 0.8000 1.0000 2.0000 0.0000 Constraint 41 700 0.8000 1.0000 2.0000 0.0000 Constraint 41 691 0.8000 1.0000 2.0000 0.0000 Constraint 41 683 0.8000 1.0000 2.0000 0.0000 Constraint 41 674 0.8000 1.0000 2.0000 0.0000 Constraint 41 669 0.8000 1.0000 2.0000 0.0000 Constraint 41 660 0.8000 1.0000 2.0000 0.0000 Constraint 41 641 0.8000 1.0000 2.0000 0.0000 Constraint 41 632 0.8000 1.0000 2.0000 0.0000 Constraint 41 624 0.8000 1.0000 2.0000 0.0000 Constraint 41 618 0.8000 1.0000 2.0000 0.0000 Constraint 41 544 0.8000 1.0000 2.0000 0.0000 Constraint 41 532 0.8000 1.0000 2.0000 0.0000 Constraint 41 522 0.8000 1.0000 2.0000 0.0000 Constraint 41 515 0.8000 1.0000 2.0000 0.0000 Constraint 41 510 0.8000 1.0000 2.0000 0.0000 Constraint 41 488 0.8000 1.0000 2.0000 0.0000 Constraint 41 481 0.8000 1.0000 2.0000 0.0000 Constraint 41 472 0.8000 1.0000 2.0000 0.0000 Constraint 41 464 0.8000 1.0000 2.0000 0.0000 Constraint 41 455 0.8000 1.0000 2.0000 0.0000 Constraint 41 446 0.8000 1.0000 2.0000 0.0000 Constraint 41 439 0.8000 1.0000 2.0000 0.0000 Constraint 41 431 0.8000 1.0000 2.0000 0.0000 Constraint 41 422 0.8000 1.0000 2.0000 0.0000 Constraint 41 417 0.8000 1.0000 2.0000 0.0000 Constraint 41 408 0.8000 1.0000 2.0000 0.0000 Constraint 41 402 0.8000 1.0000 2.0000 0.0000 Constraint 41 394 0.8000 1.0000 2.0000 0.0000 Constraint 41 386 0.8000 1.0000 2.0000 0.0000 Constraint 41 380 0.8000 1.0000 2.0000 0.0000 Constraint 41 373 0.8000 1.0000 2.0000 0.0000 Constraint 41 362 0.8000 1.0000 2.0000 0.0000 Constraint 41 351 0.8000 1.0000 2.0000 0.0000 Constraint 41 343 0.8000 1.0000 2.0000 0.0000 Constraint 41 335 0.8000 1.0000 2.0000 0.0000 Constraint 41 325 0.8000 1.0000 2.0000 0.0000 Constraint 41 237 0.8000 1.0000 2.0000 0.0000 Constraint 41 229 0.8000 1.0000 2.0000 0.0000 Constraint 41 222 0.8000 1.0000 2.0000 0.0000 Constraint 41 205 0.8000 1.0000 2.0000 0.0000 Constraint 41 196 0.8000 1.0000 2.0000 0.0000 Constraint 41 168 0.8000 1.0000 2.0000 0.0000 Constraint 41 163 0.8000 1.0000 2.0000 0.0000 Constraint 41 155 0.8000 1.0000 2.0000 0.0000 Constraint 41 148 0.8000 1.0000 2.0000 0.0000 Constraint 41 141 0.8000 1.0000 2.0000 0.0000 Constraint 41 132 0.8000 1.0000 2.0000 0.0000 Constraint 41 124 0.8000 1.0000 2.0000 0.0000 Constraint 41 115 0.8000 1.0000 2.0000 0.0000 Constraint 41 100 0.8000 1.0000 2.0000 0.0000 Constraint 41 92 0.8000 1.0000 2.0000 0.0000 Constraint 41 84 0.8000 1.0000 2.0000 0.0000 Constraint 41 69 0.8000 1.0000 2.0000 0.0000 Constraint 41 62 0.8000 1.0000 2.0000 0.0000 Constraint 41 54 0.8000 1.0000 2.0000 0.0000 Constraint 41 46 0.8000 1.0000 2.0000 0.0000 Constraint 29 1476 0.8000 1.0000 2.0000 0.0000 Constraint 29 1467 0.8000 1.0000 2.0000 0.0000 Constraint 29 1459 0.8000 1.0000 2.0000 0.0000 Constraint 29 1451 0.8000 1.0000 2.0000 0.0000 Constraint 29 1442 0.8000 1.0000 2.0000 0.0000 Constraint 29 1430 0.8000 1.0000 2.0000 0.0000 Constraint 29 1421 0.8000 1.0000 2.0000 0.0000 Constraint 29 1413 0.8000 1.0000 2.0000 0.0000 Constraint 29 1402 0.8000 1.0000 2.0000 0.0000 Constraint 29 1395 0.8000 1.0000 2.0000 0.0000 Constraint 29 1386 0.8000 1.0000 2.0000 0.0000 Constraint 29 1381 0.8000 1.0000 2.0000 0.0000 Constraint 29 1373 0.8000 1.0000 2.0000 0.0000 Constraint 29 1362 0.8000 1.0000 2.0000 0.0000 Constraint 29 1354 0.8000 1.0000 2.0000 0.0000 Constraint 29 1347 0.8000 1.0000 2.0000 0.0000 Constraint 29 1339 0.8000 1.0000 2.0000 0.0000 Constraint 29 1329 0.8000 1.0000 2.0000 0.0000 Constraint 29 1318 0.8000 1.0000 2.0000 0.0000 Constraint 29 1306 0.8000 1.0000 2.0000 0.0000 Constraint 29 1295 0.8000 1.0000 2.0000 0.0000 Constraint 29 1288 0.8000 1.0000 2.0000 0.0000 Constraint 29 1281 0.8000 1.0000 2.0000 0.0000 Constraint 29 1272 0.8000 1.0000 2.0000 0.0000 Constraint 29 1264 0.8000 1.0000 2.0000 0.0000 Constraint 29 1256 0.8000 1.0000 2.0000 0.0000 Constraint 29 1244 0.8000 1.0000 2.0000 0.0000 Constraint 29 1235 0.8000 1.0000 2.0000 0.0000 Constraint 29 1225 0.8000 1.0000 2.0000 0.0000 Constraint 29 1213 0.8000 1.0000 2.0000 0.0000 Constraint 29 1208 0.8000 1.0000 2.0000 0.0000 Constraint 29 1201 0.8000 1.0000 2.0000 0.0000 Constraint 29 1192 0.8000 1.0000 2.0000 0.0000 Constraint 29 1186 0.8000 1.0000 2.0000 0.0000 Constraint 29 1174 0.8000 1.0000 2.0000 0.0000 Constraint 29 1168 0.8000 1.0000 2.0000 0.0000 Constraint 29 1159 0.8000 1.0000 2.0000 0.0000 Constraint 29 1150 0.8000 1.0000 2.0000 0.0000 Constraint 29 1144 0.8000 1.0000 2.0000 0.0000 Constraint 29 1133 0.8000 1.0000 2.0000 0.0000 Constraint 29 1124 0.8000 1.0000 2.0000 0.0000 Constraint 29 1106 0.8000 1.0000 2.0000 0.0000 Constraint 29 1095 0.8000 1.0000 2.0000 0.0000 Constraint 29 1087 0.8000 1.0000 2.0000 0.0000 Constraint 29 1075 0.8000 1.0000 2.0000 0.0000 Constraint 29 1066 0.8000 1.0000 2.0000 0.0000 Constraint 29 1039 0.8000 1.0000 2.0000 0.0000 Constraint 29 1031 0.8000 1.0000 2.0000 0.0000 Constraint 29 1024 0.8000 1.0000 2.0000 0.0000 Constraint 29 1015 0.8000 1.0000 2.0000 0.0000 Constraint 29 1007 0.8000 1.0000 2.0000 0.0000 Constraint 29 998 0.8000 1.0000 2.0000 0.0000 Constraint 29 990 0.8000 1.0000 2.0000 0.0000 Constraint 29 981 0.8000 1.0000 2.0000 0.0000 Constraint 29 973 0.8000 1.0000 2.0000 0.0000 Constraint 29 967 0.8000 1.0000 2.0000 0.0000 Constraint 29 958 0.8000 1.0000 2.0000 0.0000 Constraint 29 951 0.8000 1.0000 2.0000 0.0000 Constraint 29 944 0.8000 1.0000 2.0000 0.0000 Constraint 29 939 0.8000 1.0000 2.0000 0.0000 Constraint 29 931 0.8000 1.0000 2.0000 0.0000 Constraint 29 924 0.8000 1.0000 2.0000 0.0000 Constraint 29 915 0.8000 1.0000 2.0000 0.0000 Constraint 29 907 0.8000 1.0000 2.0000 0.0000 Constraint 29 900 0.8000 1.0000 2.0000 0.0000 Constraint 29 892 0.8000 1.0000 2.0000 0.0000 Constraint 29 884 0.8000 1.0000 2.0000 0.0000 Constraint 29 871 0.8000 1.0000 2.0000 0.0000 Constraint 29 864 0.8000 1.0000 2.0000 0.0000 Constraint 29 852 0.8000 1.0000 2.0000 0.0000 Constraint 29 833 0.8000 1.0000 2.0000 0.0000 Constraint 29 794 0.8000 1.0000 2.0000 0.0000 Constraint 29 789 0.8000 1.0000 2.0000 0.0000 Constraint 29 781 0.8000 1.0000 2.0000 0.0000 Constraint 29 773 0.8000 1.0000 2.0000 0.0000 Constraint 29 762 0.8000 1.0000 2.0000 0.0000 Constraint 29 756 0.8000 1.0000 2.0000 0.0000 Constraint 29 742 0.8000 1.0000 2.0000 0.0000 Constraint 29 728 0.8000 1.0000 2.0000 0.0000 Constraint 29 723 0.8000 1.0000 2.0000 0.0000 Constraint 29 716 0.8000 1.0000 2.0000 0.0000 Constraint 29 708 0.8000 1.0000 2.0000 0.0000 Constraint 29 700 0.8000 1.0000 2.0000 0.0000 Constraint 29 691 0.8000 1.0000 2.0000 0.0000 Constraint 29 683 0.8000 1.0000 2.0000 0.0000 Constraint 29 674 0.8000 1.0000 2.0000 0.0000 Constraint 29 669 0.8000 1.0000 2.0000 0.0000 Constraint 29 660 0.8000 1.0000 2.0000 0.0000 Constraint 29 649 0.8000 1.0000 2.0000 0.0000 Constraint 29 641 0.8000 1.0000 2.0000 0.0000 Constraint 29 632 0.8000 1.0000 2.0000 0.0000 Constraint 29 624 0.8000 1.0000 2.0000 0.0000 Constraint 29 618 0.8000 1.0000 2.0000 0.0000 Constraint 29 610 0.8000 1.0000 2.0000 0.0000 Constraint 29 602 0.8000 1.0000 2.0000 0.0000 Constraint 29 551 0.8000 1.0000 2.0000 0.0000 Constraint 29 532 0.8000 1.0000 2.0000 0.0000 Constraint 29 522 0.8000 1.0000 2.0000 0.0000 Constraint 29 515 0.8000 1.0000 2.0000 0.0000 Constraint 29 510 0.8000 1.0000 2.0000 0.0000 Constraint 29 499 0.8000 1.0000 2.0000 0.0000 Constraint 29 481 0.8000 1.0000 2.0000 0.0000 Constraint 29 472 0.8000 1.0000 2.0000 0.0000 Constraint 29 464 0.8000 1.0000 2.0000 0.0000 Constraint 29 455 0.8000 1.0000 2.0000 0.0000 Constraint 29 446 0.8000 1.0000 2.0000 0.0000 Constraint 29 439 0.8000 1.0000 2.0000 0.0000 Constraint 29 431 0.8000 1.0000 2.0000 0.0000 Constraint 29 422 0.8000 1.0000 2.0000 0.0000 Constraint 29 417 0.8000 1.0000 2.0000 0.0000 Constraint 29 408 0.8000 1.0000 2.0000 0.0000 Constraint 29 402 0.8000 1.0000 2.0000 0.0000 Constraint 29 394 0.8000 1.0000 2.0000 0.0000 Constraint 29 386 0.8000 1.0000 2.0000 0.0000 Constraint 29 380 0.8000 1.0000 2.0000 0.0000 Constraint 29 373 0.8000 1.0000 2.0000 0.0000 Constraint 29 362 0.8000 1.0000 2.0000 0.0000 Constraint 29 351 0.8000 1.0000 2.0000 0.0000 Constraint 29 343 0.8000 1.0000 2.0000 0.0000 Constraint 29 335 0.8000 1.0000 2.0000 0.0000 Constraint 29 325 0.8000 1.0000 2.0000 0.0000 Constraint 29 317 0.8000 1.0000 2.0000 0.0000 Constraint 29 309 0.8000 1.0000 2.0000 0.0000 Constraint 29 237 0.8000 1.0000 2.0000 0.0000 Constraint 29 229 0.8000 1.0000 2.0000 0.0000 Constraint 29 222 0.8000 1.0000 2.0000 0.0000 Constraint 29 214 0.8000 1.0000 2.0000 0.0000 Constraint 29 205 0.8000 1.0000 2.0000 0.0000 Constraint 29 196 0.8000 1.0000 2.0000 0.0000 Constraint 29 185 0.8000 1.0000 2.0000 0.0000 Constraint 29 177 0.8000 1.0000 2.0000 0.0000 Constraint 29 168 0.8000 1.0000 2.0000 0.0000 Constraint 29 155 0.8000 1.0000 2.0000 0.0000 Constraint 29 141 0.8000 1.0000 2.0000 0.0000 Constraint 29 132 0.8000 1.0000 2.0000 0.0000 Constraint 29 124 0.8000 1.0000 2.0000 0.0000 Constraint 29 115 0.8000 1.0000 2.0000 0.0000 Constraint 29 100 0.8000 1.0000 2.0000 0.0000 Constraint 29 92 0.8000 1.0000 2.0000 0.0000 Constraint 29 84 0.8000 1.0000 2.0000 0.0000 Constraint 29 69 0.8000 1.0000 2.0000 0.0000 Constraint 29 62 0.8000 1.0000 2.0000 0.0000 Constraint 29 54 0.8000 1.0000 2.0000 0.0000 Constraint 29 46 0.8000 1.0000 2.0000 0.0000 Constraint 29 41 0.8000 1.0000 2.0000 0.0000 Constraint 18 1467 0.8000 1.0000 2.0000 0.0000 Constraint 18 1451 0.8000 1.0000 2.0000 0.0000 Constraint 18 1442 0.8000 1.0000 2.0000 0.0000 Constraint 18 1430 0.8000 1.0000 2.0000 0.0000 Constraint 18 1421 0.8000 1.0000 2.0000 0.0000 Constraint 18 1413 0.8000 1.0000 2.0000 0.0000 Constraint 18 1402 0.8000 1.0000 2.0000 0.0000 Constraint 18 1395 0.8000 1.0000 2.0000 0.0000 Constraint 18 1386 0.8000 1.0000 2.0000 0.0000 Constraint 18 1381 0.8000 1.0000 2.0000 0.0000 Constraint 18 1373 0.8000 1.0000 2.0000 0.0000 Constraint 18 1362 0.8000 1.0000 2.0000 0.0000 Constraint 18 1354 0.8000 1.0000 2.0000 0.0000 Constraint 18 1347 0.8000 1.0000 2.0000 0.0000 Constraint 18 1339 0.8000 1.0000 2.0000 0.0000 Constraint 18 1329 0.8000 1.0000 2.0000 0.0000 Constraint 18 1318 0.8000 1.0000 2.0000 0.0000 Constraint 18 1306 0.8000 1.0000 2.0000 0.0000 Constraint 18 1295 0.8000 1.0000 2.0000 0.0000 Constraint 18 1288 0.8000 1.0000 2.0000 0.0000 Constraint 18 1281 0.8000 1.0000 2.0000 0.0000 Constraint 18 1272 0.8000 1.0000 2.0000 0.0000 Constraint 18 1264 0.8000 1.0000 2.0000 0.0000 Constraint 18 1244 0.8000 1.0000 2.0000 0.0000 Constraint 18 1235 0.8000 1.0000 2.0000 0.0000 Constraint 18 1225 0.8000 1.0000 2.0000 0.0000 Constraint 18 1213 0.8000 1.0000 2.0000 0.0000 Constraint 18 1208 0.8000 1.0000 2.0000 0.0000 Constraint 18 1201 0.8000 1.0000 2.0000 0.0000 Constraint 18 1192 0.8000 1.0000 2.0000 0.0000 Constraint 18 1186 0.8000 1.0000 2.0000 0.0000 Constraint 18 1174 0.8000 1.0000 2.0000 0.0000 Constraint 18 1168 0.8000 1.0000 2.0000 0.0000 Constraint 18 1159 0.8000 1.0000 2.0000 0.0000 Constraint 18 1150 0.8000 1.0000 2.0000 0.0000 Constraint 18 1144 0.8000 1.0000 2.0000 0.0000 Constraint 18 1133 0.8000 1.0000 2.0000 0.0000 Constraint 18 1124 0.8000 1.0000 2.0000 0.0000 Constraint 18 1106 0.8000 1.0000 2.0000 0.0000 Constraint 18 1095 0.8000 1.0000 2.0000 0.0000 Constraint 18 1087 0.8000 1.0000 2.0000 0.0000 Constraint 18 1075 0.8000 1.0000 2.0000 0.0000 Constraint 18 1066 0.8000 1.0000 2.0000 0.0000 Constraint 18 1039 0.8000 1.0000 2.0000 0.0000 Constraint 18 1031 0.8000 1.0000 2.0000 0.0000 Constraint 18 1024 0.8000 1.0000 2.0000 0.0000 Constraint 18 1015 0.8000 1.0000 2.0000 0.0000 Constraint 18 1007 0.8000 1.0000 2.0000 0.0000 Constraint 18 998 0.8000 1.0000 2.0000 0.0000 Constraint 18 990 0.8000 1.0000 2.0000 0.0000 Constraint 18 981 0.8000 1.0000 2.0000 0.0000 Constraint 18 973 0.8000 1.0000 2.0000 0.0000 Constraint 18 967 0.8000 1.0000 2.0000 0.0000 Constraint 18 958 0.8000 1.0000 2.0000 0.0000 Constraint 18 951 0.8000 1.0000 2.0000 0.0000 Constraint 18 944 0.8000 1.0000 2.0000 0.0000 Constraint 18 939 0.8000 1.0000 2.0000 0.0000 Constraint 18 931 0.8000 1.0000 2.0000 0.0000 Constraint 18 924 0.8000 1.0000 2.0000 0.0000 Constraint 18 915 0.8000 1.0000 2.0000 0.0000 Constraint 18 907 0.8000 1.0000 2.0000 0.0000 Constraint 18 900 0.8000 1.0000 2.0000 0.0000 Constraint 18 892 0.8000 1.0000 2.0000 0.0000 Constraint 18 884 0.8000 1.0000 2.0000 0.0000 Constraint 18 871 0.8000 1.0000 2.0000 0.0000 Constraint 18 864 0.8000 1.0000 2.0000 0.0000 Constraint 18 852 0.8000 1.0000 2.0000 0.0000 Constraint 18 841 0.8000 1.0000 2.0000 0.0000 Constraint 18 833 0.8000 1.0000 2.0000 0.0000 Constraint 18 822 0.8000 1.0000 2.0000 0.0000 Constraint 18 814 0.8000 1.0000 2.0000 0.0000 Constraint 18 805 0.8000 1.0000 2.0000 0.0000 Constraint 18 794 0.8000 1.0000 2.0000 0.0000 Constraint 18 789 0.8000 1.0000 2.0000 0.0000 Constraint 18 781 0.8000 1.0000 2.0000 0.0000 Constraint 18 773 0.8000 1.0000 2.0000 0.0000 Constraint 18 762 0.8000 1.0000 2.0000 0.0000 Constraint 18 756 0.8000 1.0000 2.0000 0.0000 Constraint 18 742 0.8000 1.0000 2.0000 0.0000 Constraint 18 728 0.8000 1.0000 2.0000 0.0000 Constraint 18 723 0.8000 1.0000 2.0000 0.0000 Constraint 18 716 0.8000 1.0000 2.0000 0.0000 Constraint 18 708 0.8000 1.0000 2.0000 0.0000 Constraint 18 700 0.8000 1.0000 2.0000 0.0000 Constraint 18 691 0.8000 1.0000 2.0000 0.0000 Constraint 18 683 0.8000 1.0000 2.0000 0.0000 Constraint 18 674 0.8000 1.0000 2.0000 0.0000 Constraint 18 669 0.8000 1.0000 2.0000 0.0000 Constraint 18 660 0.8000 1.0000 2.0000 0.0000 Constraint 18 649 0.8000 1.0000 2.0000 0.0000 Constraint 18 641 0.8000 1.0000 2.0000 0.0000 Constraint 18 632 0.8000 1.0000 2.0000 0.0000 Constraint 18 624 0.8000 1.0000 2.0000 0.0000 Constraint 18 618 0.8000 1.0000 2.0000 0.0000 Constraint 18 610 0.8000 1.0000 2.0000 0.0000 Constraint 18 602 0.8000 1.0000 2.0000 0.0000 Constraint 18 596 0.8000 1.0000 2.0000 0.0000 Constraint 18 585 0.8000 1.0000 2.0000 0.0000 Constraint 18 579 0.8000 1.0000 2.0000 0.0000 Constraint 18 551 0.8000 1.0000 2.0000 0.0000 Constraint 18 544 0.8000 1.0000 2.0000 0.0000 Constraint 18 532 0.8000 1.0000 2.0000 0.0000 Constraint 18 522 0.8000 1.0000 2.0000 0.0000 Constraint 18 515 0.8000 1.0000 2.0000 0.0000 Constraint 18 510 0.8000 1.0000 2.0000 0.0000 Constraint 18 499 0.8000 1.0000 2.0000 0.0000 Constraint 18 488 0.8000 1.0000 2.0000 0.0000 Constraint 18 481 0.8000 1.0000 2.0000 0.0000 Constraint 18 472 0.8000 1.0000 2.0000 0.0000 Constraint 18 464 0.8000 1.0000 2.0000 0.0000 Constraint 18 455 0.8000 1.0000 2.0000 0.0000 Constraint 18 446 0.8000 1.0000 2.0000 0.0000 Constraint 18 439 0.8000 1.0000 2.0000 0.0000 Constraint 18 431 0.8000 1.0000 2.0000 0.0000 Constraint 18 422 0.8000 1.0000 2.0000 0.0000 Constraint 18 417 0.8000 1.0000 2.0000 0.0000 Constraint 18 408 0.8000 1.0000 2.0000 0.0000 Constraint 18 402 0.8000 1.0000 2.0000 0.0000 Constraint 18 394 0.8000 1.0000 2.0000 0.0000 Constraint 18 386 0.8000 1.0000 2.0000 0.0000 Constraint 18 380 0.8000 1.0000 2.0000 0.0000 Constraint 18 373 0.8000 1.0000 2.0000 0.0000 Constraint 18 362 0.8000 1.0000 2.0000 0.0000 Constraint 18 351 0.8000 1.0000 2.0000 0.0000 Constraint 18 343 0.8000 1.0000 2.0000 0.0000 Constraint 18 335 0.8000 1.0000 2.0000 0.0000 Constraint 18 325 0.8000 1.0000 2.0000 0.0000 Constraint 18 317 0.8000 1.0000 2.0000 0.0000 Constraint 18 309 0.8000 1.0000 2.0000 0.0000 Constraint 18 297 0.8000 1.0000 2.0000 0.0000 Constraint 18 266 0.8000 1.0000 2.0000 0.0000 Constraint 18 249 0.8000 1.0000 2.0000 0.0000 Constraint 18 237 0.8000 1.0000 2.0000 0.0000 Constraint 18 229 0.8000 1.0000 2.0000 0.0000 Constraint 18 222 0.8000 1.0000 2.0000 0.0000 Constraint 18 214 0.8000 1.0000 2.0000 0.0000 Constraint 18 205 0.8000 1.0000 2.0000 0.0000 Constraint 18 196 0.8000 1.0000 2.0000 0.0000 Constraint 18 185 0.8000 1.0000 2.0000 0.0000 Constraint 18 177 0.8000 1.0000 2.0000 0.0000 Constraint 18 168 0.8000 1.0000 2.0000 0.0000 Constraint 18 163 0.8000 1.0000 2.0000 0.0000 Constraint 18 155 0.8000 1.0000 2.0000 0.0000 Constraint 18 148 0.8000 1.0000 2.0000 0.0000 Constraint 18 141 0.8000 1.0000 2.0000 0.0000 Constraint 18 132 0.8000 1.0000 2.0000 0.0000 Constraint 18 124 0.8000 1.0000 2.0000 0.0000 Constraint 18 115 0.8000 1.0000 2.0000 0.0000 Constraint 18 100 0.8000 1.0000 2.0000 0.0000 Constraint 18 92 0.8000 1.0000 2.0000 0.0000 Constraint 18 84 0.8000 1.0000 2.0000 0.0000 Constraint 18 69 0.8000 1.0000 2.0000 0.0000 Constraint 18 62 0.8000 1.0000 2.0000 0.0000 Constraint 18 54 0.8000 1.0000 2.0000 0.0000 Constraint 18 46 0.8000 1.0000 2.0000 0.0000 Constraint 18 41 0.8000 1.0000 2.0000 0.0000 Constraint 18 29 0.8000 1.0000 2.0000 0.0000 Constraint 11 1476 0.8000 1.0000 2.0000 0.0000 Constraint 11 1467 0.8000 1.0000 2.0000 0.0000 Constraint 11 1459 0.8000 1.0000 2.0000 0.0000 Constraint 11 1451 0.8000 1.0000 2.0000 0.0000 Constraint 11 1442 0.8000 1.0000 2.0000 0.0000 Constraint 11 1430 0.8000 1.0000 2.0000 0.0000 Constraint 11 1421 0.8000 1.0000 2.0000 0.0000 Constraint 11 1413 0.8000 1.0000 2.0000 0.0000 Constraint 11 1402 0.8000 1.0000 2.0000 0.0000 Constraint 11 1395 0.8000 1.0000 2.0000 0.0000 Constraint 11 1386 0.8000 1.0000 2.0000 0.0000 Constraint 11 1381 0.8000 1.0000 2.0000 0.0000 Constraint 11 1373 0.8000 1.0000 2.0000 0.0000 Constraint 11 1362 0.8000 1.0000 2.0000 0.0000 Constraint 11 1354 0.8000 1.0000 2.0000 0.0000 Constraint 11 1347 0.8000 1.0000 2.0000 0.0000 Constraint 11 1339 0.8000 1.0000 2.0000 0.0000 Constraint 11 1329 0.8000 1.0000 2.0000 0.0000 Constraint 11 1318 0.8000 1.0000 2.0000 0.0000 Constraint 11 1306 0.8000 1.0000 2.0000 0.0000 Constraint 11 1295 0.8000 1.0000 2.0000 0.0000 Constraint 11 1288 0.8000 1.0000 2.0000 0.0000 Constraint 11 1281 0.8000 1.0000 2.0000 0.0000 Constraint 11 1272 0.8000 1.0000 2.0000 0.0000 Constraint 11 1264 0.8000 1.0000 2.0000 0.0000 Constraint 11 1256 0.8000 1.0000 2.0000 0.0000 Constraint 11 1244 0.8000 1.0000 2.0000 0.0000 Constraint 11 1235 0.8000 1.0000 2.0000 0.0000 Constraint 11 1225 0.8000 1.0000 2.0000 0.0000 Constraint 11 1213 0.8000 1.0000 2.0000 0.0000 Constraint 11 1208 0.8000 1.0000 2.0000 0.0000 Constraint 11 1201 0.8000 1.0000 2.0000 0.0000 Constraint 11 1192 0.8000 1.0000 2.0000 0.0000 Constraint 11 1186 0.8000 1.0000 2.0000 0.0000 Constraint 11 1174 0.8000 1.0000 2.0000 0.0000 Constraint 11 1168 0.8000 1.0000 2.0000 0.0000 Constraint 11 1159 0.8000 1.0000 2.0000 0.0000 Constraint 11 1150 0.8000 1.0000 2.0000 0.0000 Constraint 11 1144 0.8000 1.0000 2.0000 0.0000 Constraint 11 1133 0.8000 1.0000 2.0000 0.0000 Constraint 11 1124 0.8000 1.0000 2.0000 0.0000 Constraint 11 1106 0.8000 1.0000 2.0000 0.0000 Constraint 11 1095 0.8000 1.0000 2.0000 0.0000 Constraint 11 1087 0.8000 1.0000 2.0000 0.0000 Constraint 11 1075 0.8000 1.0000 2.0000 0.0000 Constraint 11 1066 0.8000 1.0000 2.0000 0.0000 Constraint 11 1051 0.8000 1.0000 2.0000 0.0000 Constraint 11 1039 0.8000 1.0000 2.0000 0.0000 Constraint 11 1031 0.8000 1.0000 2.0000 0.0000 Constraint 11 1024 0.8000 1.0000 2.0000 0.0000 Constraint 11 1015 0.8000 1.0000 2.0000 0.0000 Constraint 11 1007 0.8000 1.0000 2.0000 0.0000 Constraint 11 998 0.8000 1.0000 2.0000 0.0000 Constraint 11 990 0.8000 1.0000 2.0000 0.0000 Constraint 11 981 0.8000 1.0000 2.0000 0.0000 Constraint 11 973 0.8000 1.0000 2.0000 0.0000 Constraint 11 967 0.8000 1.0000 2.0000 0.0000 Constraint 11 958 0.8000 1.0000 2.0000 0.0000 Constraint 11 951 0.8000 1.0000 2.0000 0.0000 Constraint 11 944 0.8000 1.0000 2.0000 0.0000 Constraint 11 939 0.8000 1.0000 2.0000 0.0000 Constraint 11 931 0.8000 1.0000 2.0000 0.0000 Constraint 11 924 0.8000 1.0000 2.0000 0.0000 Constraint 11 915 0.8000 1.0000 2.0000 0.0000 Constraint 11 907 0.8000 1.0000 2.0000 0.0000 Constraint 11 900 0.8000 1.0000 2.0000 0.0000 Constraint 11 892 0.8000 1.0000 2.0000 0.0000 Constraint 11 884 0.8000 1.0000 2.0000 0.0000 Constraint 11 871 0.8000 1.0000 2.0000 0.0000 Constraint 11 864 0.8000 1.0000 2.0000 0.0000 Constraint 11 852 0.8000 1.0000 2.0000 0.0000 Constraint 11 841 0.8000 1.0000 2.0000 0.0000 Constraint 11 833 0.8000 1.0000 2.0000 0.0000 Constraint 11 822 0.8000 1.0000 2.0000 0.0000 Constraint 11 814 0.8000 1.0000 2.0000 0.0000 Constraint 11 805 0.8000 1.0000 2.0000 0.0000 Constraint 11 794 0.8000 1.0000 2.0000 0.0000 Constraint 11 789 0.8000 1.0000 2.0000 0.0000 Constraint 11 781 0.8000 1.0000 2.0000 0.0000 Constraint 11 773 0.8000 1.0000 2.0000 0.0000 Constraint 11 762 0.8000 1.0000 2.0000 0.0000 Constraint 11 756 0.8000 1.0000 2.0000 0.0000 Constraint 11 742 0.8000 1.0000 2.0000 0.0000 Constraint 11 728 0.8000 1.0000 2.0000 0.0000 Constraint 11 723 0.8000 1.0000 2.0000 0.0000 Constraint 11 716 0.8000 1.0000 2.0000 0.0000 Constraint 11 708 0.8000 1.0000 2.0000 0.0000 Constraint 11 700 0.8000 1.0000 2.0000 0.0000 Constraint 11 691 0.8000 1.0000 2.0000 0.0000 Constraint 11 683 0.8000 1.0000 2.0000 0.0000 Constraint 11 674 0.8000 1.0000 2.0000 0.0000 Constraint 11 669 0.8000 1.0000 2.0000 0.0000 Constraint 11 660 0.8000 1.0000 2.0000 0.0000 Constraint 11 649 0.8000 1.0000 2.0000 0.0000 Constraint 11 641 0.8000 1.0000 2.0000 0.0000 Constraint 11 632 0.8000 1.0000 2.0000 0.0000 Constraint 11 624 0.8000 1.0000 2.0000 0.0000 Constraint 11 618 0.8000 1.0000 2.0000 0.0000 Constraint 11 610 0.8000 1.0000 2.0000 0.0000 Constraint 11 602 0.8000 1.0000 2.0000 0.0000 Constraint 11 596 0.8000 1.0000 2.0000 0.0000 Constraint 11 585 0.8000 1.0000 2.0000 0.0000 Constraint 11 579 0.8000 1.0000 2.0000 0.0000 Constraint 11 544 0.8000 1.0000 2.0000 0.0000 Constraint 11 532 0.8000 1.0000 2.0000 0.0000 Constraint 11 522 0.8000 1.0000 2.0000 0.0000 Constraint 11 515 0.8000 1.0000 2.0000 0.0000 Constraint 11 510 0.8000 1.0000 2.0000 0.0000 Constraint 11 499 0.8000 1.0000 2.0000 0.0000 Constraint 11 488 0.8000 1.0000 2.0000 0.0000 Constraint 11 481 0.8000 1.0000 2.0000 0.0000 Constraint 11 472 0.8000 1.0000 2.0000 0.0000 Constraint 11 464 0.8000 1.0000 2.0000 0.0000 Constraint 11 455 0.8000 1.0000 2.0000 0.0000 Constraint 11 446 0.8000 1.0000 2.0000 0.0000 Constraint 11 439 0.8000 1.0000 2.0000 0.0000 Constraint 11 431 0.8000 1.0000 2.0000 0.0000 Constraint 11 422 0.8000 1.0000 2.0000 0.0000 Constraint 11 417 0.8000 1.0000 2.0000 0.0000 Constraint 11 408 0.8000 1.0000 2.0000 0.0000 Constraint 11 402 0.8000 1.0000 2.0000 0.0000 Constraint 11 394 0.8000 1.0000 2.0000 0.0000 Constraint 11 386 0.8000 1.0000 2.0000 0.0000 Constraint 11 380 0.8000 1.0000 2.0000 0.0000 Constraint 11 373 0.8000 1.0000 2.0000 0.0000 Constraint 11 362 0.8000 1.0000 2.0000 0.0000 Constraint 11 351 0.8000 1.0000 2.0000 0.0000 Constraint 11 343 0.8000 1.0000 2.0000 0.0000 Constraint 11 335 0.8000 1.0000 2.0000 0.0000 Constraint 11 325 0.8000 1.0000 2.0000 0.0000 Constraint 11 317 0.8000 1.0000 2.0000 0.0000 Constraint 11 309 0.8000 1.0000 2.0000 0.0000 Constraint 11 297 0.8000 1.0000 2.0000 0.0000 Constraint 11 291 0.8000 1.0000 2.0000 0.0000 Constraint 11 282 0.8000 1.0000 2.0000 0.0000 Constraint 11 275 0.8000 1.0000 2.0000 0.0000 Constraint 11 266 0.8000 1.0000 2.0000 0.0000 Constraint 11 257 0.8000 1.0000 2.0000 0.0000 Constraint 11 249 0.8000 1.0000 2.0000 0.0000 Constraint 11 237 0.8000 1.0000 2.0000 0.0000 Constraint 11 229 0.8000 1.0000 2.0000 0.0000 Constraint 11 222 0.8000 1.0000 2.0000 0.0000 Constraint 11 214 0.8000 1.0000 2.0000 0.0000 Constraint 11 205 0.8000 1.0000 2.0000 0.0000 Constraint 11 196 0.8000 1.0000 2.0000 0.0000 Constraint 11 185 0.8000 1.0000 2.0000 0.0000 Constraint 11 177 0.8000 1.0000 2.0000 0.0000 Constraint 11 168 0.8000 1.0000 2.0000 0.0000 Constraint 11 155 0.8000 1.0000 2.0000 0.0000 Constraint 11 148 0.8000 1.0000 2.0000 0.0000 Constraint 11 141 0.8000 1.0000 2.0000 0.0000 Constraint 11 132 0.8000 1.0000 2.0000 0.0000 Constraint 11 124 0.8000 1.0000 2.0000 0.0000 Constraint 11 115 0.8000 1.0000 2.0000 0.0000 Constraint 11 100 0.8000 1.0000 2.0000 0.0000 Constraint 11 92 0.8000 1.0000 2.0000 0.0000 Constraint 11 84 0.8000 1.0000 2.0000 0.0000 Constraint 11 69 0.8000 1.0000 2.0000 0.0000 Constraint 11 62 0.8000 1.0000 2.0000 0.0000 Constraint 11 54 0.8000 1.0000 2.0000 0.0000 Constraint 11 46 0.8000 1.0000 2.0000 0.0000 Constraint 11 41 0.8000 1.0000 2.0000 0.0000 Constraint 11 29 0.8000 1.0000 2.0000 0.0000 Constraint 11 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 1476 0.8000 1.0000 2.0000 0.0000 Constraint 3 1467 0.8000 1.0000 2.0000 0.0000 Constraint 3 1459 0.8000 1.0000 2.0000 0.0000 Constraint 3 1451 0.8000 1.0000 2.0000 0.0000 Constraint 3 1442 0.8000 1.0000 2.0000 0.0000 Constraint 3 1430 0.8000 1.0000 2.0000 0.0000 Constraint 3 1421 0.8000 1.0000 2.0000 0.0000 Constraint 3 1413 0.8000 1.0000 2.0000 0.0000 Constraint 3 1402 0.8000 1.0000 2.0000 0.0000 Constraint 3 1395 0.8000 1.0000 2.0000 0.0000 Constraint 3 1386 0.8000 1.0000 2.0000 0.0000 Constraint 3 1381 0.8000 1.0000 2.0000 0.0000 Constraint 3 1373 0.8000 1.0000 2.0000 0.0000 Constraint 3 1362 0.8000 1.0000 2.0000 0.0000 Constraint 3 1354 0.8000 1.0000 2.0000 0.0000 Constraint 3 1347 0.8000 1.0000 2.0000 0.0000 Constraint 3 1339 0.8000 1.0000 2.0000 0.0000 Constraint 3 1329 0.8000 1.0000 2.0000 0.0000 Constraint 3 1318 0.8000 1.0000 2.0000 0.0000 Constraint 3 1306 0.8000 1.0000 2.0000 0.0000 Constraint 3 1295 0.8000 1.0000 2.0000 0.0000 Constraint 3 1288 0.8000 1.0000 2.0000 0.0000 Constraint 3 1281 0.8000 1.0000 2.0000 0.0000 Constraint 3 1272 0.8000 1.0000 2.0000 0.0000 Constraint 3 1264 0.8000 1.0000 2.0000 0.0000 Constraint 3 1256 0.8000 1.0000 2.0000 0.0000 Constraint 3 1244 0.8000 1.0000 2.0000 0.0000 Constraint 3 1235 0.8000 1.0000 2.0000 0.0000 Constraint 3 1225 0.8000 1.0000 2.0000 0.0000 Constraint 3 1213 0.8000 1.0000 2.0000 0.0000 Constraint 3 1208 0.8000 1.0000 2.0000 0.0000 Constraint 3 1201 0.8000 1.0000 2.0000 0.0000 Constraint 3 1192 0.8000 1.0000 2.0000 0.0000 Constraint 3 1186 0.8000 1.0000 2.0000 0.0000 Constraint 3 1174 0.8000 1.0000 2.0000 0.0000 Constraint 3 1168 0.8000 1.0000 2.0000 0.0000 Constraint 3 1159 0.8000 1.0000 2.0000 0.0000 Constraint 3 1150 0.8000 1.0000 2.0000 0.0000 Constraint 3 1144 0.8000 1.0000 2.0000 0.0000 Constraint 3 1133 0.8000 1.0000 2.0000 0.0000 Constraint 3 1124 0.8000 1.0000 2.0000 0.0000 Constraint 3 1106 0.8000 1.0000 2.0000 0.0000 Constraint 3 1095 0.8000 1.0000 2.0000 0.0000 Constraint 3 1087 0.8000 1.0000 2.0000 0.0000 Constraint 3 1075 0.8000 1.0000 2.0000 0.0000 Constraint 3 1066 0.8000 1.0000 2.0000 0.0000 Constraint 3 1051 0.8000 1.0000 2.0000 0.0000 Constraint 3 1039 0.8000 1.0000 2.0000 0.0000 Constraint 3 1031 0.8000 1.0000 2.0000 0.0000 Constraint 3 1024 0.8000 1.0000 2.0000 0.0000 Constraint 3 1015 0.8000 1.0000 2.0000 0.0000 Constraint 3 1007 0.8000 1.0000 2.0000 0.0000 Constraint 3 998 0.8000 1.0000 2.0000 0.0000 Constraint 3 990 0.8000 1.0000 2.0000 0.0000 Constraint 3 981 0.8000 1.0000 2.0000 0.0000 Constraint 3 973 0.8000 1.0000 2.0000 0.0000 Constraint 3 967 0.8000 1.0000 2.0000 0.0000 Constraint 3 958 0.8000 1.0000 2.0000 0.0000 Constraint 3 951 0.8000 1.0000 2.0000 0.0000 Constraint 3 944 0.8000 1.0000 2.0000 0.0000 Constraint 3 939 0.8000 1.0000 2.0000 0.0000 Constraint 3 931 0.8000 1.0000 2.0000 0.0000 Constraint 3 924 0.8000 1.0000 2.0000 0.0000 Constraint 3 915 0.8000 1.0000 2.0000 0.0000 Constraint 3 907 0.8000 1.0000 2.0000 0.0000 Constraint 3 900 0.8000 1.0000 2.0000 0.0000 Constraint 3 892 0.8000 1.0000 2.0000 0.0000 Constraint 3 884 0.8000 1.0000 2.0000 0.0000 Constraint 3 871 0.8000 1.0000 2.0000 0.0000 Constraint 3 864 0.8000 1.0000 2.0000 0.0000 Constraint 3 852 0.8000 1.0000 2.0000 0.0000 Constraint 3 841 0.8000 1.0000 2.0000 0.0000 Constraint 3 833 0.8000 1.0000 2.0000 0.0000 Constraint 3 822 0.8000 1.0000 2.0000 0.0000 Constraint 3 814 0.8000 1.0000 2.0000 0.0000 Constraint 3 805 0.8000 1.0000 2.0000 0.0000 Constraint 3 794 0.8000 1.0000 2.0000 0.0000 Constraint 3 789 0.8000 1.0000 2.0000 0.0000 Constraint 3 781 0.8000 1.0000 2.0000 0.0000 Constraint 3 773 0.8000 1.0000 2.0000 0.0000 Constraint 3 762 0.8000 1.0000 2.0000 0.0000 Constraint 3 756 0.8000 1.0000 2.0000 0.0000 Constraint 3 742 0.8000 1.0000 2.0000 0.0000 Constraint 3 728 0.8000 1.0000 2.0000 0.0000 Constraint 3 723 0.8000 1.0000 2.0000 0.0000 Constraint 3 716 0.8000 1.0000 2.0000 0.0000 Constraint 3 708 0.8000 1.0000 2.0000 0.0000 Constraint 3 700 0.8000 1.0000 2.0000 0.0000 Constraint 3 691 0.8000 1.0000 2.0000 0.0000 Constraint 3 683 0.8000 1.0000 2.0000 0.0000 Constraint 3 674 0.8000 1.0000 2.0000 0.0000 Constraint 3 669 0.8000 1.0000 2.0000 0.0000 Constraint 3 660 0.8000 1.0000 2.0000 0.0000 Constraint 3 649 0.8000 1.0000 2.0000 0.0000 Constraint 3 641 0.8000 1.0000 2.0000 0.0000 Constraint 3 632 0.8000 1.0000 2.0000 0.0000 Constraint 3 624 0.8000 1.0000 2.0000 0.0000 Constraint 3 618 0.8000 1.0000 2.0000 0.0000 Constraint 3 610 0.8000 1.0000 2.0000 0.0000 Constraint 3 602 0.8000 1.0000 2.0000 0.0000 Constraint 3 596 0.8000 1.0000 2.0000 0.0000 Constraint 3 585 0.8000 1.0000 2.0000 0.0000 Constraint 3 579 0.8000 1.0000 2.0000 0.0000 Constraint 3 570 0.8000 1.0000 2.0000 0.0000 Constraint 3 562 0.8000 1.0000 2.0000 0.0000 Constraint 3 551 0.8000 1.0000 2.0000 0.0000 Constraint 3 544 0.8000 1.0000 2.0000 0.0000 Constraint 3 532 0.8000 1.0000 2.0000 0.0000 Constraint 3 522 0.8000 1.0000 2.0000 0.0000 Constraint 3 515 0.8000 1.0000 2.0000 0.0000 Constraint 3 510 0.8000 1.0000 2.0000 0.0000 Constraint 3 499 0.8000 1.0000 2.0000 0.0000 Constraint 3 488 0.8000 1.0000 2.0000 0.0000 Constraint 3 481 0.8000 1.0000 2.0000 0.0000 Constraint 3 472 0.8000 1.0000 2.0000 0.0000 Constraint 3 464 0.8000 1.0000 2.0000 0.0000 Constraint 3 455 0.8000 1.0000 2.0000 0.0000 Constraint 3 446 0.8000 1.0000 2.0000 0.0000 Constraint 3 439 0.8000 1.0000 2.0000 0.0000 Constraint 3 431 0.8000 1.0000 2.0000 0.0000 Constraint 3 422 0.8000 1.0000 2.0000 0.0000 Constraint 3 417 0.8000 1.0000 2.0000 0.0000 Constraint 3 408 0.8000 1.0000 2.0000 0.0000 Constraint 3 402 0.8000 1.0000 2.0000 0.0000 Constraint 3 394 0.8000 1.0000 2.0000 0.0000 Constraint 3 386 0.8000 1.0000 2.0000 0.0000 Constraint 3 380 0.8000 1.0000 2.0000 0.0000 Constraint 3 373 0.8000 1.0000 2.0000 0.0000 Constraint 3 362 0.8000 1.0000 2.0000 0.0000 Constraint 3 351 0.8000 1.0000 2.0000 0.0000 Constraint 3 343 0.8000 1.0000 2.0000 0.0000 Constraint 3 335 0.8000 1.0000 2.0000 0.0000 Constraint 3 325 0.8000 1.0000 2.0000 0.0000 Constraint 3 317 0.8000 1.0000 2.0000 0.0000 Constraint 3 309 0.8000 1.0000 2.0000 0.0000 Constraint 3 297 0.8000 1.0000 2.0000 0.0000 Constraint 3 291 0.8000 1.0000 2.0000 0.0000 Constraint 3 282 0.8000 1.0000 2.0000 0.0000 Constraint 3 275 0.8000 1.0000 2.0000 0.0000 Constraint 3 266 0.8000 1.0000 2.0000 0.0000 Constraint 3 257 0.8000 1.0000 2.0000 0.0000 Constraint 3 249 0.8000 1.0000 2.0000 0.0000 Constraint 3 237 0.8000 1.0000 2.0000 0.0000 Constraint 3 229 0.8000 1.0000 2.0000 0.0000 Constraint 3 222 0.8000 1.0000 2.0000 0.0000 Constraint 3 214 0.8000 1.0000 2.0000 0.0000 Constraint 3 205 0.8000 1.0000 2.0000 0.0000 Constraint 3 196 0.8000 1.0000 2.0000 0.0000 Constraint 3 185 0.8000 1.0000 2.0000 0.0000 Constraint 3 177 0.8000 1.0000 2.0000 0.0000 Constraint 3 168 0.8000 1.0000 2.0000 0.0000 Constraint 3 163 0.8000 1.0000 2.0000 0.0000 Constraint 3 155 0.8000 1.0000 2.0000 0.0000 Constraint 3 148 0.8000 1.0000 2.0000 0.0000 Constraint 3 141 0.8000 1.0000 2.0000 0.0000 Constraint 3 132 0.8000 1.0000 2.0000 0.0000 Constraint 3 124 0.8000 1.0000 2.0000 0.0000 Constraint 3 115 0.8000 1.0000 2.0000 0.0000 Constraint 3 100 0.8000 1.0000 2.0000 0.0000 Constraint 3 92 0.8000 1.0000 2.0000 0.0000 Constraint 3 84 0.8000 1.0000 2.0000 0.0000 Constraint 3 69 0.8000 1.0000 2.0000 0.0000 Constraint 3 62 0.8000 1.0000 2.0000 0.0000 Constraint 3 54 0.8000 1.0000 2.0000 0.0000 Constraint 3 46 0.8000 1.0000 2.0000 0.0000 Constraint 3 41 0.8000 1.0000 2.0000 0.0000 Constraint 3 29 0.8000 1.0000 2.0000 0.0000 Constraint 3 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: