# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 24.0000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint 406 518 6.0814 7.6017 11.4026 100.2126 Constraint 406 509 9.9323 12.4154 18.6231 100.2126 Constraint 406 504 11.1142 13.8928 20.8391 100.2126 Constraint 406 497 9.2300 11.5375 17.3063 100.2126 Constraint 406 488 10.5969 13.2461 19.8692 100.2126 Constraint 406 481 13.7112 17.1390 25.7085 100.2126 Constraint 399 518 4.3013 5.3766 8.0649 100.2126 Constraint 399 509 8.2542 10.3178 15.4767 100.2126 Constraint 399 504 8.3216 10.4019 15.6029 100.2126 Constraint 399 497 5.7540 7.1925 10.7888 100.2126 Constraint 399 488 8.0766 10.0958 15.1437 100.2126 Constraint 399 481 10.9297 13.6621 20.4932 100.2126 Constraint 388 518 10.1157 12.6446 18.9669 100.2126 Constraint 388 509 13.5080 16.8850 25.3275 100.2126 Constraint 388 504 12.6089 15.7611 23.6417 100.2126 Constraint 388 497 8.6752 10.8440 16.2660 100.2126 Constraint 388 488 11.0739 13.8424 20.7636 100.2126 Constraint 388 481 13.9919 17.4898 26.2347 100.2126 Constraint 380 518 8.0595 10.0744 15.1116 100.2126 Constraint 380 509 10.9065 13.6331 20.4497 100.2126 Constraint 380 504 8.9446 11.1807 16.7711 100.2126 Constraint 380 497 5.7675 7.2094 10.8141 100.2126 Constraint 380 488 9.4782 11.8478 17.7717 100.2126 Constraint 380 481 11.3156 14.1445 21.2167 100.2126 Constraint 354 518 16.2236 20.2795 30.4192 100.2126 Constraint 354 509 17.6980 22.1225 33.1838 100.2126 Constraint 354 504 13.9897 17.4872 26.2307 100.2126 Constraint 354 497 13.1079 16.3848 24.5773 100.2126 Constraint 349 518 16.3764 20.4706 30.7058 100.2126 Constraint 349 504 15.5715 19.4643 29.1965 100.2126 Constraint 349 497 14.0255 17.5319 26.2978 100.2126 Constraint 349 406 15.9789 19.9736 29.9604 100.2126 Constraint 305 504 11.9673 14.9591 22.4386 100.2126 Constraint 305 406 12.1916 15.2395 22.8593 100.2126 Constraint 305 399 10.4056 13.0070 19.5105 100.2126 Constraint 305 380 9.0079 11.2599 16.8898 100.2126 Constraint 275 504 16.6262 20.7828 31.1742 100.2126 Constraint 275 399 17.6620 22.0775 33.1163 100.2126 Constraint 275 380 15.6325 19.5406 29.3109 100.2126 Constraint 275 354 9.7880 12.2350 18.3525 100.2126 Constraint 275 349 10.4933 13.1166 19.6749 100.2126 Constraint 264 518 15.2805 19.1006 28.6509 100.2126 Constraint 264 509 15.8629 19.8286 29.7429 100.2126 Constraint 264 504 12.5056 15.6321 23.4481 100.2126 Constraint 264 497 13.8970 17.3713 26.0570 100.2126 Constraint 264 481 16.5129 20.6411 30.9616 100.2126 Constraint 264 399 14.3217 17.9021 26.8532 100.2126 Constraint 264 388 17.1074 21.3843 32.0764 100.2126 Constraint 264 380 12.6851 15.8564 23.7846 100.2126 Constraint 264 354 8.8904 11.1129 16.6694 100.2126 Constraint 264 349 10.1600 12.6999 19.0499 100.2126 Constraint 257 518 14.8707 18.5884 27.8826 100.2126 Constraint 257 509 16.3292 20.4115 30.6172 100.2126 Constraint 257 504 12.8742 16.0928 24.1392 100.2126 Constraint 257 497 12.8658 16.0822 24.1234 100.2126 Constraint 257 488 16.9681 21.2101 31.8152 100.2126 Constraint 257 481 16.6045 20.7557 31.1335 100.2126 Constraint 257 406 15.4111 19.2638 28.8958 100.2126 Constraint 257 399 12.9139 16.1423 24.2135 100.2126 Constraint 257 388 13.9773 17.4716 26.2074 100.2126 Constraint 257 380 9.9863 12.4828 18.7243 100.2126 Constraint 257 354 4.9925 6.2407 9.3610 100.2126 Constraint 257 349 5.6378 7.0472 10.5708 100.2126 Constraint 233 518 11.7706 14.7132 22.0698 100.2126 Constraint 233 509 13.5514 16.9393 25.4089 100.2126 Constraint 233 504 10.1964 12.7455 19.1182 100.2126 Constraint 233 497 8.8586 11.0732 16.6098 100.2126 Constraint 233 488 12.9767 16.2209 24.3313 100.2126 Constraint 233 481 13.1719 16.4648 24.6972 100.2126 Constraint 233 406 13.0259 16.2823 24.4235 100.2126 Constraint 233 399 9.7028 12.1286 18.1928 100.2126 Constraint 233 388 9.3808 11.7260 17.5890 100.2126 Constraint 233 380 5.3844 6.7306 10.0958 100.2126 Constraint 233 354 4.5628 5.7035 8.5553 100.2126 Constraint 233 349 5.6091 7.0114 10.5171 100.2126 Constraint 233 305 6.4949 8.1187 12.1780 100.2126 Constraint 221 518 12.3865 15.4831 23.2246 100.2126 Constraint 221 509 13.7691 17.2113 25.8170 100.2126 Constraint 221 504 10.5177 13.1471 19.7206 100.2126 Constraint 221 497 8.4234 10.5293 15.7939 100.2126 Constraint 221 488 11.8865 14.8581 22.2871 100.2126 Constraint 221 481 12.0057 15.0071 22.5107 100.2126 Constraint 221 406 14.6716 18.3396 27.5093 100.2126 Constraint 221 399 10.8892 13.6115 20.4173 100.2126 Constraint 221 388 8.6777 10.8471 16.2707 100.2126 Constraint 221 380 5.8807 7.3509 11.0264 100.2126 Constraint 221 354 6.6525 8.3157 12.4735 100.2126 Constraint 221 349 8.4953 10.6191 15.9286 100.2126 Constraint 221 305 10.8866 13.6082 20.4123 100.2126 Constraint 518 588 9.4861 11.8577 17.7865 99.5125 Constraint 509 588 13.4061 16.7576 25.1364 99.5125 Constraint 509 581 10.6074 13.2593 19.8889 99.5125 Constraint 504 588 13.5211 16.9014 25.3521 99.5125 Constraint 504 581 10.3319 12.9149 19.3723 99.5125 Constraint 497 588 11.4459 14.3074 21.4611 99.5125 Constraint 497 581 9.5825 11.9781 17.9672 99.5125 Constraint 488 588 13.8879 17.3599 26.0399 99.5125 Constraint 488 581 12.2675 15.3344 23.0016 99.5125 Constraint 481 588 16.6960 20.8700 31.3049 99.5125 Constraint 481 581 14.1448 17.6810 26.5215 99.5125 Constraint 406 588 4.4739 5.5924 8.3886 99.5125 Constraint 406 581 4.9974 6.2467 9.3701 99.5125 Constraint 406 526 7.3366 9.1707 13.7561 99.5125 Constraint 399 588 6.0103 7.5129 11.2693 99.5125 Constraint 399 581 5.3814 6.7268 10.0902 99.5125 Constraint 399 526 5.1435 6.4293 9.6440 99.5125 Constraint 388 588 9.3231 11.6539 17.4809 99.5125 Constraint 388 581 11.0440 13.8050 20.7075 99.5125 Constraint 388 526 10.9205 13.6507 20.4760 99.5125 Constraint 380 588 8.9557 11.1946 16.7919 99.5125 Constraint 380 581 8.5963 10.7453 16.1180 99.5125 Constraint 380 526 7.2871 9.1088 13.6632 99.5125 Constraint 354 581 14.5000 18.1250 27.1875 99.5125 Constraint 354 526 13.3569 16.6961 25.0442 99.5125 Constraint 349 588 13.6073 17.0091 25.5136 99.5125 Constraint 349 581 13.2437 16.5546 24.8320 99.5125 Constraint 349 526 13.7377 17.1722 25.7582 99.5125 Constraint 305 588 10.4081 13.0102 19.5153 99.5125 Constraint 305 581 7.9965 9.9956 14.9935 99.5125 Constraint 305 526 9.0608 11.3260 16.9891 99.5125 Constraint 275 581 15.0433 18.8042 28.2062 99.5125 Constraint 275 526 15.0858 18.8572 28.2858 99.5125 Constraint 264 588 15.4345 19.2932 28.9398 99.5125 Constraint 264 581 12.0876 15.1095 22.6642 99.5125 Constraint 264 526 11.2079 14.0098 21.0148 99.5125 Constraint 257 588 13.8110 17.2637 25.8956 99.5125 Constraint 257 581 11.5941 14.4926 21.7390 99.5125 Constraint 257 526 11.2618 14.0772 21.1158 99.5125 Constraint 233 588 12.1437 15.1796 22.7694 99.5125 Constraint 233 581 10.6560 13.3200 19.9800 99.5125 Constraint 233 526 9.1723 11.4654 17.1980 99.5125 Constraint 221 588 14.5356 18.1695 27.2543 99.5125 Constraint 221 581 13.5782 16.9727 25.4591 99.5125 Constraint 221 526 10.9590 13.6987 20.5481 99.5125 Constraint 354 488 17.1060 21.3825 32.0738 99.2128 Constraint 264 488 17.5597 21.9497 32.9245 99.2128 Constraint 354 588 15.8286 19.7857 29.6786 99.1113 Constraint 406 472 13.6792 17.0990 25.6486 99.0091 Constraint 399 472 10.1512 12.6890 19.0335 99.0091 Constraint 388 472 11.5973 14.4967 21.7450 99.0091 Constraint 380 472 8.5920 10.7400 16.1100 99.0091 Constraint 354 472 13.0831 16.3539 24.5308 99.0091 Constraint 349 472 15.2218 19.0272 28.5408 99.0091 Constraint 264 472 14.5204 18.1505 27.2258 99.0091 Constraint 264 406 16.3528 20.4410 30.6615 99.0091 Constraint 257 472 13.7611 17.2014 25.8021 99.0091 Constraint 233 472 9.7792 12.2240 18.3360 99.0091 Constraint 221 472 8.0105 10.0131 15.0196 99.0091 Constraint 472 588 15.7349 19.6686 29.5029 98.3090 Constraint 472 581 13.5582 16.9478 25.4216 98.3090 Constraint 435 518 5.8731 7.3413 11.0120 98.2247 Constraint 435 509 8.7641 10.9552 16.4328 98.2247 Constraint 435 504 8.3409 10.4261 15.6391 98.2247 Constraint 371 518 12.2691 15.3364 23.0046 98.2247 Constraint 371 509 14.7897 18.4871 27.7306 98.2247 Constraint 371 504 12.4986 15.6232 23.4349 98.2247 Constraint 371 497 9.1921 11.4902 17.2352 98.2247 Constraint 371 488 12.4392 15.5490 23.3235 98.2247 Constraint 371 481 13.9939 17.4924 26.2386 98.2247 Constraint 371 435 7.3408 9.1760 13.7641 98.2247 Constraint 363 518 13.2098 16.5123 24.7684 98.2247 Constraint 363 504 13.0359 16.2949 24.4424 98.2247 Constraint 363 497 10.6693 13.3366 20.0049 98.2247 Constraint 363 481 15.6974 19.6218 29.4327 98.2247 Constraint 363 435 9.7489 12.1861 18.2791 98.2247 Constraint 354 435 13.7591 17.1989 25.7983 98.2247 Constraint 349 435 13.7010 17.1262 25.6894 98.2247 Constraint 305 371 11.6320 14.5400 21.8100 98.2247 Constraint 305 363 8.0793 10.0991 15.1487 98.2247 Constraint 283 399 17.5953 21.9941 32.9912 98.2247 Constraint 283 380 16.5016 20.6269 30.9404 98.2247 Constraint 283 363 14.6574 18.3218 27.4826 98.2247 Constraint 283 354 12.3117 15.3896 23.0844 98.2247 Constraint 283 349 12.1401 15.1751 22.7627 98.2247 Constraint 275 371 17.1558 21.4447 32.1671 98.2247 Constraint 275 363 13.2813 16.6016 24.9024 98.2247 Constraint 264 435 16.1238 20.1547 30.2321 98.2247 Constraint 264 371 14.9387 18.6734 28.0101 98.2247 Constraint 264 363 11.6136 14.5170 21.7755 98.2247 Constraint 257 435 14.1014 17.6267 26.4401 98.2247 Constraint 257 371 11.2798 14.0997 21.1495 98.2247 Constraint 257 363 7.4703 9.3379 14.0068 98.2247 Constraint 248 518 15.0048 18.7560 28.1339 98.2247 Constraint 248 509 15.4604 19.3255 28.9883 98.2247 Constraint 248 504 11.4737 14.3421 21.5131 98.2247 Constraint 248 497 12.1321 15.1652 22.7477 98.2247 Constraint 248 488 15.8921 19.8651 29.7976 98.2247 Constraint 248 481 14.5517 18.1896 27.2845 98.2247 Constraint 248 435 14.2197 17.7746 26.6619 98.2247 Constraint 248 406 17.1713 21.4641 32.1962 98.2247 Constraint 248 399 14.0727 17.5908 26.3863 98.2247 Constraint 248 388 15.0582 18.8228 28.2342 98.2247 Constraint 248 380 10.7370 13.4212 20.1318 98.2247 Constraint 248 371 11.6469 14.5586 21.8379 98.2247 Constraint 248 363 9.0891 11.3614 17.0420 98.2247 Constraint 248 354 5.0598 6.3247 9.4871 98.2247 Constraint 248 349 8.3198 10.3997 15.5995 98.2247 Constraint 241 518 13.6876 17.1096 25.6643 98.2247 Constraint 241 509 14.1317 17.6646 26.4969 98.2247 Constraint 241 504 10.1178 12.6472 18.9708 98.2247 Constraint 241 497 10.0121 12.5151 18.7726 98.2247 Constraint 241 488 13.5921 16.9901 25.4852 98.2247 Constraint 241 481 12.3587 15.4483 23.1725 98.2247 Constraint 241 435 11.8923 14.8654 22.2981 98.2247 Constraint 241 406 16.4858 20.6072 30.9108 98.2247 Constraint 241 399 12.9146 16.1433 24.2149 98.2247 Constraint 241 388 12.8878 16.1097 24.1646 98.2247 Constraint 241 380 8.8746 11.0933 16.6399 98.2247 Constraint 241 371 9.1010 11.3763 17.0644 98.2247 Constraint 241 363 7.9369 9.9212 14.8817 98.2247 Constraint 241 354 5.1922 6.4902 9.7354 98.2247 Constraint 241 349 8.7469 10.9336 16.4004 98.2247 Constraint 233 435 9.4868 11.8586 17.7878 98.2247 Constraint 233 371 6.2906 7.8633 11.7949 98.2247 Constraint 233 363 3.8310 4.7888 7.1831 98.2247 Constraint 221 435 8.6279 10.7849 16.1774 98.2247 Constraint 221 371 4.4959 5.6199 8.4298 98.2247 Constraint 221 363 5.5689 6.9611 10.4417 98.2247 Constraint 429 518 8.3148 10.3935 15.5902 97.5916 Constraint 429 509 11.5554 14.4443 21.6664 97.5916 Constraint 429 504 12.2940 15.3675 23.0512 97.5916 Constraint 429 497 8.3776 10.4720 15.7081 97.5916 Constraint 418 518 5.0881 6.3601 9.5401 97.5916 Constraint 418 509 8.6771 10.8464 16.2696 97.5916 Constraint 418 504 10.3450 12.9313 19.3969 97.5916 Constraint 418 497 7.4747 9.3433 14.0150 97.5916 Constraint 418 488 7.5899 9.4874 14.2312 97.5916 Constraint 354 429 17.4144 21.7680 32.6521 97.5916 Constraint 349 429 16.6642 20.8303 31.2455 97.5916 Constraint 342 518 13.0827 16.3534 24.5301 97.5916 Constraint 342 509 15.6212 19.5264 29.2897 97.5916 Constraint 342 504 12.9113 16.1391 24.2087 97.5916 Constraint 342 497 11.7007 14.6259 21.9389 97.5916 Constraint 342 488 15.8403 19.8004 29.7005 97.5916 Constraint 342 481 16.6425 20.8032 31.2048 97.5916 Constraint 342 429 14.6564 18.3205 27.4808 97.5916 Constraint 342 418 14.2667 17.8333 26.7500 97.5916 Constraint 342 406 12.1911 15.2388 22.8583 97.5916 Constraint 342 399 10.0506 12.5632 18.8448 97.5916 Constraint 305 418 14.8487 18.5608 27.8413 97.5916 Constraint 298 518 13.1670 16.4588 24.6882 97.5916 Constraint 298 509 15.0268 18.7835 28.1752 97.5916 Constraint 298 504 13.0919 16.3649 24.5473 97.5916 Constraint 298 497 13.6315 17.0393 25.5590 97.5916 Constraint 298 488 17.1423 21.4279 32.1419 97.5916 Constraint 298 418 15.4658 19.3322 28.9983 97.5916 Constraint 298 406 11.9078 14.8847 22.3271 97.5916 Constraint 298 399 11.3039 14.1299 21.1948 97.5916 Constraint 298 388 15.2511 19.0639 28.5959 97.5916 Constraint 298 380 11.7036 14.6295 21.9442 97.5916 Constraint 298 354 12.1951 15.2438 22.8657 97.5916 Constraint 275 342 9.7633 12.2041 18.3062 97.5916 Constraint 264 342 8.3030 10.3788 15.5681 97.5916 Constraint 257 429 17.8666 22.3332 33.4999 97.5916 Constraint 257 418 17.2288 21.5360 32.3040 97.5916 Constraint 257 342 4.7039 5.8799 8.8198 97.5916 Constraint 233 429 13.3136 16.6420 24.9630 97.5916 Constraint 233 418 13.5371 16.9214 25.3822 97.5916 Constraint 233 342 4.9255 6.1569 9.2353 97.5916 Constraint 221 429 12.3077 15.3846 23.0769 97.5916 Constraint 221 418 13.6888 17.1110 25.6664 97.5916 Constraint 221 342 9.0438 11.3048 16.9572 97.5916 Constraint 221 298 14.4809 18.1011 27.1516 97.5916 Constraint 435 588 9.8405 12.3006 18.4509 97.5246 Constraint 435 581 9.8004 12.2505 18.3757 97.5246 Constraint 435 526 7.5437 9.4296 14.1444 97.5246 Constraint 371 588 12.4238 15.5297 23.2946 97.5246 Constraint 371 581 12.8933 16.1166 24.1749 97.5246 Constraint 371 526 11.7164 14.6455 21.9683 97.5246 Constraint 363 588 11.4940 14.3674 21.5512 97.5246 Constraint 363 581 11.4700 14.3375 21.5062 97.5246 Constraint 363 526 11.3516 14.1896 21.2843 97.5246 Constraint 283 588 16.9291 21.1614 31.7421 97.5246 Constraint 283 581 14.0619 17.5774 26.3661 97.5246 Constraint 283 526 15.0896 18.8619 28.2929 97.5246 Constraint 248 588 16.5147 20.6434 30.9651 97.5246 Constraint 248 581 13.7803 17.2254 25.8382 97.5246 Constraint 248 526 11.5146 14.3932 21.5898 97.5246 Constraint 241 581 14.0666 17.5833 26.3749 97.5246 Constraint 241 526 10.9822 13.7277 20.5915 97.5246 Constraint 305 518 12.4347 15.5434 23.3151 97.2127 Constraint 305 509 14.4810 18.1013 27.1520 97.2127 Constraint 305 497 11.5583 14.4478 21.6718 97.2127 Constraint 305 488 15.5683 19.4603 29.1905 97.2127 Constraint 305 481 15.9380 19.9226 29.8838 97.2127 Constraint 305 388 12.6455 15.8069 23.7104 97.2127 Constraint 354 481 16.6870 20.8588 31.2882 97.2126 Constraint 481 552 12.4118 15.5147 23.2721 97.1158 Constraint 406 552 5.2832 6.6040 9.9061 97.1158 Constraint 399 552 6.0046 7.5057 11.2586 97.1158 Constraint 380 552 10.2949 12.8687 19.3030 97.1158 Constraint 305 552 10.7363 13.4204 20.1305 97.1158 Constraint 275 552 16.9997 21.2496 31.8744 97.1158 Constraint 264 552 13.5471 16.9339 25.4009 97.1158 Constraint 257 552 13.9448 17.4310 26.1465 97.1158 Constraint 233 552 12.7169 15.8962 23.8442 97.1158 Constraint 371 472 10.4664 13.0830 19.6245 97.0212 Constraint 363 472 12.2436 15.3045 22.9568 97.0212 Constraint 248 472 11.5609 14.4511 21.6766 97.0212 Constraint 241 472 8.7592 10.9489 16.4234 97.0212 Constraint 429 588 10.2570 12.8212 19.2318 96.8915 Constraint 429 581 11.8483 14.8104 22.2156 96.8915 Constraint 429 526 11.0427 13.8033 20.7050 96.8915 Constraint 418 588 8.2579 10.3223 15.4835 96.8915 Constraint 418 581 8.8998 11.1247 16.6870 96.8915 Constraint 418 526 8.2952 10.3690 15.5535 96.8915 Constraint 342 588 9.8745 12.3431 18.5146 96.8915 Constraint 342 581 8.8899 11.1124 16.6686 96.8915 Constraint 342 526 10.1589 12.6986 19.0479 96.8915 Constraint 298 588 10.1695 12.7118 19.0677 96.8915 Constraint 298 581 7.1339 8.9173 13.3760 96.8915 Constraint 298 526 9.5623 11.9528 17.9292 96.8915 Constraint 298 429 17.7096 22.1369 33.2054 96.5917 Constraint 406 534 9.7395 12.1743 18.2615 96.5125 Constraint 399 534 8.5805 10.7257 16.0885 96.5125 Constraint 388 534 14.7605 18.4507 27.6760 96.5125 Constraint 380 534 11.2837 14.1047 21.1570 96.5125 Constraint 354 534 16.5353 20.6691 31.0037 96.5125 Constraint 349 534 17.3874 21.7342 32.6013 96.5125 Constraint 305 534 11.9952 14.9940 22.4909 96.5125 Constraint 275 534 16.7931 20.9914 31.4872 96.5125 Constraint 264 534 12.7285 15.9106 23.8659 96.5125 Constraint 257 534 14.0566 17.5708 26.3562 96.5125 Constraint 233 534 12.7030 15.8788 23.8182 96.5125 Constraint 221 534 14.2822 17.8528 26.7792 96.5125 Constraint 275 588 17.7867 22.2334 33.3501 96.5125 Constraint 504 572 14.3670 17.9587 26.9381 96.5125 Constraint 497 572 13.8703 17.3378 26.0068 96.5125 Constraint 406 572 6.9707 8.7134 13.0701 96.5125 Constraint 399 572 9.2307 11.5384 17.3076 96.5125 Constraint 380 572 12.7649 15.9561 23.9342 96.5125 Constraint 305 572 10.6836 13.3546 20.0318 96.5125 Constraint 264 572 14.6996 18.3746 27.5618 96.5125 Constraint 257 572 14.6352 18.2939 27.4409 96.5125 Constraint 233 572 14.6552 18.3190 27.4785 96.5125 Constraint 349 418 17.2766 21.5958 32.3936 96.3881 Constraint 342 472 13.8754 17.3442 26.0163 96.3881 Constraint 298 472 16.2421 20.3026 30.4539 96.3881 Constraint 241 588 16.2788 20.3485 30.5227 96.2497 Constraint 305 472 13.6988 17.1235 25.6852 96.0092 Constraint 472 552 12.9554 16.1942 24.2913 95.9123 Constraint 363 429 12.6314 15.7892 23.6838 95.6037 Constraint 342 435 11.6471 14.5589 21.8383 95.6037 Constraint 323 504 15.7323 19.6654 29.4981 95.6037 Constraint 323 435 14.6733 18.3417 27.5125 95.6037 Constraint 323 418 15.8210 19.7763 29.6644 95.6037 Constraint 323 406 12.4469 15.5586 23.3379 95.6037 Constraint 323 399 11.7694 14.7118 22.0677 95.6037 Constraint 323 388 13.4677 16.8346 25.2520 95.6037 Constraint 323 380 11.0263 13.7829 20.6743 95.6037 Constraint 298 435 14.7641 18.4552 27.6827 95.6037 Constraint 298 371 15.0011 18.7513 28.1270 95.6037 Constraint 298 363 11.6952 14.6190 21.9284 95.6037 Constraint 291 518 14.8125 18.5156 27.7734 95.6037 Constraint 291 509 15.9892 19.9865 29.9797 95.6037 Constraint 291 504 13.2587 16.5734 24.8601 95.6037 Constraint 291 497 14.3250 17.9063 26.8594 95.6037 Constraint 291 435 16.0350 20.0438 30.0656 95.6037 Constraint 291 406 14.7902 18.4878 27.7317 95.6037 Constraint 291 399 13.3906 16.7382 25.1073 95.6037 Constraint 291 388 16.7047 20.8809 31.3213 95.6037 Constraint 291 380 12.6164 15.7705 23.6557 95.6037 Constraint 291 371 15.3029 19.1287 28.6930 95.6037 Constraint 291 363 11.7493 14.6866 22.0299 95.6037 Constraint 291 354 10.4450 13.0563 19.5844 95.6037 Constraint 291 349 10.3637 12.9546 19.4319 95.6037 Constraint 283 342 10.3982 12.9977 19.4966 95.6037 Constraint 257 323 7.8072 9.7590 14.6386 95.6037 Constraint 248 342 8.2757 10.3446 15.5169 95.6037 Constraint 248 323 12.0260 15.0326 22.5488 95.6037 Constraint 241 429 16.1352 20.1690 30.2535 95.6037 Constraint 241 418 16.3511 20.4389 30.6583 95.6037 Constraint 241 342 9.0848 11.3559 17.0339 95.6037 Constraint 241 323 13.6163 17.0203 25.5305 95.6037 Constraint 233 323 9.7201 12.1501 18.2251 95.6037 Constraint 221 323 13.8345 17.2932 25.9398 95.6037 Constraint 488 572 16.0583 20.0729 30.1093 95.5125 Constraint 363 509 15.6865 19.6081 29.4121 95.2248 Constraint 363 488 14.4748 18.0935 27.1403 95.2248 Constraint 305 435 12.5888 15.7360 23.6040 95.2247 Constraint 443 518 9.9495 12.4369 18.6554 95.2247 Constraint 443 509 12.3271 15.4089 23.1134 95.2247 Constraint 380 443 7.5263 9.4078 14.1117 95.2247 Constraint 371 443 7.5761 9.4701 14.2051 95.2247 Constraint 363 443 11.4055 14.2569 21.3853 95.2247 Constraint 354 443 15.7029 19.6286 29.4430 95.2247 Constraint 349 443 15.5576 19.4470 29.1705 95.2247 Constraint 241 443 14.1316 17.6645 26.4967 95.2247 Constraint 233 443 12.0720 15.0900 22.6350 95.2247 Constraint 221 443 9.8224 12.2780 18.4170 95.2247 Constraint 283 504 17.2731 21.5914 32.3871 95.2247 Constraint 310 518 16.6015 20.7518 31.1277 95.2247 Constraint 310 504 15.4868 19.3585 29.0378 95.2247 Constraint 310 406 15.9564 19.9455 29.9182 95.2247 Constraint 310 399 14.4027 18.0034 27.0050 95.2247 Constraint 310 388 16.1648 20.2060 30.3091 95.2247 Constraint 310 380 12.5830 15.7288 23.5932 95.2247 Constraint 310 371 14.3204 17.9005 26.8507 95.2247 Constraint 310 363 10.1926 12.7408 19.1112 95.2247 Constraint 241 310 11.2523 14.0654 21.0981 95.2247 Constraint 233 310 8.9941 11.2427 16.8640 95.2247 Constraint 221 310 13.3270 16.6588 24.9881 95.2247 Constraint 435 552 10.1117 12.6396 18.9594 95.1278 Constraint 363 552 14.1441 17.6802 26.5202 95.1278 Constraint 283 552 16.0359 20.0449 30.0673 95.1278 Constraint 248 552 15.2071 19.0089 28.5133 95.1278 Constraint 241 552 15.2538 19.0673 28.6009 95.1278 Constraint 406 543 7.5809 9.4762 14.2142 95.1122 Constraint 399 543 7.7971 9.7463 14.6195 95.1122 Constraint 388 543 14.4345 18.0431 27.0647 95.1122 Constraint 380 543 12.0743 15.0929 22.6394 95.1122 Constraint 305 543 14.1010 17.6263 26.4395 95.1122 Constraint 257 543 16.7605 20.9506 31.4259 95.1122 Constraint 233 543 14.8829 18.6036 27.9055 95.1122 Constraint 221 543 16.2287 20.2859 30.4288 95.1122 Constraint 323 588 9.2150 11.5187 17.2780 94.9035 Constraint 323 581 8.5525 10.6907 16.0360 94.9035 Constraint 323 526 12.0109 15.0136 22.5204 94.9035 Constraint 291 588 13.3148 16.6435 24.9652 94.9035 Constraint 291 581 10.0357 12.5446 18.8169 94.9035 Constraint 291 526 10.7851 13.4814 20.2220 94.9035 Constraint 305 429 16.0321 20.0401 30.0602 94.5916 Constraint 443 588 12.9449 16.1812 24.2717 94.5246 Constraint 443 581 13.9384 17.4230 26.1345 94.5246 Constraint 443 526 11.9767 14.9709 22.4563 94.5246 Constraint 435 534 10.7682 13.4602 20.1903 94.5246 Constraint 371 534 15.5867 19.4834 29.2251 94.5246 Constraint 363 534 15.2996 19.1246 28.6868 94.5246 Constraint 283 534 16.4957 20.6197 30.9295 94.5246 Constraint 248 534 13.6506 17.0632 25.5948 94.5246 Constraint 241 534 13.4870 16.8588 25.2882 94.5246 Constraint 435 572 13.7592 17.1990 25.7985 94.5246 Constraint 310 588 13.6328 17.0410 25.5615 94.5246 Constraint 310 581 11.5461 14.4327 21.6490 94.5246 Constraint 310 572 13.3408 16.6759 25.0139 94.5246 Constraint 310 526 12.8906 16.1133 24.1700 94.5246 Constraint 283 572 15.2223 19.0279 28.5419 94.5246 Constraint 349 572 16.0696 20.0870 30.1305 94.5126 Constraint 418 552 8.2403 10.3004 15.4506 94.4947 Constraint 342 552 12.0402 15.0503 22.5755 94.4947 Constraint 298 552 9.5533 11.9416 17.9124 94.4947 Constraint 213 518 8.1710 10.2137 15.3206 94.2126 Constraint 213 509 9.7416 12.1770 18.2655 94.2126 Constraint 213 504 7.3251 9.1564 13.7346 94.2126 Constraint 213 497 4.1872 5.2340 7.8510 94.2126 Constraint 213 488 7.5173 9.3966 14.0950 94.2126 Constraint 213 481 8.5727 10.7158 16.0737 94.2126 Constraint 213 406 11.2404 14.0504 21.0757 94.2126 Constraint 213 399 7.3476 9.1845 13.7768 94.2126 Constraint 213 388 6.7791 8.4739 12.7109 94.2126 Constraint 213 380 3.9108 4.8885 7.3328 94.2126 Constraint 213 354 10.3586 12.9482 19.4223 94.2126 Constraint 213 349 11.4273 14.2841 21.4261 94.2126 Constraint 213 305 11.3213 14.1516 21.2275 94.2126 Constraint 388 552 12.5618 15.7023 23.5534 94.1158 Constraint 349 552 16.1310 20.1638 30.2457 94.1158 Constraint 221 552 14.8665 18.5831 27.8746 94.1158 Constraint 388 572 14.2872 17.8590 26.7885 94.1114 Constraint 472 543 11.8460 14.8075 22.2113 93.9087 Constraint 264 543 15.9501 19.9376 29.9064 93.9087 Constraint 429 534 13.9502 17.4377 26.1566 93.8915 Constraint 418 534 10.5417 13.1771 19.7657 93.8915 Constraint 342 534 13.7533 17.1916 25.7875 93.8915 Constraint 298 534 11.5108 14.3885 21.5828 93.8915 Constraint 418 572 11.6390 14.5488 21.8232 93.8915 Constraint 342 572 11.8147 14.7684 22.1525 93.8915 Constraint 298 572 8.3951 10.4939 15.7409 93.8915 Constraint 406 559 8.0349 10.0437 15.0655 93.6459 Constraint 399 559 10.1171 12.6464 18.9696 93.6459 Constraint 380 559 14.3622 17.9528 26.9291 93.6459 Constraint 305 559 12.8618 16.0773 24.1159 93.6459 Constraint 257 559 16.4249 20.5312 30.7968 93.6459 Constraint 233 559 16.3117 20.3897 30.5845 93.6459 Constraint 213 588 12.2722 15.3402 23.0103 93.5125 Constraint 213 581 11.2176 14.0220 21.0330 93.5125 Constraint 213 526 7.8346 9.7932 14.6898 93.5125 Constraint 526 595 7.1812 8.9765 13.4647 93.5125 Constraint 518 595 8.3978 10.4972 15.7458 93.5125 Constraint 509 595 11.9865 14.9832 22.4747 93.5125 Constraint 504 595 10.8115 13.5144 20.2716 93.5125 Constraint 497 595 8.4754 10.5943 15.8914 93.5125 Constraint 488 595 11.9012 14.8765 22.3147 93.5125 Constraint 481 595 14.0965 17.6206 26.4309 93.5125 Constraint 406 595 6.3698 7.9622 11.9434 93.5125 Constraint 399 595 4.6145 5.7681 8.6521 93.5125 Constraint 388 595 6.8154 8.5193 12.7789 93.5125 Constraint 380 595 4.8113 6.0142 9.0212 93.5125 Constraint 354 595 11.4543 14.3178 21.4768 93.5125 Constraint 349 595 9.7323 12.1654 18.2481 93.5125 Constraint 305 595 7.4055 9.2568 13.8852 93.5125 Constraint 275 595 14.8850 18.6062 27.9093 93.5125 Constraint 264 595 12.3243 15.4053 23.1080 93.5125 Constraint 257 595 10.0517 12.5647 18.8470 93.5125 Constraint 233 595 7.5987 9.4984 14.2476 93.5125 Constraint 221 595 10.0322 12.5402 18.8103 93.5125 Constraint 354 552 16.6599 20.8249 31.2373 93.3134 Constraint 275 497 17.5386 21.9232 32.8849 93.2128 Constraint 363 572 14.9529 18.6911 28.0366 93.1876 Constraint 248 572 17.4146 21.7682 32.6523 93.1876 Constraint 435 543 10.4577 13.0721 19.6082 93.1243 Constraint 248 543 16.9391 21.1739 31.7608 93.1243 Constraint 241 543 16.4517 20.5646 30.8469 93.1243 Constraint 213 472 5.2723 6.5903 9.8855 93.0091 Constraint 264 559 15.3241 19.1551 28.7326 92.9077 Constraint 122 509 10.9349 13.6687 20.5030 92.6576 Constraint 323 518 14.7285 18.4107 27.6160 92.6037 Constraint 323 497 14.7395 18.4244 27.6366 92.6037 Constraint 342 443 14.5078 18.1347 27.2020 92.6037 Constraint 315 518 17.1292 21.4115 32.1173 92.6037 Constraint 315 504 17.0981 21.3726 32.0590 92.6037 Constraint 315 406 15.2100 19.0125 28.5188 92.6037 Constraint 315 399 14.6351 18.2938 27.4408 92.6037 Constraint 315 388 17.0456 21.3071 31.9606 92.6037 Constraint 315 380 14.0285 17.5356 26.3034 92.6037 Constraint 315 371 16.2730 20.3412 30.5118 92.6037 Constraint 248 315 12.1377 15.1721 22.7582 92.6037 Constraint 241 315 14.6916 18.3645 27.5468 92.6037 Constraint 233 315 11.7242 14.6553 21.9829 92.6037 Constraint 221 315 16.1072 20.1340 30.2010 92.6037 Constraint 275 572 16.9006 21.1257 31.6886 92.5126 Constraint 323 552 12.1243 15.1554 22.7330 92.5068 Constraint 291 552 11.9984 14.9980 22.4970 92.5068 Constraint 429 543 12.4600 15.5750 23.3624 92.4912 Constraint 418 543 8.3270 10.4088 15.6132 92.4912 Constraint 342 543 15.4290 19.2863 28.9295 92.4912 Constraint 298 543 13.2756 16.5945 24.8918 92.4912 Constraint 354 418 17.9142 22.3927 33.5891 92.3876 Constraint 148 509 9.4439 11.8049 17.7074 92.3586 Constraint 134 518 11.0216 13.7770 20.6655 92.3586 Constraint 472 595 12.2374 15.2968 22.9452 92.3090 Constraint 310 497 15.4833 19.3541 29.0311 92.2247 Constraint 310 435 16.5423 20.6778 31.0168 92.2247 Constraint 213 435 4.4171 5.5213 8.2820 92.2247 Constraint 213 371 5.5997 6.9997 10.4995 92.2247 Constraint 213 363 7.7186 9.6482 14.4723 92.2247 Constraint 248 443 16.9546 21.1933 31.7899 92.2247 Constraint 429 572 14.7726 18.4657 27.6986 92.1533 Constraint 371 552 14.6488 18.3110 27.4664 92.1278 Constraint 310 552 14.2777 17.8471 26.7706 92.1278 Constraint 148 526 6.3471 7.9339 11.9008 92.0216 Constraint 148 518 8.6666 10.8333 16.2499 92.0216 Constraint 122 406 9.5732 11.9665 17.9497 92.0216 Constraint 354 572 17.9124 22.3906 33.5858 91.9721 Constraint 148 504 5.7811 7.2264 10.8396 91.9574 Constraint 148 488 9.1256 11.4070 17.1105 91.9574 Constraint 148 481 8.6654 10.8318 16.2477 91.9574 Constraint 142 509 12.1330 15.1663 22.7494 91.9574 Constraint 142 481 11.4072 14.2590 21.3885 91.9574 Constraint 134 509 12.3364 15.4205 23.1307 91.9574 Constraint 134 504 9.1559 11.4449 17.1674 91.9574 Constraint 134 481 13.1467 16.4334 24.6502 91.9574 Constraint 122 488 13.0117 16.2646 24.3970 91.9574 Constraint 122 481 13.3182 16.6477 24.9716 91.9574 Constraint 291 534 12.4628 15.5785 23.3678 91.9035 Constraint 323 572 9.5115 11.8894 17.8341 91.9035 Constraint 315 588 12.3662 15.4577 23.1866 91.9035 Constraint 315 581 10.6909 13.3637 20.0455 91.9035 Constraint 315 572 11.1972 13.9965 20.9948 91.9035 Constraint 315 526 13.6682 17.0852 25.6279 91.9035 Constraint 291 572 11.9874 14.9842 22.4764 91.9035 Constraint 418 559 11.6990 14.6238 21.9357 91.8985 Constraint 342 559 14.7384 18.4230 27.6344 91.8985 Constraint 298 559 10.4093 13.0117 19.5175 91.8985 Constraint 435 559 14.3631 17.9539 26.9308 91.6579 Constraint 488 559 14.6940 18.3676 27.5513 91.6459 Constraint 148 497 5.2338 6.5422 9.8133 91.6204 Constraint 148 472 5.6261 7.0326 10.5489 91.6204 Constraint 142 504 8.1235 10.1544 15.2316 91.6204 Constraint 134 526 7.2397 9.0496 13.5745 91.6204 Constraint 122 518 9.2938 11.6172 17.4259 91.6204 Constraint 122 504 8.8698 11.0872 16.6308 91.6204 Constraint 122 497 9.6133 12.0166 18.0249 91.6204 Constraint 122 472 12.2177 15.2721 22.9081 91.6204 Constraint 122 435 11.2490 14.0613 21.0919 91.6204 Constraint 122 399 8.0932 10.1165 15.1747 91.6204 Constraint 122 388 12.8185 16.0231 24.0347 91.6204 Constraint 122 380 8.7890 10.9863 16.4794 91.6204 Constraint 122 371 12.7056 15.8821 23.8231 91.6204 Constraint 122 363 10.3889 12.9861 19.4792 91.6204 Constraint 122 354 11.2924 14.1154 21.1732 91.6204 Constraint 122 349 11.1700 13.9626 20.9438 91.6204 Constraint 122 305 4.7134 5.8918 8.8376 91.6204 Constraint 122 283 10.0752 12.5940 18.8911 91.6204 Constraint 122 275 10.6663 13.3329 19.9993 91.6204 Constraint 122 264 7.0346 8.7932 13.1898 91.6204 Constraint 122 257 7.6563 9.5704 14.3556 91.6204 Constraint 122 248 9.3476 11.6845 17.5267 91.6204 Constraint 122 241 10.4895 13.1118 19.6677 91.6204 Constraint 122 233 8.1102 10.1378 15.2066 91.6204 Constraint 122 221 11.7046 14.6308 21.9461 91.6204 Constraint 213 429 8.6059 10.7574 16.1361 91.5916 Constraint 213 418 9.5185 11.8982 17.8472 91.5916 Constraint 213 342 10.1665 12.7081 19.0622 91.5916 Constraint 213 298 14.1168 17.6460 26.4690 91.5916 Constraint 443 534 14.9970 18.7462 28.1193 91.5246 Constraint 310 534 15.4357 19.2946 28.9419 91.5246 Constraint 435 595 7.3524 9.1905 13.7857 91.5246 Constraint 371 595 8.4132 10.5165 15.7748 91.5246 Constraint 363 595 7.2220 9.0275 13.5412 91.5246 Constraint 310 595 11.0280 13.7850 20.6775 91.5246 Constraint 283 595 14.8328 18.5410 27.8115 91.5246 Constraint 248 595 12.3508 15.4384 23.1577 91.5246 Constraint 241 595 11.8442 14.8052 22.2078 91.5246 Constraint 429 552 11.8572 14.8215 22.2323 91.4947 Constraint 291 472 15.8341 19.7927 29.6890 91.4003 Constraint 148 588 12.6720 15.8400 23.7599 91.3215 Constraint 148 581 10.2315 12.7894 19.1842 91.3215 Constraint 148 552 10.8071 13.5088 20.2632 91.3215 Constraint 148 406 11.9183 14.8978 22.3467 91.3215 Constraint 148 399 8.2860 10.3574 15.5362 91.3215 Constraint 142 581 11.8872 14.8589 22.2884 91.3215 Constraint 142 552 12.6554 15.8192 23.7289 91.3215 Constraint 142 406 14.8981 18.6227 27.9340 91.3215 Constraint 134 588 11.3841 14.2301 21.3452 91.3215 Constraint 134 581 8.4298 10.5373 15.8059 91.3215 Constraint 134 552 10.2698 12.8373 19.2559 91.3215 Constraint 134 406 12.0679 15.0849 22.6273 91.3215 Constraint 122 588 9.2628 11.5785 17.3677 91.3215 Constraint 122 581 5.2274 6.5342 9.8013 91.3215 Constraint 122 552 6.7871 8.4839 12.7259 91.3215 Constraint 134 488 13.3119 16.6399 24.9598 91.2573 Constraint 213 552 11.8975 14.8718 22.3078 91.1158 Constraint 221 572 17.6907 22.1133 33.1700 91.0984 Constraint 310 472 17.0502 21.3128 31.9692 91.0212 Constraint 148 435 7.5924 9.4905 14.2358 90.9203 Constraint 148 388 9.9524 12.4406 18.6608 90.9203 Constraint 148 380 5.5159 6.8948 10.3422 90.9203 Constraint 148 371 8.0579 10.0724 15.1086 90.9203 Constraint 148 363 7.9350 9.9188 14.8782 90.9203 Constraint 148 354 8.5454 10.6818 16.0226 90.9203 Constraint 148 349 10.3838 12.9797 19.4696 90.9203 Constraint 148 305 8.9147 11.1433 16.7150 90.9203 Constraint 148 283 14.9700 18.7125 28.0688 90.9203 Constraint 148 275 13.6054 17.0067 25.5101 90.9203 Constraint 148 264 9.9329 12.4161 18.6241 90.9203 Constraint 148 257 8.6473 10.8091 16.2137 90.9203 Constraint 148 248 7.1746 8.9682 13.4523 90.9203 Constraint 148 241 5.0760 6.3450 9.5175 90.9203 Constraint 148 233 4.8681 6.0851 9.1277 90.9203 Constraint 148 221 5.2908 6.6135 9.9203 90.9203 Constraint 142 588 15.0507 18.8134 28.2200 90.9203 Constraint 142 526 8.5587 10.6984 16.0476 90.9203 Constraint 142 518 11.9952 14.9940 22.4910 90.9203 Constraint 142 497 9.2809 11.6012 17.4018 90.9203 Constraint 142 488 12.8331 16.0414 24.0621 90.9203 Constraint 142 472 8.7713 10.9641 16.4462 90.9203 Constraint 142 435 11.9634 14.9543 22.4314 90.9203 Constraint 142 399 11.7122 14.6403 21.9604 90.9203 Constraint 142 388 13.7991 17.2489 25.8734 90.9203 Constraint 142 380 9.1751 11.4689 17.2033 90.9203 Constraint 142 371 11.1688 13.9610 20.9415 90.9203 Constraint 142 363 9.4687 11.8359 17.7538 90.9203 Constraint 142 354 7.3238 9.1547 13.7321 90.9203 Constraint 142 349 10.0945 12.6181 18.9271 90.9203 Constraint 142 305 7.9439 9.9298 14.8948 90.9203 Constraint 142 283 11.8376 14.7970 22.1955 90.9203 Constraint 142 275 10.0227 12.5284 18.7926 90.9203 Constraint 142 264 6.3856 7.9820 11.9731 90.9203 Constraint 142 257 6.3357 7.9196 11.8794 90.9203 Constraint 142 248 3.5074 4.3842 6.5764 90.9203 Constraint 142 241 3.8342 4.7927 7.1891 90.9203 Constraint 142 233 5.6793 7.0992 10.6488 90.9203 Constraint 142 221 7.6462 9.5578 14.3367 90.9203 Constraint 134 497 9.2796 11.5994 17.3992 90.9203 Constraint 134 472 10.7537 13.4422 20.1633 90.9203 Constraint 134 435 10.9074 13.6343 20.4514 90.9203 Constraint 134 399 9.3767 11.7209 17.5813 90.9203 Constraint 134 388 11.8402 14.8002 22.2003 90.9203 Constraint 134 380 7.3464 9.1830 13.7745 90.9203 Constraint 134 371 10.0794 12.5992 18.8988 90.9203 Constraint 134 363 7.3433 9.1791 13.7686 90.9203 Constraint 134 354 7.0314 8.7892 13.1838 90.9203 Constraint 134 349 7.8362 9.7953 14.6930 90.9203 Constraint 134 305 3.8326 4.7907 7.1861 90.9203 Constraint 134 283 9.8155 12.2694 18.4041 90.9203 Constraint 134 275 8.9390 11.1738 16.7607 90.9203 Constraint 134 264 5.4718 6.8397 10.2595 90.9203 Constraint 134 257 4.2040 5.2550 7.8825 90.9203 Constraint 134 248 5.3472 6.6840 10.0259 90.9203 Constraint 134 241 6.4106 8.0132 12.0199 90.9203 Constraint 134 233 4.2956 5.3695 8.0542 90.9203 Constraint 134 221 8.2010 10.2513 15.3770 90.9203 Constraint 122 526 5.4238 6.7797 10.1696 90.9203 Constraint 429 595 9.4467 11.8084 17.7126 90.8915 Constraint 418 595 8.5059 10.6324 15.9486 90.8915 Constraint 342 595 6.2026 7.7532 11.6298 90.8915 Constraint 298 595 8.8310 11.0388 16.5582 90.8915 Constraint 465 581 15.1073 18.8841 28.3261 90.6242 Constraint 399 465 10.7690 13.4613 20.1919 90.6242 Constraint 388 465 12.0244 15.0305 22.5457 90.6242 Constraint 380 465 10.4525 13.0657 19.5985 90.6242 Constraint 342 465 16.9607 21.2009 31.8013 90.6242 Constraint 233 465 13.2578 16.5723 24.8584 90.6242 Constraint 221 465 11.0259 13.7824 20.6736 90.6242 Constraint 526 603 10.5762 13.2203 19.8304 90.5127 Constraint 518 603 10.2236 12.7795 19.1693 90.5127 Constraint 509 603 14.1486 17.6858 26.5287 90.5127 Constraint 504 603 13.5395 16.9244 25.3866 90.5127 Constraint 497 603 10.1161 12.6452 18.9678 90.5127 Constraint 488 603 12.8026 16.0033 24.0049 90.5127 Constraint 481 603 15.8192 19.7740 29.6609 90.5127 Constraint 406 603 7.5036 9.3795 14.0693 90.5127 Constraint 399 603 6.2964 7.8705 11.8058 90.5127 Constraint 388 603 3.9985 4.9981 7.4972 90.5127 Constraint 380 603 5.9732 7.4665 11.1998 90.5127 Constraint 354 603 13.5671 16.9588 25.4382 90.5127 Constraint 349 603 11.3685 14.2106 21.3159 90.5127 Constraint 305 603 11.4373 14.2967 21.4450 90.5127 Constraint 264 603 16.4192 20.5240 30.7860 90.5127 Constraint 257 603 13.4945 16.8681 25.3022 90.5127 Constraint 233 603 10.0641 12.5801 18.8701 90.5127 Constraint 221 603 11.0014 13.7518 20.6277 90.5127 Constraint 213 534 11.0758 13.8448 20.7672 90.5125 Constraint 291 543 15.1321 18.9151 28.3727 90.5033 Constraint 207 518 11.4632 14.3290 21.4935 90.2016 Constraint 207 509 13.1690 16.4613 24.6919 90.2016 Constraint 207 504 11.1653 13.9566 20.9348 90.2016 Constraint 207 497 7.7429 9.6786 14.5179 90.2016 Constraint 207 488 9.9626 12.4532 18.6798 90.2016 Constraint 207 481 11.3374 14.1718 21.2576 90.2016 Constraint 207 406 13.8176 17.2720 25.9079 90.2016 Constraint 207 399 10.2015 12.7518 19.1278 90.2016 Constraint 207 388 6.4422 8.0527 12.0791 90.2016 Constraint 207 380 6.2150 7.7688 11.6532 90.2016 Constraint 207 354 11.4472 14.3090 21.4635 90.2016 Constraint 207 349 12.2966 15.3708 23.0562 90.2016 Constraint 371 543 16.4105 20.5131 30.7697 90.1244 Constraint 443 543 14.4786 18.0982 27.1473 90.1243 Constraint 310 543 17.7643 22.2054 33.3081 90.1243 Constraint 371 572 16.5745 20.7181 31.0771 89.9128 Constraint 323 559 13.4848 16.8560 25.2841 89.9106 Constraint 291 559 13.2476 16.5595 24.8392 89.9106 Constraint 354 465 16.7887 20.9859 31.4788 89.6244 Constraint 465 588 16.5440 20.6800 31.0200 89.6243 Constraint 291 418 17.5993 21.9991 32.9987 89.6142 Constraint 291 481 17.4452 21.8065 32.7098 89.6038 Constraint 315 497 17.0773 21.3467 32.0200 89.6037 Constraint 213 323 14.2626 17.8282 26.7423 89.6037 Constraint 213 291 14.3870 17.9837 26.9756 89.6037 Constraint 248 429 18.3983 22.9978 34.4967 89.6037 Constraint 323 429 16.8288 21.0360 31.5541 89.6037 Constraint 315 552 13.6733 17.0916 25.6374 89.5068 Constraint 456 588 12.8933 16.1166 24.1749 89.5028 Constraint 456 581 12.2770 15.3462 23.0193 89.5028 Constraint 456 526 8.5146 10.6433 15.9649 89.5028 Constraint 388 456 8.2635 10.3293 15.4940 89.5028 Constraint 380 456 7.5410 9.4262 14.1393 89.5028 Constraint 371 456 9.7867 12.2334 18.3500 89.5028 Constraint 363 456 12.5967 15.7459 23.6189 89.5028 Constraint 354 456 15.7569 19.6961 29.5441 89.5028 Constraint 349 456 16.4726 20.5908 30.8862 89.5028 Constraint 342 456 14.6132 18.2664 27.3997 89.5028 Constraint 298 456 17.2767 21.5958 32.3937 89.5028 Constraint 257 456 16.4064 20.5080 30.7619 89.5028 Constraint 248 456 15.5350 19.4188 29.1282 89.5028 Constraint 241 456 12.8012 16.0015 24.0022 89.5028 Constraint 233 456 11.6926 14.6158 21.9237 89.5028 Constraint 221 456 9.9918 12.4897 18.7346 89.5028 Constraint 207 526 11.8193 14.7741 22.1612 89.5014 Constraint 148 534 9.1690 11.4613 17.1919 89.3586 Constraint 134 534 10.1428 12.6785 19.0177 89.3586 Constraint 472 603 13.8035 17.2544 25.8816 89.3092 Constraint 305 443 16.0497 20.0621 30.0931 89.2247 Constraint 213 443 6.8087 8.5109 12.7663 89.2247 Constraint 213 310 14.7625 18.4532 27.6798 89.2247 Constraint 213 572 15.5596 19.4495 29.1743 89.1755 Constraint 443 552 14.1288 17.6610 26.4914 89.1278 Constraint 363 543 16.5594 20.6992 31.0488 89.1133 Constraint 213 543 12.3360 15.4200 23.1301 89.1122 Constraint 122 429 14.6940 18.3675 27.5513 88.9994 Constraint 122 418 12.1869 15.2337 22.8505 88.9994 Constraint 122 342 7.1335 8.9169 13.3753 88.9994 Constraint 122 323 7.9566 9.9458 14.9187 88.9994 Constraint 122 298 4.4813 5.6016 8.4024 88.9994 Constraint 122 291 5.7548 7.1935 10.7903 88.9994 Constraint 207 472 7.8969 9.8711 14.8066 88.9981 Constraint 142 534 10.4749 13.0937 19.6405 88.9574 Constraint 122 534 7.7042 9.6302 14.4454 88.9574 Constraint 323 534 14.9356 18.6695 28.0042 88.9036 Constraint 315 534 15.9964 19.9955 29.9933 88.9035 Constraint 323 595 7.6796 9.5995 14.3992 88.9035 Constraint 315 595 11.1120 13.8901 20.8351 88.9035 Constraint 291 595 10.9719 13.7149 20.5724 88.9035 Constraint 148 418 11.4761 14.3452 21.5177 88.7004 Constraint 148 543 11.6050 14.5063 21.7594 88.6585 Constraint 134 543 12.7458 15.9323 23.8985 88.6585 Constraint 310 559 15.7176 19.6469 29.4704 88.6579 Constraint 371 465 12.2734 15.3417 23.0126 88.6363 Constraint 363 465 14.9808 18.7259 28.0889 88.6363 Constraint 248 465 15.7846 19.7308 29.5961 88.6363 Constraint 241 465 12.8225 16.0281 24.0421 88.6363 Constraint 122 443 15.4913 19.3642 29.0463 88.6204 Constraint 122 310 8.1462 10.1828 15.2742 88.6204 Constraint 298 481 17.3773 21.7216 32.5824 88.5916 Constraint 435 603 7.1054 8.8817 13.3226 88.5248 Constraint 371 603 7.6845 9.6057 14.4085 88.5248 Constraint 363 603 8.1825 10.2281 15.3422 88.5248 Constraint 310 603 14.6566 18.3207 27.4811 88.5248 Constraint 248 603 15.6019 19.5024 29.2536 88.5248 Constraint 241 603 14.3359 17.9199 26.8798 88.5248 Constraint 443 595 10.7197 13.3996 20.0994 88.5246 Constraint 207 588 14.4126 18.0157 27.0236 88.5015 Constraint 207 581 14.3712 17.9640 26.9460 88.5015 Constraint 248 418 17.8682 22.3352 33.5029 88.4107 Constraint 142 543 13.8166 17.2708 25.9061 88.3215 Constraint 148 572 14.6927 18.3659 27.5488 88.3215 Constraint 142 572 15.9107 19.8884 29.8327 88.3215 Constraint 134 572 12.2369 15.2961 22.9442 88.3215 Constraint 122 572 8.5386 10.6733 16.0099 88.3215 Constraint 148 465 9.1598 11.4497 17.1746 88.2993 Constraint 148 456 8.5196 10.6495 15.9742 88.2993 Constraint 148 429 12.0390 15.0487 22.5731 88.2993 Constraint 148 342 8.7392 10.9241 16.3861 88.2993 Constraint 148 323 12.7974 15.9967 23.9951 88.2993 Constraint 148 298 11.5934 14.4917 21.7376 88.2993 Constraint 148 291 11.0778 13.8473 20.7709 88.2993 Constraint 142 465 12.8595 16.0744 24.1116 88.2993 Constraint 142 456 12.8805 16.1006 24.1509 88.2993 Constraint 142 429 16.3588 20.4485 30.6728 88.2993 Constraint 142 418 15.3524 19.1905 28.7857 88.2993 Constraint 142 342 8.7921 10.9901 16.4851 88.2993 Constraint 142 323 12.5070 15.6337 23.4505 88.2993 Constraint 142 298 10.5279 13.1598 19.7398 88.2993 Constraint 142 291 8.5970 10.7462 16.1193 88.2993 Constraint 134 465 14.2759 17.8449 26.7673 88.2993 Constraint 134 456 12.9236 16.1545 24.2317 88.2993 Constraint 134 429 14.8585 18.5732 27.8598 88.2993 Constraint 134 418 13.5804 16.9755 25.4633 88.2993 Constraint 134 342 5.0197 6.2746 9.4120 88.2993 Constraint 134 323 8.3083 10.3854 15.5781 88.2993 Constraint 134 298 6.7673 8.4591 12.6887 88.2993 Constraint 134 291 5.8983 7.3728 11.0593 88.2993 Constraint 122 465 15.0659 18.8323 28.2485 88.2993 Constraint 122 456 13.3142 16.6427 24.9641 88.2993 Constraint 122 543 9.7930 12.2413 18.3619 88.2573 Constraint 207 435 6.2979 7.8723 11.8085 88.2136 Constraint 207 371 4.5196 5.6495 8.4742 88.2136 Constraint 207 363 8.4021 10.5026 15.7540 88.2136 Constraint 148 443 10.8808 13.6010 20.4015 87.9203 Constraint 142 443 15.2532 19.0665 28.5998 87.9203 Constraint 134 443 14.4925 18.1157 27.1735 87.9203 Constraint 148 310 12.0752 15.0940 22.6410 87.9203 Constraint 142 310 9.8990 12.3737 18.5605 87.9203 Constraint 134 310 6.8761 8.5951 12.8927 87.9203 Constraint 429 603 7.0916 8.8644 13.2967 87.8917 Constraint 418 603 8.0510 10.0637 15.0956 87.8917 Constraint 342 603 9.2459 11.5574 17.3361 87.8917 Constraint 298 603 13.1102 16.3877 24.5816 87.8917 Constraint 283 559 16.5096 20.6370 30.9555 87.6580 Constraint 305 465 17.1321 21.4152 32.1227 87.6243 Constraint 465 552 13.6774 17.0967 25.6451 87.6242 Constraint 465 543 11.8791 14.8489 22.2733 87.6242 Constraint 465 534 11.2826 14.1033 21.1550 87.6242 Constraint 207 429 8.9257 11.1572 16.7358 87.5805 Constraint 207 418 11.4931 14.3664 21.5496 87.5805 Constraint 207 342 12.2892 15.3615 23.0423 87.5805 Constraint 207 298 17.4247 21.7809 32.6714 87.5805 Constraint 534 603 14.4917 18.1146 27.1719 87.5127 Constraint 213 595 8.3819 10.4773 15.7160 87.5125 Constraint 323 543 16.0479 20.0599 30.0898 87.5033 Constraint 148 559 14.8568 18.5710 27.8565 87.4478 Constraint 142 559 15.9595 19.9494 29.9241 87.4478 Constraint 134 559 13.3118 16.6398 24.9597 87.4478 Constraint 122 559 9.1974 11.4967 17.2451 87.4478 Constraint 349 488 17.9250 22.4062 33.6094 87.2129 Constraint 207 305 14.0163 17.5204 26.2806 87.2016 Constraint 443 572 17.3542 21.6927 32.5391 86.9128 Constraint 315 559 14.2633 17.8291 26.7436 86.9106 Constraint 213 315 16.8176 21.0220 31.5330 86.6037 Constraint 315 435 17.6072 22.0090 33.0135 86.6037 Constraint 305 456 15.2281 19.0351 28.5526 86.5028 Constraint 456 552 11.2637 14.0797 21.1195 86.5028 Constraint 456 543 10.4461 13.0577 19.5865 86.5028 Constraint 456 534 10.7068 13.3835 20.0752 86.5028 Constraint 207 534 15.0384 18.7980 28.1970 86.5014 Constraint 310 509 18.2339 22.7924 34.1886 86.2247 Constraint 122 315 8.6783 10.8479 16.2718 85.9994 Constraint 323 603 10.8432 13.5540 20.3311 85.9038 Constraint 315 603 14.7070 18.3837 27.5755 85.9038 Constraint 291 603 15.2449 19.0562 28.5843 85.9038 Constraint 122 213 10.5289 13.1612 19.7418 85.6204 Constraint 207 323 16.6180 20.7725 31.1587 85.5926 Constraint 443 603 8.6042 10.7553 16.1330 85.5248 Constraint 264 456 17.7575 22.1969 33.2954 85.5029 Constraint 148 315 14.4991 18.1239 27.1858 85.2993 Constraint 142 315 13.0044 16.2554 24.3832 85.2993 Constraint 134 315 9.2930 11.6163 17.4244 85.2993 Constraint 207 443 5.9054 7.3817 11.0726 85.2136 Constraint 481 572 17.8563 22.3203 33.4805 85.1757 Constraint 148 213 4.2211 5.2764 7.9146 84.9203 Constraint 142 213 8.5438 10.6798 16.0197 84.9203 Constraint 134 213 8.6504 10.8129 16.2194 84.9203 Constraint 148 595 8.5493 10.6866 16.0299 84.9203 Constraint 142 595 11.0246 13.7808 20.6712 84.9203 Constraint 134 595 7.5326 9.4157 14.1236 84.9203 Constraint 122 595 7.0441 8.8051 13.2076 84.9203 Constraint 58 534 11.3954 14.2442 21.3663 84.6302 Constraint 58 509 14.0738 17.5923 26.3885 84.6302 Constraint 213 465 7.3496 9.1870 13.7804 84.6242 Constraint 465 595 13.9612 17.4515 26.1773 84.6242 Constraint 213 603 9.2773 11.5966 17.3950 84.5127 Constraint 315 543 17.6012 22.0016 33.0023 84.5033 Constraint 66 588 7.9596 9.9495 14.9243 84.2932 Constraint 66 581 5.9712 7.4639 11.1959 84.2932 Constraint 66 552 8.4854 10.6068 15.9102 84.2932 Constraint 66 543 12.5913 15.7392 23.6088 84.2932 Constraint 66 534 12.2453 15.3066 22.9599 84.2932 Constraint 66 526 10.5719 13.2149 19.8224 84.2932 Constraint 66 518 13.0975 16.3719 24.5578 84.2932 Constraint 66 509 15.5140 19.3925 29.0888 84.2932 Constraint 66 504 14.8212 18.5264 27.7897 84.2932 Constraint 66 497 14.8587 18.5734 27.8601 84.2932 Constraint 66 429 16.9673 21.2091 31.8137 84.2932 Constraint 66 418 14.1643 17.7054 26.5581 84.2932 Constraint 66 406 9.9455 12.4318 18.6478 84.2932 Constraint 66 399 10.8633 13.5791 20.3687 84.2932 Constraint 66 388 15.3168 19.1460 28.7191 84.2932 Constraint 66 380 12.8480 16.0600 24.0899 84.2932 Constraint 66 354 15.7455 19.6819 29.5229 84.2932 Constraint 66 349 13.9720 17.4649 26.1974 84.2932 Constraint 66 342 9.7641 12.2051 18.3076 84.2932 Constraint 66 305 8.0689 10.0861 15.1291 84.2932 Constraint 66 298 5.2460 6.5575 9.8362 84.2932 Constraint 66 275 13.5030 16.8788 25.3181 84.2932 Constraint 66 264 11.5943 14.4929 21.7394 84.2932 Constraint 66 257 11.8460 14.8075 22.2113 84.2932 Constraint 66 233 13.0490 16.3112 24.4668 84.2932 Constraint 66 221 16.8384 21.0480 31.5720 84.2932 Constraint 58 588 6.0591 7.5739 11.3608 84.2932 Constraint 58 581 4.3373 5.4216 8.1324 84.2932 Constraint 58 552 7.7620 9.7025 14.5537 84.2932 Constraint 58 543 11.9796 14.9745 22.4618 84.2932 Constraint 58 526 8.6236 10.7795 16.1692 84.2932 Constraint 58 518 11.2324 14.0405 21.0607 84.2932 Constraint 58 504 12.8588 16.0735 24.1103 84.2932 Constraint 58 497 12.2451 15.3064 22.9596 84.2932 Constraint 58 488 15.5692 19.4615 29.1922 84.2932 Constraint 58 429 14.2529 17.8162 26.7243 84.2932 Constraint 58 418 12.1072 15.1340 22.7011 84.2932 Constraint 58 406 8.4215 10.5268 15.7902 84.2932 Constraint 58 399 8.3444 10.4306 15.6458 84.2932 Constraint 58 388 12.0010 15.0013 22.5019 84.2932 Constraint 58 380 9.4853 11.8567 17.7850 84.2932 Constraint 58 354 12.7976 15.9970 23.9954 84.2932 Constraint 58 349 10.9425 13.6782 20.5172 84.2932 Constraint 58 342 6.6879 8.3599 12.5399 84.2932 Constraint 58 305 5.7459 7.1823 10.7735 84.2932 Constraint 58 298 4.8575 6.0719 9.1078 84.2932 Constraint 58 275 12.6694 15.8367 23.7551 84.2932 Constraint 58 264 10.4070 13.0087 19.5131 84.2932 Constraint 58 257 9.5318 11.9147 17.8720 84.2932 Constraint 58 233 9.8150 12.2687 18.4031 84.2932 Constraint 58 221 13.5083 16.8854 25.3281 84.2932 Constraint 51 588 4.4565 5.5706 8.3560 84.2932 Constraint 51 581 6.0363 7.5454 11.3180 84.2932 Constraint 51 552 9.4180 11.7725 17.6588 84.2932 Constraint 51 543 13.6912 17.1141 25.6711 84.2932 Constraint 51 534 13.9912 17.4889 26.2334 84.2932 Constraint 51 526 10.9741 13.7176 20.5764 84.2932 Constraint 51 518 12.5305 15.6631 23.4947 84.2932 Constraint 51 509 16.0058 20.0072 30.0108 84.2932 Constraint 51 504 15.3050 19.1312 28.6968 84.2932 Constraint 51 497 13.8434 17.3043 25.9564 84.2932 Constraint 51 488 16.9325 21.1656 31.7484 84.2932 Constraint 51 429 13.6370 17.0462 25.5694 84.2932 Constraint 51 418 11.9782 14.9727 22.4591 84.2932 Constraint 51 406 8.1978 10.2473 15.3709 84.2932 Constraint 51 399 8.9930 11.2412 16.8619 84.2932 Constraint 51 388 11.3988 14.2485 21.3727 84.2932 Constraint 51 380 10.3578 12.9472 19.4208 84.2932 Constraint 51 354 14.6288 18.2860 27.4289 84.2932 Constraint 51 349 11.9223 14.9028 22.3543 84.2932 Constraint 51 342 8.2416 10.3020 15.4530 84.2932 Constraint 51 305 8.6774 10.8467 16.2701 84.2932 Constraint 51 298 8.1828 10.2285 15.3427 84.2932 Constraint 51 275 15.5428 19.4285 29.1427 84.2932 Constraint 51 264 13.7811 17.2264 25.8396 84.2932 Constraint 51 257 12.1416 15.1770 22.7655 84.2932 Constraint 51 233 11.7272 14.6590 21.9885 84.2932 Constraint 51 221 14.9516 18.6895 28.0342 84.2932 Constraint 92 380 16.8199 21.0248 31.5373 84.2801 Constraint 207 552 15.2511 19.0639 28.5959 84.1047 Constraint 456 572 16.0767 20.0959 30.1439 84.1016 Constraint 66 148 14.0510 17.5637 26.3456 84.0375 Constraint 66 142 14.1316 17.6645 26.4968 84.0375 Constraint 66 134 10.2725 12.8406 19.2609 84.0375 Constraint 248 559 18.0388 22.5485 33.8228 83.9458 Constraint 58 148 11.1983 13.9979 20.9968 83.6363 Constraint 58 142 11.8320 14.7900 22.1850 83.6363 Constraint 58 134 7.7088 9.6360 14.4540 83.6363 Constraint 213 456 5.5757 6.9696 10.4545 83.5028 Constraint 456 595 10.6963 13.3704 20.0556 83.5028 Constraint 207 595 10.7709 13.4636 20.1954 83.5014 Constraint 66 435 15.1014 18.8768 28.3152 83.2993 Constraint 66 371 16.5392 20.6740 31.0110 83.2993 Constraint 66 363 13.8259 17.2824 25.9236 83.2993 Constraint 66 323 6.9785 8.7232 13.0848 83.2993 Constraint 66 291 8.6885 10.8607 16.2910 83.2993 Constraint 66 283 11.4296 14.2870 21.4304 83.2993 Constraint 66 248 15.0610 18.8262 28.2393 83.2993 Constraint 66 241 16.5425 20.6781 31.0172 83.2993 Constraint 58 456 15.0004 18.7505 28.1258 83.2993 Constraint 58 435 12.1634 15.2043 22.8064 83.2993 Constraint 58 371 12.9770 16.2212 24.3319 83.2993 Constraint 58 363 10.3557 12.9447 19.4170 83.2993 Constraint 58 323 5.2077 6.5096 9.7644 83.2993 Constraint 58 291 8.0206 10.0258 15.0387 83.2993 Constraint 58 283 11.4896 14.3620 21.5430 83.2993 Constraint 58 248 12.7299 15.9124 23.8686 83.2993 Constraint 58 241 13.6986 17.1233 25.6849 83.2993 Constraint 51 456 15.8142 19.7677 29.6516 83.2993 Constraint 51 435 12.6253 15.7816 23.6725 83.2993 Constraint 51 371 13.2361 16.5452 24.8178 83.2993 Constraint 51 363 11.0299 13.7874 20.6811 83.2993 Constraint 51 323 6.2701 7.8377 11.7565 83.2993 Constraint 51 291 11.3907 14.2383 21.3575 83.2993 Constraint 51 283 14.4191 18.0238 27.0357 83.2993 Constraint 51 248 15.6296 19.5370 29.3055 83.2993 Constraint 51 241 16.1435 20.1794 30.2691 83.2993 Constraint 51 148 13.5568 16.9460 25.4190 83.2993 Constraint 51 142 14.9287 18.6609 27.9913 83.2993 Constraint 51 134 10.7584 13.4480 20.1721 83.2993 Constraint 51 122 8.9015 11.1269 16.6904 83.2993 Constraint 44 588 5.7934 7.2418 10.8626 83.2993 Constraint 44 581 7.2894 9.1118 13.6677 83.2993 Constraint 44 552 10.7775 13.4719 20.2079 83.2993 Constraint 44 543 14.7734 18.4668 27.7001 83.2993 Constraint 44 534 14.5561 18.1951 27.2926 83.2993 Constraint 44 526 10.8390 13.5488 20.3232 83.2993 Constraint 44 518 12.5183 15.6479 23.4718 83.2993 Constraint 44 509 16.0815 20.1019 30.1529 83.2993 Constraint 44 504 14.7068 18.3835 27.5753 83.2993 Constraint 44 497 12.6558 15.8198 23.7297 83.2993 Constraint 44 488 16.2185 20.2732 30.4098 83.2993 Constraint 44 472 16.1431 20.1789 30.2683 83.2993 Constraint 44 456 14.4648 18.0810 27.1215 83.2993 Constraint 44 435 11.0735 13.8419 20.7628 83.2993 Constraint 44 429 12.4152 15.5191 23.2786 83.2993 Constraint 44 418 11.9058 14.8822 22.3234 83.2993 Constraint 44 406 9.2957 11.6196 17.4294 83.2993 Constraint 44 399 8.5694 10.7117 16.0676 83.2993 Constraint 44 388 8.8891 11.1113 16.6670 83.2993 Constraint 44 380 8.0020 10.0026 15.0038 83.2993 Constraint 44 371 9.9830 12.4787 18.7181 83.2993 Constraint 44 363 7.6232 9.5290 14.2934 83.2993 Constraint 44 354 11.7387 14.6734 22.0101 83.2993 Constraint 44 349 8.7472 10.9340 16.4010 83.2993 Constraint 44 342 5.6584 7.0730 10.6095 83.2993 Constraint 44 323 5.6558 7.0697 10.6046 83.2993 Constraint 44 305 7.5523 9.4403 14.1605 83.2993 Constraint 44 298 8.8571 11.0714 16.6071 83.2993 Constraint 44 291 11.1706 13.9632 20.9448 83.2993 Constraint 44 264 13.0061 16.2576 24.3864 83.2993 Constraint 44 257 10.2430 12.8038 19.2057 83.2993 Constraint 44 248 13.5768 16.9710 25.4565 83.2993 Constraint 44 241 13.6657 17.0821 25.6231 83.2993 Constraint 44 233 9.0614 11.3268 16.9902 83.2993 Constraint 44 221 12.0407 15.0509 22.5763 83.2993 Constraint 44 148 11.6583 14.5729 21.8593 83.2993 Constraint 44 142 13.2331 16.5414 24.8121 83.2993 Constraint 44 134 9.2209 11.5261 17.2892 83.2993 Constraint 44 122 9.0145 11.2681 16.9022 83.2993 Constraint 58 472 15.6243 19.5304 29.2956 83.2932 Constraint 257 443 16.8374 21.0467 31.5701 83.2247 Constraint 122 207 14.2921 17.8652 26.7977 82.6204 Constraint 207 291 17.5046 21.8807 32.8211 82.5927 Constraint 388 559 16.1987 20.2483 30.3725 82.4554 Constraint 35 588 5.8098 7.2622 10.8933 82.2993 Constraint 35 581 9.3311 11.6638 17.4957 82.2993 Constraint 35 552 12.3741 15.4676 23.2014 82.2993 Constraint 35 526 12.8572 16.0715 24.1073 82.2993 Constraint 35 518 13.4453 16.8066 25.2099 82.2993 Constraint 35 504 16.6017 20.7521 31.1282 82.2993 Constraint 35 497 13.8304 17.2880 25.9321 82.2993 Constraint 35 488 16.9136 21.1420 31.7130 82.2993 Constraint 35 472 17.5619 21.9524 32.9286 82.2993 Constraint 35 456 14.6986 18.3732 27.5598 82.2993 Constraint 35 435 11.2234 14.0292 21.0438 82.2993 Constraint 35 429 11.2130 14.0162 21.0243 82.2993 Constraint 35 418 11.4647 14.3308 21.4963 82.2993 Constraint 35 406 9.4298 11.7873 17.6809 82.2993 Constraint 35 399 9.3003 11.6254 17.4381 82.2993 Constraint 35 388 8.0400 10.0500 15.0750 82.2993 Constraint 35 380 9.1615 11.4519 17.1778 82.2993 Constraint 35 371 10.3887 12.9859 19.4789 82.2993 Constraint 35 363 9.2696 11.5869 17.3804 82.2993 Constraint 35 354 14.2495 17.8118 26.7178 82.2993 Constraint 35 349 11.0377 13.7971 20.6957 82.2993 Constraint 35 342 8.9646 11.2057 16.8086 82.2993 Constraint 35 323 9.0565 11.3206 16.9810 82.2993 Constraint 35 305 11.2206 14.0257 21.0385 82.2993 Constraint 35 298 12.3538 15.4423 23.1634 82.2993 Constraint 35 291 14.8369 18.5461 27.8192 82.2993 Constraint 35 264 16.6108 20.7635 31.1453 82.2993 Constraint 35 257 13.6147 17.0184 25.5276 82.2993 Constraint 35 248 16.6542 20.8177 31.2266 82.2993 Constraint 35 241 16.1543 20.1929 30.2894 82.2993 Constraint 35 233 11.5443 14.4304 21.6455 82.2993 Constraint 35 221 13.5344 16.9180 25.3771 82.2993 Constraint 35 148 13.8503 17.3129 25.9693 82.2993 Constraint 35 142 16.1820 20.2275 30.3413 82.2993 Constraint 35 134 12.4720 15.5901 23.3851 82.2993 Constraint 35 122 12.2045 15.2556 22.8834 82.2993 Constraint 44 283 14.1900 17.7375 26.6063 82.2993 Constraint 97 399 14.6810 18.3512 27.5268 82.2922 Constraint 97 380 16.2612 20.3265 30.4897 82.2922 Constraint 97 342 13.8388 17.2985 25.9478 82.2922 Constraint 97 323 13.0887 16.3609 24.5413 82.2922 Constraint 97 305 10.9073 13.6341 20.4511 82.2922 Constraint 97 275 12.5341 15.6677 23.5015 82.2922 Constraint 97 264 9.8068 12.2586 18.3878 82.2922 Constraint 97 257 12.9344 16.1680 24.2520 82.2922 Constraint 97 248 14.0156 17.5194 26.2792 82.2922 Constraint 97 233 15.0592 18.8240 28.2359 82.2922 Constraint 92 342 14.2439 17.8049 26.7073 82.2922 Constraint 92 257 14.0917 17.6146 26.4219 82.2922 Constraint 92 248 15.7998 19.7497 29.6246 82.2922 Constraint 92 233 16.0971 20.1214 30.1821 82.2922 Constraint 92 509 15.2974 19.1217 28.6826 82.2872 Constraint 92 504 14.7781 18.4726 27.7089 82.2872 Constraint 92 497 16.6409 20.8011 31.2017 82.2872 Constraint 207 310 17.1528 21.4410 32.1614 82.2137 Constraint 207 543 15.7620 19.7025 29.5537 82.1013 Constraint 429 559 15.3205 19.1507 28.7260 82.0340 Constraint 472 572 17.5908 21.9885 32.9828 82.0091 Constraint 213 559 16.0114 20.0143 30.0214 81.9719 Constraint 148 603 11.2259 14.0323 21.0485 81.9205 Constraint 142 603 14.4728 18.0910 27.1365 81.9205 Constraint 134 603 11.4599 14.3249 21.4874 81.9205 Constraint 122 603 11.4806 14.3508 21.5262 81.9205 Constraint 148 207 7.9873 9.9841 14.9762 81.9203 Constraint 142 207 11.7144 14.6431 21.9646 81.9203 Constraint 134 207 11.9958 14.9947 22.4921 81.9203 Constraint 465 603 14.5212 18.1515 27.2273 81.6245 Constraint 35 543 16.0658 20.0823 30.1234 81.2993 Constraint 35 509 17.3902 21.7378 32.6067 81.2993 Constraint 44 275 14.4910 18.1137 27.1706 81.2993 Constraint 106 588 13.5675 16.9594 25.4391 81.2957 Constraint 106 581 9.2181 11.5227 17.2840 81.2957 Constraint 106 518 12.3767 15.4708 23.2062 81.2957 Constraint 106 504 10.9661 13.7076 20.5614 81.2957 Constraint 106 497 13.3013 16.6266 24.9399 81.2957 Constraint 106 481 15.0879 18.8598 28.2898 81.2957 Constraint 106 472 15.0493 18.8116 28.2174 81.2957 Constraint 106 435 15.7438 19.6798 29.5196 81.2957 Constraint 106 399 12.6185 15.7731 23.6596 81.2957 Constraint 106 380 13.9352 17.4190 26.1285 81.2957 Constraint 106 363 15.3851 19.2314 28.8471 81.2957 Constraint 106 354 15.0252 18.7816 28.1723 81.2957 Constraint 106 349 15.5243 19.4054 29.1081 81.2957 Constraint 106 342 11.9402 14.9253 22.3879 81.2957 Constraint 106 323 11.7918 14.7398 22.1097 81.2957 Constraint 106 305 9.0248 11.2810 16.9214 81.2957 Constraint 106 291 7.2711 9.0888 13.6332 81.2957 Constraint 106 275 11.3639 14.2049 21.3074 81.2957 Constraint 106 264 8.0317 10.0397 15.0595 81.2957 Constraint 106 257 10.9320 13.6650 20.4974 81.2957 Constraint 106 248 11.7994 14.7493 22.1239 81.2957 Constraint 106 241 13.6148 17.0185 25.5278 81.2957 Constraint 106 233 12.6812 15.8515 23.7773 81.2957 Constraint 106 221 15.9967 19.9958 29.9937 81.2957 Constraint 58 559 9.4133 11.7666 17.6499 81.2932 Constraint 51 559 10.6094 13.2617 19.8926 81.2932 Constraint 58 572 5.8885 7.3606 11.0409 81.2932 Constraint 51 572 5.8657 7.3321 10.9982 81.2932 Constraint 97 241 16.0241 20.0302 30.0453 81.2922 Constraint 207 465 8.8575 11.0719 16.6078 81.2872 Constraint 363 559 17.2666 21.5832 32.3748 81.2458 Constraint 349 481 18.4579 23.0724 34.6086 81.2128 Constraint 44 465 17.8574 22.3217 33.4826 81.1993 Constraint 66 559 8.1252 10.1565 15.2348 80.7004 Constraint 66 572 4.8196 6.0245 9.0367 80.7004 Constraint 257 465 17.4243 21.7803 32.6705 80.6245 Constraint 291 488 17.6781 22.0976 33.1464 80.6039 Constraint 323 509 17.2699 21.5874 32.3810 80.6039 Constraint 481 559 15.7290 19.6612 29.4919 80.5837 Constraint 456 603 10.6336 13.2920 19.9381 80.5030 Constraint 207 456 7.3375 9.1719 13.7579 80.5028 Constraint 207 603 10.0314 12.5392 18.8088 80.5017 Constraint 44 559 13.1658 16.4573 24.6860 80.2993 Constraint 51 443 15.4963 19.3704 29.0556 80.2993 Constraint 44 443 13.3863 16.7329 25.0993 80.2993 Constraint 35 534 16.5757 20.7196 31.0794 80.2993 Constraint 66 315 7.5671 9.4588 14.1882 80.2993 Constraint 66 310 9.9596 12.4495 18.6743 80.2993 Constraint 58 315 7.3820 9.2276 13.8413 80.2993 Constraint 58 310 8.6530 10.8162 16.2244 80.2993 Constraint 51 315 9.2707 11.5884 17.3826 80.2993 Constraint 51 310 11.0943 13.8679 20.8018 80.2993 Constraint 44 572 9.0899 11.3624 17.0436 80.2993 Constraint 44 315 9.4421 11.8027 17.7040 80.2993 Constraint 44 310 10.0702 12.5877 18.8816 80.2993 Constraint 97 588 14.7926 18.4908 27.7361 80.2993 Constraint 97 581 10.5859 13.2324 19.8486 80.2993 Constraint 97 552 10.3576 12.9470 19.4204 80.2993 Constraint 97 526 11.0266 13.7833 20.6749 80.2993 Constraint 97 518 14.3176 17.8970 26.8455 80.2993 Constraint 97 509 14.2892 17.8615 26.7922 80.2993 Constraint 97 504 13.2876 16.6095 24.9142 80.2993 Constraint 97 406 14.5662 18.2077 27.3116 80.2993 Constraint 97 298 7.9764 9.9705 14.9558 80.2993 Constraint 97 291 8.4914 10.6142 15.9213 80.2993 Constraint 97 283 10.5543 13.1929 19.7893 80.2993 Constraint 92 588 13.8591 17.3238 25.9857 80.2993 Constraint 92 581 10.0173 12.5216 18.7824 80.2993 Constraint 92 552 10.0245 12.5306 18.7958 80.2993 Constraint 92 526 11.7459 14.6824 22.0236 80.2993 Constraint 92 518 14.7119 18.3899 27.5849 80.2993 Constraint 92 406 13.9119 17.3898 26.0848 80.2993 Constraint 92 399 14.5616 18.2021 27.3031 80.2993 Constraint 92 323 12.4942 15.6178 23.4266 80.2993 Constraint 92 305 11.2121 14.0151 21.0226 80.2993 Constraint 92 298 7.8291 9.7864 14.6796 80.2993 Constraint 92 291 9.3650 11.7063 17.5594 80.2993 Constraint 92 283 11.2952 14.1190 21.1785 80.2993 Constraint 92 275 13.6323 17.0404 25.5606 80.2993 Constraint 92 264 11.2253 14.0316 21.0474 80.2993 Constraint 106 552 8.8153 11.0192 16.5288 80.2993 Constraint 106 526 8.7258 10.9072 16.3608 80.2993 Constraint 106 509 12.3414 15.4267 23.1401 80.2993 Constraint 106 406 13.1215 16.4019 24.6029 80.2993 Constraint 106 298 6.8591 8.5738 12.8608 80.2993 Constraint 106 283 9.9816 12.4771 18.7156 80.2993 Constraint 106 310 10.7597 13.4497 20.1745 80.2957 Constraint 84 380 15.1664 18.9580 28.4370 80.2837 Constraint 84 233 14.5062 18.1327 27.1991 80.2837 Constraint 388 633 9.1277 11.4096 17.1144 80.0947 Constraint 380 633 9.4501 11.8126 17.7190 80.0947 Constraint 349 633 6.9279 8.6598 12.9898 80.0947 Constraint 233 633 8.9736 11.2170 16.8255 80.0947 Constraint 221 633 9.2041 11.5051 17.2577 80.0947 Constraint 241 572 17.9687 22.4608 33.6913 79.9629 Constraint 75 148 12.5423 15.6779 23.5168 79.7376 Constraint 75 142 12.3744 15.4680 23.2021 79.7376 Constraint 106 572 10.7788 13.4735 20.2103 79.7004 Constraint 323 472 17.3291 21.6614 32.4921 79.4002 Constraint 173 497 11.2740 14.0925 21.1388 79.3901 Constraint 173 488 11.6178 14.5223 21.7834 79.3901 Constraint 173 443 10.1004 12.6255 18.9382 79.3901 Constraint 173 435 11.2787 14.0984 21.1476 79.3901 Constraint 173 429 13.1624 16.4530 24.6796 79.3901 Constraint 173 399 15.3350 19.1687 28.7531 79.3901 Constraint 173 388 12.6948 15.8685 23.8027 79.3901 Constraint 173 380 12.5001 15.6251 23.4376 79.3901 Constraint 173 371 11.0946 13.8682 20.8023 79.3901 Constraint 173 363 14.5141 18.1427 27.2140 79.3901 Constraint 168 518 13.8367 17.2958 25.9438 79.3901 Constraint 168 504 12.0535 15.0669 22.6004 79.3901 Constraint 168 497 10.0209 12.5261 18.7891 79.3901 Constraint 168 488 10.5629 13.2036 19.8054 79.3901 Constraint 168 481 10.4147 13.0184 19.5276 79.3901 Constraint 168 443 9.9670 12.4588 18.6882 79.3901 Constraint 168 435 10.4326 13.0408 19.5612 79.3901 Constraint 168 429 12.8627 16.0784 24.1176 79.3901 Constraint 168 399 14.3254 17.9067 26.8601 79.3901 Constraint 168 388 12.3450 15.4313 23.1469 79.3901 Constraint 168 380 11.5011 14.3764 21.5646 79.3901 Constraint 168 371 10.4788 13.0986 19.6478 79.3901 Constraint 168 363 13.5717 16.9646 25.4469 79.3901 Constraint 168 241 11.6034 14.5042 21.7563 79.3901 Constraint 58 443 15.6923 19.6154 29.4231 79.2993 Constraint 35 443 12.5165 15.6457 23.4685 79.2993 Constraint 35 572 10.4724 13.0905 19.6358 79.2993 Constraint 35 315 12.8042 16.0052 24.0078 79.2993 Constraint 35 310 13.6323 17.0403 25.5605 79.2993 Constraint 97 543 12.1255 15.1569 22.7354 79.2993 Constraint 97 534 9.9800 12.4750 18.7125 79.2993 Constraint 92 543 12.3221 15.4026 23.1040 79.2993 Constraint 92 534 10.9857 13.7321 20.5981 79.2993 Constraint 106 315 10.7210 13.4012 20.1018 79.2993 Constraint 106 418 15.8905 19.8631 29.7946 79.2957 Constraint 66 488 17.6054 22.0067 33.0100 79.2933 Constraint 75 588 9.2754 11.5943 17.3914 79.2932 Constraint 75 581 5.5587 6.9484 10.4226 79.2932 Constraint 75 552 6.5788 8.2235 12.3353 79.2932 Constraint 75 543 10.0999 12.6248 18.9373 79.2932 Constraint 75 534 9.2040 11.5049 17.2574 79.2932 Constraint 75 526 8.4226 10.5282 15.7923 79.2932 Constraint 75 518 11.2799 14.0999 21.1499 79.2932 Constraint 75 509 12.9173 16.1466 24.2199 79.2932 Constraint 75 504 12.2913 15.3642 23.0462 79.2932 Constraint 75 497 13.1642 16.4553 24.6829 79.2932 Constraint 75 406 9.7172 12.1465 18.2197 79.2932 Constraint 75 399 10.1970 12.7462 19.1193 79.2932 Constraint 75 380 12.5239 15.6549 23.4823 79.2932 Constraint 75 354 15.6311 19.5389 29.3084 79.2932 Constraint 75 349 14.7220 18.4025 27.6037 79.2932 Constraint 75 342 10.4715 13.0894 19.6341 79.2932 Constraint 75 305 8.1013 10.1267 15.1900 79.2932 Constraint 75 298 5.2647 6.5809 9.8714 79.2932 Constraint 75 275 13.1561 16.4451 24.6677 79.2932 Constraint 75 264 10.3803 12.9754 19.4631 79.2932 Constraint 75 257 11.6202 14.5253 21.7879 79.2932 Constraint 75 233 12.6325 15.7907 23.6860 79.2932 Constraint 97 497 15.6420 19.5524 29.3287 79.2922 Constraint 97 310 12.2869 15.3586 23.0379 79.2922 Constraint 84 526 11.0640 13.8301 20.7451 79.2872 Constraint 84 518 14.0790 17.5987 26.3981 79.2872 Constraint 84 509 15.1123 18.8904 28.3356 79.2872 Constraint 84 504 14.3342 17.9177 26.8766 79.2872 Constraint 84 497 15.7098 19.6373 29.4559 79.2872 Constraint 84 399 13.2162 16.5203 24.7805 79.2872 Constraint 342 633 8.9864 11.2329 16.8494 79.2210 Constraint 354 633 9.1156 11.3945 17.0918 79.0947 Constraint 257 633 11.6081 14.5101 21.7652 79.0947 Constraint 173 472 9.0923 11.3653 17.0480 78.9890 Constraint 168 509 13.9205 17.4006 26.1009 78.9890 Constraint 168 472 7.7085 9.6356 14.4534 78.9890 Constraint 399 625 11.3326 14.1657 21.2486 78.9684 Constraint 388 625 5.6131 7.0164 10.5245 78.9684 Constraint 380 625 7.3890 9.2363 13.8544 78.9684 Constraint 354 625 10.8764 13.5956 20.3933 78.9684 Constraint 349 625 9.1312 11.4140 17.1211 78.9684 Constraint 305 625 12.9764 16.2205 24.3307 78.9684 Constraint 257 625 13.0658 16.3323 24.4985 78.9684 Constraint 233 625 9.0974 11.3717 17.0576 78.9684 Constraint 221 625 8.4379 10.5473 15.8210 78.9684 Constraint 497 613 10.9035 13.6293 20.4440 78.8686 Constraint 399 613 9.0328 11.2910 16.9365 78.8686 Constraint 388 613 6.0981 7.6227 11.4340 78.8686 Constraint 380 613 5.4712 6.8390 10.2586 78.8686 Constraint 354 613 9.1117 11.3897 17.0845 78.8686 Constraint 349 613 6.9772 8.7215 13.0823 78.8686 Constraint 305 613 9.3539 11.6923 17.5385 78.8686 Constraint 257 613 9.9927 12.4909 18.7363 78.8686 Constraint 233 613 6.7044 8.3805 12.5707 78.8686 Constraint 221 613 7.9634 9.9542 14.9314 78.8686 Constraint 84 148 14.5001 18.1252 27.1878 78.7376 Constraint 168 526 14.4177 18.0222 27.0332 78.6900 Constraint 58 481 16.7885 20.9856 31.4784 78.5303 Constraint 472 559 16.6361 20.7951 31.1926 78.4545 Constraint 35 559 14.5783 18.2229 27.3343 78.2993 Constraint 75 363 14.2902 17.8628 26.7942 78.2993 Constraint 75 323 8.9368 11.1710 16.7565 78.2993 Constraint 75 291 7.9922 9.9902 14.9853 78.2993 Constraint 75 283 11.2340 14.0425 21.0638 78.2993 Constraint 75 248 13.8814 17.3517 26.0276 78.2993 Constraint 75 241 15.3410 19.1763 28.7644 78.2993 Constraint 84 342 12.0662 15.0828 22.6242 78.2957 Constraint 84 257 12.3174 15.3968 23.0951 78.2957 Constraint 84 248 14.5534 18.1918 27.2877 78.2957 Constraint 106 488 15.5618 19.4523 29.1785 78.2957 Constraint 66 213 15.6824 19.6030 29.4046 78.2932 Constraint 58 213 12.5743 15.7179 23.5768 78.2932 Constraint 51 213 13.8665 17.3332 25.9997 78.2932 Constraint 75 488 15.6670 19.5837 29.3756 78.2932 Constraint 75 429 16.6542 20.8178 31.2267 78.2932 Constraint 75 418 13.4251 16.7814 25.1721 78.2932 Constraint 75 388 15.5876 19.4845 29.2267 78.2932 Constraint 75 221 16.1457 20.1822 30.2733 78.2932 Constraint 66 595 8.9560 11.1950 16.7924 78.2932 Constraint 58 595 5.6990 7.1237 10.6855 78.2932 Constraint 51 595 5.9601 7.4501 11.1752 78.2932 Constraint 371 633 6.6488 8.3111 12.4666 78.1068 Constraint 363 633 5.5537 6.9421 10.4132 78.1068 Constraint 305 633 12.2141 15.2676 22.9014 78.0947 Constraint 497 633 14.5795 18.2243 27.3365 77.9947 Constraint 497 625 12.3757 15.4697 23.2045 77.9684 Constraint 264 613 13.6859 17.1074 25.6611 77.8686 Constraint 526 613 11.3151 14.1438 21.2158 77.8686 Constraint 518 613 12.4903 15.6129 23.4194 77.8686 Constraint 406 613 11.3926 14.2408 21.3611 77.8686 Constraint 106 559 9.5036 11.8796 17.8193 77.7004 Constraint 173 354 15.8644 19.8305 29.7458 77.3901 Constraint 173 248 16.5679 20.7099 31.0648 77.3901 Constraint 168 354 14.5125 18.1406 27.2110 77.3901 Constraint 168 342 16.8045 21.0056 31.5084 77.3901 Constraint 168 248 14.9064 18.6329 27.9494 77.3901 Constraint 44 213 11.7480 14.6850 22.0275 77.2993 Constraint 97 559 9.6190 12.0238 18.0356 77.2993 Constraint 92 559 8.4364 10.5455 15.8182 77.2993 Constraint 75 435 14.2652 17.8315 26.7473 77.2993 Constraint 75 371 16.5924 20.7405 31.1107 77.2993 Constraint 84 588 11.9509 14.9386 22.4079 77.2993 Constraint 84 581 8.3353 10.4191 15.6287 77.2993 Constraint 84 552 9.2580 11.5725 17.3588 77.2993 Constraint 84 543 12.2737 15.3421 23.0131 77.2993 Constraint 84 534 10.9518 13.6898 20.5346 77.2993 Constraint 84 406 12.5909 15.7386 23.6079 77.2993 Constraint 84 323 10.1248 12.6560 18.9840 77.2993 Constraint 84 305 9.1327 11.4159 17.1239 77.2993 Constraint 84 298 5.6342 7.0427 10.5641 77.2993 Constraint 84 291 7.6409 9.5512 14.3267 77.2993 Constraint 84 283 9.9307 12.4134 18.6200 77.2993 Constraint 84 275 12.3055 15.3819 23.0729 77.2993 Constraint 84 264 10.0275 12.5344 18.8016 77.2993 Constraint 44 595 4.3337 5.4171 8.1256 77.2993 Constraint 106 543 10.7857 13.4822 20.2233 77.2993 Constraint 106 534 8.1211 10.1513 15.2270 77.2993 Constraint 97 572 11.1709 13.9637 20.9455 77.2993 Constraint 97 315 11.5962 14.4952 21.7428 77.2993 Constraint 92 572 9.5269 11.9086 17.8629 77.2993 Constraint 92 315 11.1649 13.9561 20.9342 77.2993 Constraint 92 310 12.5849 15.7311 23.5967 77.2993 Constraint 84 349 16.0182 20.0228 30.0342 77.2957 Constraint 106 595 12.3119 15.3898 23.0848 77.2957 Constraint 429 625 10.7870 13.4837 20.2256 77.2210 Constraint 342 625 9.8252 12.2815 18.4223 77.2210 Constraint 429 613 10.9680 13.7100 20.5651 77.1212 Constraint 342 613 6.3124 7.8906 11.8358 77.1212 Constraint 298 613 12.2592 15.3240 22.9860 77.1212 Constraint 248 633 13.3361 16.6702 25.0052 77.1068 Constraint 241 633 12.1245 15.1556 22.7334 77.1068 Constraint 435 633 12.6975 15.8719 23.8078 77.1068 Constraint 399 633 13.4721 16.8401 25.2602 77.0947 Constraint 275 472 17.8381 22.2977 33.4465 77.0093 Constraint 435 625 9.7221 12.1526 18.2289 76.9804 Constraint 371 625 4.4713 5.5891 8.3837 76.9804 Constraint 363 625 6.0172 7.5215 11.2823 76.9804 Constraint 241 625 12.5337 15.6672 23.5007 76.9804 Constraint 435 613 8.9858 11.2323 16.8484 76.8806 Constraint 371 613 5.3372 6.6716 10.0073 76.8806 Constraint 363 613 4.0956 5.1195 7.6792 76.8806 Constraint 248 613 12.0418 15.0523 22.5784 76.8806 Constraint 241 613 10.9149 13.6436 20.4655 76.8806 Constraint 275 613 15.3025 19.1281 28.6921 76.8686 Constraint 504 613 13.5882 16.9853 25.4779 76.8686 Constraint 456 559 15.1698 18.9622 28.4433 76.7005 Constraint 472 613 13.3000 16.6250 24.9375 76.6651 Constraint 291 456 17.8296 22.2870 33.4305 76.5030 Constraint 298 443 18.3175 22.8968 34.3453 76.3038 Constraint 35 213 12.8281 16.0351 24.0527 76.2993 Constraint 35 595 6.0111 7.5139 11.2709 76.2993 Constraint 51 472 17.4594 21.8243 32.7364 76.2933 Constraint 97 595 14.4539 18.0673 27.1010 76.2922 Constraint 92 595 14.2801 17.8501 26.7752 76.2922 Constraint 283 497 18.1084 22.6355 33.9533 76.2249 Constraint 429 633 14.1495 17.6868 26.5303 76.2210 Constraint 418 613 12.0536 15.0670 22.6006 76.1212 Constraint 213 633 11.5126 14.3908 21.5861 76.0947 Constraint 248 625 14.3639 17.9548 26.9322 75.9805 Constraint 264 625 16.9145 21.1431 31.7147 75.9684 Constraint 488 613 14.2767 17.8458 26.7688 75.8687 Constraint 173 456 9.7847 12.2309 18.3463 75.7006 Constraint 168 456 8.9460 11.1825 16.7738 75.7006 Constraint 75 559 6.7143 8.3928 12.5892 75.7004 Constraint 75 572 5.9300 7.4126 11.1188 75.7004 Constraint 173 465 8.3304 10.4130 15.6194 75.2994 Constraint 168 465 7.4246 9.2808 13.9212 75.2994 Constraint 75 315 9.0225 11.2781 16.9172 75.2993 Constraint 75 310 10.4068 13.0086 19.5128 75.2993 Constraint 66 456 17.4763 21.8454 32.7681 75.2993 Constraint 106 213 14.9029 18.6286 27.9429 75.2957 Constraint 84 363 16.0814 20.1017 30.1526 75.2957 Constraint 66 603 12.5449 15.6811 23.5217 75.2935 Constraint 58 603 9.4449 11.8061 17.7091 75.2935 Constraint 51 603 8.0618 10.0773 15.1159 75.2935 Constraint 51 207 16.2925 20.3656 30.5484 75.2932 Constraint 323 625 13.1093 16.3866 24.5799 75.2331 Constraint 323 633 11.9729 14.9662 22.4493 75.2331 Constraint 323 613 9.5765 11.9706 17.9558 75.1333 Constraint 418 633 16.1524 20.1905 30.2857 75.1210 Constraint 443 633 12.8450 16.0562 24.0843 75.1068 Constraint 264 633 15.7156 19.6445 29.4668 75.1008 Constraint 443 625 9.3134 11.6418 17.4627 74.9804 Constraint 310 625 15.2513 19.0642 28.5962 74.9804 Constraint 526 625 13.9817 17.4771 26.2157 74.9744 Constraint 213 625 9.3898 11.7373 17.6059 74.9684 Constraint 406 625 13.5317 16.9146 25.3719 74.9684 Constraint 443 613 10.3881 12.9852 19.4777 74.8806 Constraint 213 613 8.5985 10.7481 16.1221 74.8686 Constraint 472 633 16.0010 20.0013 30.0019 74.7912 Constraint 349 465 18.1573 22.6966 34.0449 74.6245 Constraint 173 481 11.1611 13.9513 20.9270 74.4007 Constraint 323 443 17.2204 21.5255 32.2882 74.3037 Constraint 526 633 15.4771 19.3464 29.0197 74.3006 Constraint 44 603 5.9714 7.4642 11.1963 74.2995 Constraint 44 207 13.6535 17.0669 25.6003 74.2993 Constraint 84 559 8.3174 10.3968 15.5951 74.2993 Constraint 75 456 16.1468 20.1835 30.2752 74.2993 Constraint 84 572 7.9679 9.9599 14.9398 74.2993 Constraint 84 315 8.9911 11.2388 16.8582 74.2993 Constraint 84 310 10.5218 13.1522 19.7283 74.2993 Constraint 58 207 15.5871 19.4839 29.2258 74.2932 Constraint 298 633 15.2913 19.1141 28.6712 74.2271 Constraint 291 613 13.1453 16.4316 24.6474 74.1333 Constraint 194 504 13.7543 17.1929 25.7893 74.0784 Constraint 194 481 12.5271 15.6588 23.4883 74.0784 Constraint 173 518 14.6337 18.2921 27.4381 73.9995 Constraint 173 504 13.0403 16.3003 24.4505 73.9995 Constraint 406 633 15.7629 19.7037 29.5555 73.9948 Constraint 283 371 18.4041 23.0051 34.5077 73.9247 Constraint 310 613 11.8369 14.7962 22.1942 73.8806 Constraint 472 625 14.0635 17.5794 26.3691 73.7649 Constraint 168 418 14.4330 18.0412 27.0618 73.3901 Constraint 173 418 15.2402 19.0503 28.5754 73.3901 Constraint 194 518 14.3597 17.9496 26.9245 73.3783 Constraint 194 497 10.7868 13.4835 20.2252 73.3783 Constraint 194 488 11.5746 14.4683 21.7024 73.3783 Constraint 194 429 11.2608 14.0760 21.1140 73.3783 Constraint 194 399 14.0064 17.5081 26.2621 73.3783 Constraint 194 388 10.3870 12.9838 19.4757 73.3783 Constraint 194 380 10.9440 13.6800 20.5199 73.3783 Constraint 35 603 4.6062 5.7578 8.6367 73.2995 Constraint 173 526 15.4567 19.3209 28.9814 73.2994 Constraint 35 283 17.6494 22.0618 33.0927 73.2994 Constraint 35 207 13.8914 17.3642 26.0464 73.2993 Constraint 84 435 16.9817 21.2271 31.8406 73.2957 Constraint 75 595 9.5356 11.9194 17.8792 73.2932 Constraint 84 418 16.2060 20.2575 30.3862 73.2872 Constraint 349 509 18.4345 23.0431 34.5646 73.2250 Constraint 418 625 13.0313 16.2891 24.4337 73.2210 Constraint 58 465 17.4746 21.8432 32.7648 73.1933 Constraint 310 633 13.4152 16.7691 25.1536 73.1068 Constraint 194 472 9.6137 12.0171 18.0257 72.9771 Constraint 481 613 16.0055 20.0068 30.0103 72.8687 Constraint 291 625 16.7373 20.9216 31.3824 72.8320 Constraint 518 633 16.6543 20.8179 31.2269 72.3006 Constraint 75 213 14.5757 18.2197 27.3295 72.2932 Constraint 291 633 15.5896 19.4870 29.2305 72.2332 Constraint 298 625 15.8563 19.8204 29.7306 72.2211 Constraint 75 481 16.0992 20.1240 30.1860 72.1932 Constraint 75 472 15.8662 19.8328 29.7491 72.1932 Constraint 148 633 12.5946 15.7432 23.6148 72.1730 Constraint 315 613 12.9411 16.1764 24.2646 72.1333 Constraint 194 509 15.1943 18.9929 28.4893 72.0784 Constraint 148 625 11.6931 14.6163 21.9245 72.0467 Constraint 134 625 12.5066 15.6333 23.4499 72.0467 Constraint 518 625 14.0692 17.5865 26.3797 71.9744 Constraint 148 613 9.6379 12.0474 18.0711 71.9469 Constraint 142 613 11.8922 14.8653 22.2979 71.9469 Constraint 134 613 9.1970 11.4962 17.2443 71.9469 Constraint 122 613 10.9946 13.7433 20.6149 71.9469 Constraint 207 633 10.4446 13.0557 19.5835 71.7577 Constraint 207 613 9.0369 11.2961 16.9442 71.5315 Constraint 456 613 12.3293 15.4117 23.1175 71.4030 Constraint 194 435 9.8833 12.3541 18.5311 71.3904 Constraint 194 371 9.2405 11.5506 17.3259 71.3904 Constraint 168 349 16.2714 20.3392 30.5088 71.3901 Constraint 168 257 17.0016 21.2520 31.8780 71.3901 Constraint 24 588 10.7082 13.3852 20.0778 71.2996 Constraint 24 526 15.2361 19.0451 28.5677 71.2996 Constraint 24 497 14.2741 17.8426 26.7638 71.2996 Constraint 24 456 14.2204 17.7754 26.6632 71.2996 Constraint 24 435 11.0444 13.8055 20.7082 71.2996 Constraint 24 429 10.6784 13.3480 20.0220 71.2996 Constraint 24 418 13.0690 16.3363 24.5044 71.2996 Constraint 24 406 13.0334 16.2918 24.4377 71.2996 Constraint 24 399 11.5867 14.4834 21.7251 71.2996 Constraint 24 388 6.2371 7.7964 11.6946 71.2996 Constraint 24 380 9.2495 11.5619 17.3428 71.2996 Constraint 24 371 7.8713 9.8391 14.7586 71.2996 Constraint 24 363 8.3729 10.4661 15.6992 71.2996 Constraint 24 354 13.6778 17.0972 25.6458 71.2996 Constraint 24 349 10.8223 13.5279 20.2918 71.2996 Constraint 24 342 10.8841 13.6052 20.4078 71.2996 Constraint 24 323 12.9905 16.2381 24.3571 71.2996 Constraint 24 305 14.1462 17.6827 26.5241 71.2996 Constraint 24 257 15.1491 18.9363 28.4045 71.2996 Constraint 24 233 11.6819 14.6023 21.9035 71.2996 Constraint 24 221 11.9622 14.9528 22.4292 71.2996 Constraint 24 148 14.2689 17.8361 26.7542 71.2996 Constraint 24 134 14.3712 17.9640 26.9460 71.2996 Constraint 24 122 15.5846 19.4808 29.2211 71.2996 Constraint 84 595 12.1963 15.2453 22.8680 71.2993 Constraint 106 603 16.5407 20.6759 31.0138 71.2960 Constraint 194 418 14.0499 17.5623 26.3435 71.2783 Constraint 315 625 16.5052 20.6315 30.9473 71.2331 Constraint 315 633 14.9372 18.6715 28.0072 71.2331 Constraint 283 613 16.0337 20.0421 30.0632 71.1805 Constraint 142 633 14.0981 17.6226 26.4339 71.1730 Constraint 134 633 12.1164 15.1455 22.7182 71.1730 Constraint 283 406 18.5082 23.1353 34.7029 71.1351 Constraint 488 625 14.8951 18.6189 27.9283 70.8745 Constraint 194 526 15.1716 18.9645 28.4467 70.6782 Constraint 207 625 7.9602 9.9502 14.9254 70.6314 Constraint 504 625 15.3399 19.1748 28.7622 70.5733 Constraint 481 625 17.0553 21.3192 31.9787 70.4733 Constraint 275 633 16.2345 20.2931 30.4397 70.4007 Constraint 24 581 13.5616 16.9521 25.4281 70.2996 Constraint 24 518 15.2180 19.0225 28.5337 70.2996 Constraint 24 248 17.2490 21.5613 32.3419 70.2996 Constraint 24 241 15.7292 19.6616 29.4923 70.2996 Constraint 24 298 16.4110 20.5138 30.7706 70.2996 Constraint 35 106 16.9747 21.2184 31.8276 70.2994 Constraint 75 603 13.5194 16.8992 25.3488 70.2935 Constraint 168 595 15.6491 19.5614 29.3421 70.2888 Constraint 504 633 17.1257 21.4072 32.1107 69.8995 Constraint 509 613 15.1842 18.9802 28.4704 69.8747 Constraint 114 509 11.5146 14.3933 21.5899 69.7575 Constraint 114 518 11.2352 14.0440 21.0660 69.4205 Constraint 114 504 9.4529 11.8161 17.7241 69.4205 Constraint 114 497 11.6149 14.5186 21.7779 69.4205 Constraint 114 488 14.4343 18.0429 27.0643 69.4205 Constraint 114 481 13.7913 17.2392 25.8587 69.4205 Constraint 114 472 13.3009 16.6261 24.9391 69.4205 Constraint 114 435 14.1783 17.7229 26.5843 69.4205 Constraint 114 406 12.4668 15.5834 23.3752 69.4205 Constraint 114 399 11.2719 14.0899 21.1348 69.4205 Constraint 114 388 16.4016 20.5020 30.7530 69.4205 Constraint 114 380 12.1266 15.1582 22.7373 69.4205 Constraint 114 371 15.9297 19.9121 29.8682 69.4205 Constraint 114 363 13.6923 17.1154 25.6731 69.4205 Constraint 114 354 13.2214 16.5267 24.7901 69.4205 Constraint 114 349 13.9757 17.4697 26.2045 69.4205 Constraint 114 305 7.3258 9.1573 13.7360 69.4205 Constraint 114 283 9.6121 12.0152 18.0227 69.4205 Constraint 114 275 10.2398 12.7998 19.1997 69.4205 Constraint 114 264 6.4638 8.0798 12.1197 69.4205 Constraint 114 257 9.2024 11.5030 17.2544 69.4205 Constraint 114 248 9.8601 12.3252 18.4878 69.4205 Constraint 114 241 11.6846 14.6058 21.9086 69.4205 Constraint 114 233 10.7543 13.4429 20.1643 69.4205 Constraint 114 221 14.1552 17.6940 26.5410 69.4205 Constraint 456 633 15.4235 19.2793 28.9190 69.4028 Constraint 194 443 7.9866 9.9832 14.9748 69.3904 Constraint 194 363 12.8869 16.1087 24.1630 69.3904 Constraint 194 354 14.9450 18.6812 28.0219 69.3783 Constraint 194 349 16.2486 20.3107 30.4660 69.3783 Constraint 200 497 9.4719 11.8399 17.7598 69.3783 Constraint 200 429 10.5616 13.2020 19.8030 69.3783 Constraint 200 418 13.2256 16.5320 24.7981 69.3783 Constraint 200 399 12.7565 15.9456 23.9184 69.3783 Constraint 200 388 9.6234 12.0293 18.0439 69.3783 Constraint 200 380 9.6647 12.0809 18.1213 69.3783 Constraint 24 443 10.1855 12.7318 19.0978 69.2996 Constraint 24 142 17.0592 21.3240 31.9860 69.2996 Constraint 465 559 17.2279 21.5349 32.3024 69.2995 Constraint 194 465 9.1400 11.4250 17.1374 69.2876 Constraint 465 613 15.1445 18.9307 28.3960 69.1876 Constraint 122 633 14.6983 18.3729 27.5594 69.1730 Constraint 114 581 8.3235 10.4044 15.6066 69.1215 Constraint 114 552 8.4909 10.6137 15.9205 69.1215 Constraint 310 418 18.5123 23.1404 34.7106 69.1109 Constraint 142 625 14.1890 17.7362 26.6043 69.0467 Constraint 122 625 14.4731 18.0914 27.1370 69.0467 Constraint 200 472 8.3909 10.4886 15.7330 68.9771 Constraint 114 588 12.7155 15.8944 23.8416 68.7203 Constraint 114 526 7.3406 9.1757 13.7636 68.7203 Constraint 264 465 18.1010 22.6262 33.9394 68.6244 Constraint 456 625 12.4114 15.5142 23.2714 68.5029 Constraint 114 310 9.4695 11.8369 17.7554 68.4205 Constraint 24 552 15.9232 19.9040 29.8559 68.2996 Constraint 24 315 16.7521 20.9401 31.4102 68.2996 Constraint 24 310 16.4336 20.5420 30.8131 68.2996 Constraint 35 275 17.8893 22.3616 33.5425 68.2993 Constraint 84 213 16.8284 21.0355 31.5532 68.2837 Constraint 114 572 10.7867 13.4833 20.2250 68.1215 Constraint 388 642 10.0168 12.5210 18.7814 68.0947 Constraint 380 642 10.2849 12.8561 19.2842 68.0947 Constraint 349 642 8.3475 10.4343 15.6515 68.0947 Constraint 221 642 8.6597 10.8247 16.2370 68.0947 Constraint 200 509 13.9255 17.4069 26.1104 68.0784 Constraint 200 504 12.2326 15.2907 22.9361 68.0784 Constraint 200 481 11.1827 13.9783 20.9675 68.0784 Constraint 534 613 14.9028 18.6285 27.9428 67.8747 Constraint 509 625 17.0520 21.3150 31.9725 67.7732 Constraint 194 456 9.1353 11.4191 17.1287 67.7008 Constraint 200 435 8.7157 10.8946 16.3419 67.3903 Constraint 200 371 8.3863 10.4829 15.7244 67.3903 Constraint 264 418 17.9836 22.4794 33.7192 67.3879 Constraint 200 518 12.9873 16.2341 24.3512 67.3783 Constraint 200 488 10.2578 12.8222 19.2334 67.3783 Constraint 315 418 18.4325 23.0406 34.5609 67.3144 Constraint 44 633 9.8072 12.2590 18.3885 67.2993 Constraint 114 559 9.9441 12.4301 18.6452 67.2478 Constraint 342 642 10.8971 13.6214 20.4321 67.2211 Constraint 75 465 17.7532 22.1914 33.2872 67.1933 Constraint 354 642 9.2857 11.6072 17.4107 67.0948 Constraint 257 642 12.6628 15.8285 23.7428 67.0948 Constraint 233 642 9.5022 11.8777 17.8166 67.0948 Constraint 173 509 14.2480 17.8100 26.7150 66.9995 Constraint 241 559 18.4218 23.0272 34.5408 66.9962 Constraint 114 418 14.9932 18.7415 28.1123 66.7994 Constraint 114 342 10.4161 13.0201 19.5302 66.7994 Constraint 114 323 10.8317 13.5396 20.3094 66.7994 Constraint 114 298 6.1131 7.6414 11.4621 66.7994 Constraint 114 291 5.9806 7.4758 11.2137 66.7994 Constraint 114 534 7.7237 9.6547 14.4820 66.7575 Constraint 114 595 10.9073 13.6341 20.4511 66.7203 Constraint 194 342 16.3850 20.4812 30.7218 66.3783 Constraint 35 633 9.8754 12.3442 18.5164 66.2993 Constraint 84 603 16.2400 20.3000 30.4500 66.2960 Constraint 58 625 13.5324 16.9155 25.3733 66.2933 Constraint 51 625 12.8092 16.0115 24.0172 66.2933 Constraint 168 603 15.4536 19.3170 28.9754 66.2891 Constraint 173 595 16.4830 20.6038 30.9057 66.2889 Constraint 207 572 18.2127 22.7659 34.1488 66.2269 Constraint 44 481 17.9132 22.3915 33.5872 66.1993 Constraint 58 613 9.8087 12.2608 18.3912 66.1935 Constraint 51 613 9.4319 11.7899 17.6849 66.1935 Constraint 371 642 6.6038 8.2547 12.3821 66.1068 Constraint 363 642 6.8718 8.5898 12.8847 66.1068 Constraint 35 465 18.4180 23.0225 34.5337 66.0997 Constraint 114 465 16.3724 20.4655 30.6982 66.0993 Constraint 114 456 15.5482 19.4352 29.1528 66.0993 Constraint 399 642 14.7222 18.4028 27.6041 66.0947 Constraint 114 543 10.5477 13.1847 19.7770 66.0574 Constraint 114 315 10.1760 12.7200 19.0799 65.7994 Constraint 194 603 13.7270 17.1587 25.7381 65.5782 Constraint 168 305 17.7886 22.2358 33.3537 65.3902 Constraint 24 572 15.5269 19.4087 29.1130 65.2996 Constraint 24 213 12.1128 15.1410 22.7115 65.2996 Constraint 24 603 5.5431 6.9289 10.3933 65.2996 Constraint 24 595 8.9869 11.2336 16.8504 65.2996 Constraint 44 625 9.4080 11.7600 17.6401 65.2993 Constraint 106 371 17.2100 21.5126 32.2688 65.2960 Constraint 84 354 16.1573 20.1966 30.2949 65.2959 Constraint 58 633 13.5811 16.9764 25.4646 65.2933 Constraint 97 349 16.7855 20.9819 31.4728 65.2925 Constraint 200 465 8.3553 10.4441 15.6662 65.2875 Constraint 275 603 18.3609 22.9512 34.4268 65.2129 Constraint 44 613 6.2169 7.7711 11.6567 65.1995 Constraint 465 625 15.2054 19.0068 28.5101 65.1933 Constraint 552 625 15.6236 19.5295 29.2943 65.0766 Constraint 534 625 17.6291 22.0364 33.0545 64.7793 Constraint 200 526 13.5559 16.9449 25.4174 64.6782 Constraint 488 633 17.7080 22.1350 33.2026 64.6639 Constraint 134 194 15.7875 19.7344 29.6016 64.4010 Constraint 200 443 7.5619 9.4523 14.1785 64.3903 Constraint 283 633 17.6008 22.0010 33.0015 64.3068 Constraint 35 625 8.7911 10.9889 16.4833 64.2993 Constraint 97 481 16.5535 20.6919 31.0378 64.2993 Constraint 106 388 17.4082 21.7602 32.6404 64.2959 Constraint 84 241 15.9120 19.8901 29.8351 64.2959 Constraint 51 633 12.8753 16.0941 24.1411 64.2934 Constraint 92 241 17.2428 21.5535 32.3302 64.2923 Constraint 24 472 16.8639 21.0799 31.6199 64.1996 Constraint 35 613 6.8844 8.6055 12.9083 64.1995 Constraint 429 642 14.6939 18.3674 27.5510 64.1211 Constraint 241 642 11.6318 14.5397 21.8096 64.1068 Constraint 497 642 14.6450 18.3063 27.4594 64.0948 Constraint 443 559 17.5385 21.9232 32.8847 64.0343 Constraint 114 603 15.2922 19.1152 28.6729 63.7206 Constraint 200 456 8.3426 10.4283 15.6424 63.7008 Constraint 194 595 14.9326 18.6658 27.9987 63.6782 Constraint 465 633 17.8617 22.3271 33.4906 63.5244 Constraint 114 213 13.0984 16.3731 24.5596 63.4205 Constraint 200 363 11.5853 14.4817 21.7225 63.3904 Constraint 200 354 13.6412 17.0515 25.5773 63.3783 Constraint 200 349 15.0726 18.8407 28.2611 63.3783 Constraint 200 342 15.0774 18.8468 28.2702 63.3783 Constraint 275 559 17.6812 22.1015 33.1522 63.3463 Constraint 24 291 17.8204 22.2754 33.4132 63.2996 Constraint 97 354 16.3250 20.4062 30.6093 63.2925 Constraint 97 363 16.8852 21.1065 31.6597 63.2924 Constraint 66 613 12.7341 15.9176 23.8764 63.1935 Constraint 248 642 13.3270 16.6588 24.9881 63.1069 Constraint 435 642 12.8866 16.1083 24.1624 63.1068 Constraint 305 642 13.5130 16.8913 25.3369 63.0948 Constraint 213 642 11.4814 14.3518 21.5277 63.0947 Constraint 275 625 18.2458 22.8073 34.2109 62.9685 Constraint 114 429 17.7597 22.1997 33.2995 62.7996 Constraint 173 603 15.7614 19.7018 29.5526 62.6903 Constraint 323 456 17.0363 21.2954 31.9431 62.5030 Constraint 200 305 16.6089 20.7611 31.1417 62.3783 Constraint 200 534 16.2955 20.3694 30.5541 62.3783 Constraint 24 207 11.3478 14.1848 21.2771 62.2996 Constraint 371 559 17.9497 22.4371 33.6557 62.2961 Constraint 97 472 16.7373 20.9216 31.3824 62.2923 Constraint 323 642 14.1459 17.6824 26.5236 62.2332 Constraint 298 642 17.0799 21.3499 32.0248 62.2211 Constraint 552 633 17.2236 21.5295 32.2943 62.2031 Constraint 443 642 12.7335 15.9169 23.8753 62.1068 Constraint 92 418 16.6896 20.8620 31.2930 62.0874 Constraint 194 406 16.7992 20.9990 31.4985 62.0783 Constraint 543 613 15.1628 18.9535 28.4303 62.0734 Constraint 406 642 17.2943 21.6178 32.4267 61.9950 Constraint 472 642 15.3808 19.2260 28.8390 61.7913 Constraint 173 613 15.2267 19.0334 28.5501 61.5938 Constraint 168 613 14.4518 18.0648 27.0972 61.5938 Constraint 323 488 17.7335 22.1668 33.2503 61.3040 Constraint 97 213 16.8784 21.0980 31.6470 61.2922 Constraint 200 406 15.6184 19.5230 29.2844 61.2783 Constraint 24 465 17.4828 21.8536 32.7803 61.1996 Constraint 24 488 16.7572 20.9465 31.4197 61.1996 Constraint 200 581 16.5955 20.7444 31.1166 61.1770 Constraint 44 114 13.1371 16.4214 24.6321 61.0993 Constraint 173 625 13.7459 17.1824 25.7736 60.6936 Constraint 168 625 13.3457 16.6821 25.0232 60.6936 Constraint 200 603 12.7885 15.9856 23.9784 60.6782 Constraint 114 207 17.0020 21.2525 31.8787 60.4205 Constraint 142 200 13.0843 16.3553 24.5330 60.4009 Constraint 106 456 16.0218 20.0273 30.0409 60.2994 Constraint 221 559 18.2945 22.8681 34.3022 60.2961 Constraint 283 603 18.4130 23.0163 34.5245 60.2250 Constraint 24 504 17.3617 21.7022 32.5532 60.1996 Constraint 97 488 17.0140 21.2675 31.9013 60.1993 Constraint 264 642 16.4417 20.5521 30.8281 60.1009 Constraint 200 543 17.0777 21.3471 32.0206 60.0793 Constraint 543 625 17.8260 22.2826 33.4238 60.0793 Constraint 354 543 18.7480 23.4350 35.1525 59.9205 Constraint 207 642 9.6878 12.1097 18.1646 59.7577 Constraint 200 595 13.5664 16.9580 25.4371 59.6782 Constraint 194 613 13.1629 16.4536 24.6804 59.5818 Constraint 75 613 13.6162 17.0203 25.5305 59.1935 Constraint 200 588 16.8048 21.0060 31.5090 59.1770 Constraint 310 642 14.7611 18.4513 27.6770 59.1069 Constraint 122 200 16.4550 20.5687 30.8531 59.1011 Constraint 35 114 16.1229 20.1536 30.2304 59.0993 Constraint 291 642 16.8291 21.0364 31.5546 58.8321 Constraint 200 552 17.0236 21.2795 31.9192 58.5817 Constraint 134 200 14.1194 17.6493 26.4739 58.4009 Constraint 168 534 15.2960 19.1200 28.6800 58.2994 Constraint 92 363 17.2808 21.6011 32.4016 58.2926 Constraint 315 642 16.8235 21.0293 31.5440 58.2332 Constraint 66 625 16.3099 20.3873 30.5810 58.1936 Constraint 97 435 17.2172 21.5216 32.2823 58.1923 Constraint 148 642 12.3644 15.4554 23.1832 58.1731 Constraint 134 642 12.9331 16.1663 24.2495 58.1731 Constraint 168 633 14.9824 18.7280 28.0920 57.5936 Constraint 194 633 13.8753 17.3441 26.0161 57.5818 Constraint 526 642 16.0448 20.0560 30.0840 57.4079 Constraint 97 418 16.7839 20.9798 31.4697 57.1994 Constraint 418 642 16.7831 20.9789 31.4683 57.1213 Constraint 194 625 11.4460 14.3075 21.4613 56.6818 Constraint 456 642 15.1818 18.9773 28.4659 56.4031 Constraint 106 613 15.7713 19.7142 29.5712 56.1997 Constraint 24 613 6.5288 8.1609 12.2414 56.1996 Constraint 75 207 17.7991 22.2489 33.3734 56.1932 Constraint 122 642 15.9876 19.9845 29.9767 56.1731 Constraint 142 642 13.8004 17.2505 25.8758 56.1731 Constraint 92 435 17.6568 22.0710 33.1064 56.0925 Constraint 173 633 15.4936 19.3671 29.0506 55.4936 Constraint 335 588 9.4698 11.8372 17.7558 55.2996 Constraint 335 581 9.7902 12.2377 18.3566 55.2996 Constraint 335 552 13.3782 16.7227 25.0841 55.2996 Constraint 335 534 16.5495 20.6869 31.0304 55.2996 Constraint 335 526 13.0592 16.3240 24.4860 55.2996 Constraint 335 518 15.5730 19.4662 29.1994 55.2996 Constraint 335 504 16.6466 20.8083 31.2124 55.2996 Constraint 335 497 15.2362 19.0453 28.5679 55.2996 Constraint 335 456 17.3857 21.7321 32.5982 55.2996 Constraint 335 443 16.2287 20.2859 30.4289 55.2996 Constraint 335 435 14.0060 17.5076 26.2613 55.2996 Constraint 335 429 15.9520 19.9400 29.9101 55.2996 Constraint 335 418 15.4886 19.3608 29.0412 55.2996 Constraint 335 406 12.8420 16.0525 24.0788 55.2996 Constraint 335 399 11.6322 14.5402 21.8104 55.2996 Constraint 275 335 12.2210 15.2762 22.9144 55.2996 Constraint 264 335 11.6873 14.6091 21.9137 55.2996 Constraint 257 335 8.4363 10.5454 15.8181 55.2996 Constraint 248 335 12.3938 15.4923 23.2384 55.2996 Constraint 241 335 13.2695 16.5869 24.8803 55.2996 Constraint 233 335 8.9038 11.1298 16.6947 55.2996 Constraint 221 335 12.5522 15.6903 23.5354 55.2996 Constraint 213 335 13.5087 16.8858 25.3288 55.2996 Constraint 148 335 12.6477 15.8096 23.7144 55.2996 Constraint 142 335 13.0476 16.3095 24.4642 55.2996 Constraint 134 335 9.0044 11.2555 16.8833 55.2996 Constraint 122 335 9.7338 12.1672 18.2509 55.2996 Constraint 24 633 7.1267 8.9084 13.3626 55.2996 Constraint 75 625 17.2569 21.5711 32.3567 55.1934 Constraint 182 504 13.4430 16.8037 25.2056 55.0786 Constraint 182 481 11.8475 14.8094 22.2141 55.0786 Constraint 182 472 9.1746 11.4683 17.2024 54.6775 Constraint 200 613 12.5173 15.6467 23.4700 54.5818 Constraint 182 497 10.7506 13.4382 20.1573 54.3785 Constraint 182 488 11.1521 13.9402 20.9103 54.3785 Constraint 182 429 11.7751 14.7189 22.0783 54.3785 Constraint 182 399 14.2792 17.8490 26.7734 54.3785 Constraint 182 388 11.3081 14.1351 21.2027 54.3785 Constraint 182 380 11.5070 14.3837 21.5756 54.3785 Constraint 335 559 15.2540 19.0675 28.6012 54.2997 Constraint 66 335 9.2682 11.5853 17.3779 54.2996 Constraint 58 335 6.7657 8.4572 12.6858 54.2996 Constraint 51 335 6.6657 8.3322 12.4983 54.2996 Constraint 44 335 4.6281 5.7851 8.6777 54.2996 Constraint 35 335 7.3866 9.2332 13.8498 54.2996 Constraint 173 534 16.5018 20.6273 30.9410 54.2995 Constraint 275 642 17.0145 21.2681 31.9022 54.2994 Constraint 168 581 17.5382 21.9228 32.8842 54.2889 Constraint 84 221 17.0527 21.3159 31.9739 54.2838 Constraint 84 613 15.4958 19.3698 29.0546 54.1997 Constraint 66 633 15.9293 19.9116 29.8674 54.1936 Constraint 114 613 14.1984 17.7480 26.6220 53.8469 Constraint 349 559 18.3948 22.9935 34.4903 53.6203 Constraint 182 518 14.2087 17.7609 26.6413 53.3785 Constraint 182 418 14.3059 17.8823 26.8235 53.3785 Constraint 518 642 16.9853 21.2316 31.8474 53.3070 Constraint 24 625 5.1540 6.4425 9.6638 53.2997 Constraint 44 642 12.1920 15.2400 22.8600 53.2994 Constraint 200 633 13.4817 16.8521 25.2782 52.6818 Constraint 182 443 8.9344 11.1680 16.7521 52.3906 Constraint 182 435 10.1008 12.6260 18.9390 52.3906 Constraint 182 371 10.1330 12.6662 18.9993 52.3906 Constraint 182 363 13.6847 17.1059 25.6588 52.3906 Constraint 194 534 17.0479 21.3099 31.9648 52.3889 Constraint 182 354 15.4219 19.2774 28.9161 52.3785 Constraint 17 588 13.6982 17.1228 25.6841 52.2997 Constraint 17 497 16.7202 20.9003 31.3505 52.2997 Constraint 17 456 16.8312 21.0390 31.5584 52.2997 Constraint 17 443 12.7001 15.8751 23.8127 52.2997 Constraint 17 435 13.9106 17.3882 26.0824 52.2997 Constraint 17 429 13.9438 17.4298 26.1447 52.2997 Constraint 17 418 16.4246 20.5308 30.7962 52.2997 Constraint 17 406 16.2851 20.3564 30.5345 52.2997 Constraint 17 399 14.6640 18.3300 27.4950 52.2997 Constraint 17 388 9.2228 11.5285 17.2927 52.2997 Constraint 17 380 11.5890 14.4863 21.7294 52.2997 Constraint 17 371 9.1575 11.4468 17.1702 52.2997 Constraint 17 363 9.1214 11.4018 17.1026 52.2997 Constraint 17 354 13.5716 16.9645 25.4468 52.2997 Constraint 17 349 10.5395 13.1744 19.7616 52.2997 Constraint 17 342 11.8526 14.8157 22.2236 52.2997 Constraint 17 323 13.9115 17.3893 26.0840 52.2997 Constraint 17 257 15.7318 19.6648 29.4972 52.2997 Constraint 17 233 12.7409 15.9262 23.8892 52.2997 Constraint 17 221 12.9175 16.1468 24.2203 52.2997 Constraint 17 148 15.9803 19.9754 29.9632 52.2997 Constraint 17 134 15.7449 19.6812 29.5217 52.2997 Constraint 17 122 17.5508 21.9385 32.9077 52.2997 Constraint 75 335 11.1225 13.9032 20.8548 52.2996 Constraint 335 572 11.5714 14.4643 21.6964 52.2996 Constraint 207 335 15.2730 19.0913 28.6369 52.2996 Constraint 35 642 12.3750 15.4688 23.2031 52.2994 Constraint 51 642 15.6018 19.5022 29.2533 52.2934 Constraint 58 642 15.6823 19.6028 29.4042 52.2934 Constraint 84 488 17.3632 21.7040 32.5561 52.2872 Constraint 84 388 17.5852 21.9815 32.9723 52.2839 Constraint 200 625 11.1347 13.9184 20.8776 51.6818 Constraint 17 581 16.2125 20.2657 30.3985 51.2997 Constraint 17 526 17.7278 22.1597 33.2396 51.2997 Constraint 17 305 15.2883 19.1104 28.6656 51.2997 Constraint 24 335 10.2829 12.8537 19.2805 51.2997 Constraint 44 200 16.4055 20.5069 30.7603 51.2996 Constraint 106 465 16.2811 20.3513 30.5270 51.2994 Constraint 35 200 16.5170 20.6463 30.9694 51.1996 Constraint 75 443 17.9091 22.3864 33.5797 51.1995 Constraint 194 588 17.3382 21.6728 32.5092 50.9771 Constraint 114 625 17.7517 22.1896 33.2845 50.8469 Constraint 17 241 16.4072 20.5090 30.7635 50.2997 Constraint 84 335 12.9825 16.2282 24.3423 50.2996 Constraint 182 465 8.4364 10.5455 15.8182 50.2878 Constraint 173 342 17.1341 21.4176 32.1264 50.1903 Constraint 194 305 17.4724 21.8405 32.7607 50.1784 Constraint 66 472 17.2230 21.5288 32.2932 50.0934 Constraint 194 581 17.5502 21.9378 32.9066 49.9771 Constraint 504 642 16.7369 20.9212 31.3817 49.9127 Constraint 335 543 17.2135 21.5169 32.2753 49.2998 Constraint 17 213 14.0152 17.5190 26.2785 49.2997 Constraint 335 472 17.9537 22.4422 33.6632 49.2997 Constraint 97 335 15.0385 18.7982 28.1973 49.2996 Constraint 92 335 15.0334 18.7917 28.1876 49.2996 Constraint 335 603 9.4956 11.8695 17.8042 49.2996 Constraint 335 595 7.1984 8.9980 13.4970 49.2996 Constraint 168 543 15.8610 19.8262 29.7393 49.2994 Constraint 168 406 16.2702 20.3378 30.5067 49.2890 Constraint 75 633 17.1743 21.4679 32.2019 49.1936 Constraint 97 221 17.1606 21.4507 32.1760 49.1925 Constraint 388 650 11.3924 14.2405 21.3607 49.0948 Constraint 380 650 12.1251 15.1564 22.7346 49.0948 Constraint 349 650 9.8993 12.3741 18.5612 49.0948 Constraint 233 650 11.7871 14.7339 22.1008 49.0948 Constraint 182 456 8.9652 11.2065 16.8097 48.7010 Constraint 182 526 14.8229 18.5287 27.7930 48.6904 Constraint 194 642 12.5295 15.6619 23.4928 48.6818 Constraint 182 603 14.7838 18.4797 27.7195 48.6784 Constraint 168 642 13.3369 16.6711 25.0066 48.5937 Constraint 114 443 17.9804 22.4755 33.7133 48.4208 Constraint 173 543 17.2423 21.5529 32.3293 48.2997 Constraint 24 200 14.4164 18.0205 27.0308 48.2997 Constraint 92 349 16.7739 20.9673 31.4510 48.2926 Constraint 92 213 17.2745 21.5931 32.3897 48.2806 Constraint 342 650 12.3722 15.4653 23.1980 48.2211 Constraint 24 194 14.3873 17.9841 26.9762 48.1997 Constraint 221 650 10.7486 13.4357 20.1536 48.0948 Constraint 213 650 13.3042 16.6303 24.9454 48.0948 Constraint 182 509 14.1351 17.6689 26.5033 48.0907 Constraint 349 543 18.8046 23.5058 35.2587 47.9208 Constraint 173 642 14.0524 17.5655 26.3483 47.4937 Constraint 182 342 16.8327 21.0409 31.5614 47.3785 Constraint 465 642 16.7931 20.9913 31.4870 47.3307 Constraint 17 310 16.9210 21.1512 31.7268 47.2997 Constraint 17 603 8.9887 11.2358 16.8538 47.2997 Constraint 17 595 11.7349 14.6686 22.0030 47.2997 Constraint 17 207 12.5916 15.7395 23.6093 47.2997 Constraint 106 335 13.6148 17.0186 25.5278 47.2996 Constraint 24 509 18.2289 22.7862 34.1793 47.1998 Constraint 173 349 16.3635 20.4544 30.6816 47.1903 Constraint 371 650 8.6678 10.8348 16.2522 47.1069 Constraint 363 650 8.9220 11.1525 16.7288 47.1069 Constraint 399 650 16.2549 20.3187 30.4780 47.0949 Constraint 354 650 11.0866 13.8583 20.7874 47.0949 Constraint 257 650 14.1626 17.7033 26.5549 47.0949 Constraint 51 481 18.3620 22.9525 34.4287 47.0937 Constraint 182 349 16.6287 20.7859 31.1789 46.3785 Constraint 17 518 17.9056 22.3819 33.5729 46.2998 Constraint 92 481 17.3557 21.6947 32.5420 46.2875 Constraint 17 298 17.6686 22.0857 33.1286 46.1997 Constraint 17 315 17.3716 21.7145 32.5717 46.1997 Constraint 435 650 14.7765 18.4707 27.7060 46.1069 Constraint 305 650 15.2076 19.0095 28.5142 46.0949 Constraint 92 603 17.2390 21.5487 32.3231 46.0926 Constraint 92 488 17.3175 21.6469 32.4704 46.0875 Constraint 283 518 18.3482 22.9353 34.4030 45.9251 Constraint 182 595 15.5428 19.4285 29.1428 45.6784 Constraint 349 659 10.8459 13.5574 20.3361 45.5998 Constraint 17 248 17.5779 21.9723 32.9585 45.2997 Constraint 335 633 9.1004 11.3755 17.0633 45.2997 Constraint 92 354 16.9915 21.2394 31.8590 45.2928 Constraint 323 650 15.2986 19.1232 28.6848 45.2333 Constraint 335 613 7.2213 9.0266 13.5400 45.1997 Constraint 443 650 14.6189 18.2736 27.4104 45.0070 Constraint 173 406 17.3859 21.7324 32.5986 44.9890 Constraint 114 633 17.5450 21.9313 32.8969 44.9732 Constraint 497 650 16.6514 20.8142 31.2213 44.8949 Constraint 207 650 11.5144 14.3930 21.5895 44.7578 Constraint 342 659 13.4020 16.7525 25.1288 44.7261 Constraint 363 659 10.3556 12.9446 19.4168 44.6058 Constraint 233 659 13.0129 16.2661 24.3992 44.5998 Constraint 388 659 12.7812 15.9765 23.9647 44.5998 Constraint 380 659 13.5264 16.9080 25.3620 44.5998 Constraint 221 659 12.2982 15.3727 23.0591 44.5998 Constraint 213 659 14.9146 18.6433 27.9649 44.5998 Constraint 298 465 18.5417 23.1772 34.7658 44.3246 Constraint 24 264 18.5498 23.1872 34.7808 44.2997 Constraint 17 142 18.1180 22.6475 33.9713 44.2997 Constraint 24 642 9.3859 11.7324 17.5986 44.2997 Constraint 84 371 17.7000 22.1250 33.1876 44.2961 Constraint 24 543 18.1180 22.6475 33.9713 44.1998 Constraint 92 613 17.0140 21.2676 31.9013 44.1963 Constraint 106 429 17.5850 21.9812 32.9718 44.1961 Constraint 429 650 15.8058 19.7573 29.6359 44.1214 Constraint 248 650 15.2378 19.0473 28.5709 44.1069 Constraint 241 650 13.6672 17.0840 25.6261 44.1069 Constraint 122 194 17.2379 21.5474 32.3211 44.1011 Constraint 35 194 16.6989 20.8737 31.3105 44.0997 Constraint 200 642 12.7059 15.8824 23.8237 43.6818 Constraint 371 659 10.1250 12.6562 18.9843 43.6058 Constraint 354 659 12.0697 15.0871 22.6306 43.5999 Constraint 257 659 15.0913 18.8642 28.2963 43.5999 Constraint 182 613 14.2764 17.8455 26.7683 43.5819 Constraint 168 552 16.4739 20.5923 30.8885 43.2998 Constraint 335 625 10.4389 13.0487 19.5730 43.2997 Constraint 84 481 17.1627 21.4534 32.1801 43.2874 Constraint 84 472 16.8951 21.1189 31.6783 43.2839 Constraint 92 472 17.7666 22.2083 33.3124 43.2806 Constraint 310 456 18.4569 23.0711 34.6066 43.2031 Constraint 173 257 17.6941 22.1176 33.1764 43.1903 Constraint 122 173 18.1259 22.6574 33.9861 42.9997 Constraint 488 642 16.8800 21.1000 31.6499 42.8071 Constraint 194 543 17.5551 21.9439 32.9159 42.6888 Constraint 182 633 15.2171 19.0214 28.5321 42.5819 Constraint 465 572 18.4625 23.0781 34.6172 42.3247 Constraint 9 588 15.2771 19.0964 28.6446 42.1998 Constraint 9 581 17.4756 21.8446 32.7668 42.1998 Constraint 9 443 12.6131 15.7664 23.6495 42.1998 Constraint 9 435 14.3735 17.9669 26.9503 42.1998 Constraint 9 429 14.5987 18.2483 27.3725 42.1998 Constraint 9 418 17.3705 21.7131 32.5696 42.1998 Constraint 9 406 17.6483 22.0603 33.0905 42.1998 Constraint 9 399 15.6371 19.5464 29.3196 42.1998 Constraint 9 388 9.7649 12.2062 18.3093 42.1998 Constraint 9 380 12.0578 15.0723 22.6084 42.1998 Constraint 9 371 8.8640 11.0800 16.6200 42.1998 Constraint 9 363 9.2591 11.5739 17.3609 42.1998 Constraint 9 354 13.2336 16.5420 24.8129 42.1998 Constraint 9 349 10.6569 13.3211 19.9816 42.1998 Constraint 9 342 12.6236 15.7795 23.6692 42.1998 Constraint 9 323 15.1781 18.9726 28.4590 42.1998 Constraint 9 233 12.7885 15.9856 23.9784 42.1998 Constraint 9 221 12.3737 15.4671 23.2007 42.1998 Constraint 24 168 16.6753 20.8441 31.2661 42.1997 Constraint 173 552 17.9599 22.4498 33.6748 42.1997 Constraint 182 406 16.5987 20.7484 31.1227 42.1785 Constraint 283 543 18.4550 23.0687 34.6030 42.1248 Constraint 44 194 16.7742 20.9678 31.4516 41.9997 Constraint 275 518 18.2889 22.8611 34.2917 41.9128 Constraint 241 659 15.0177 18.7721 28.1582 41.6059 Constraint 207 659 13.1860 16.4825 24.7238 41.2628 Constraint 17 613 8.0955 10.1193 15.1790 41.1998 Constraint 97 613 17.0441 21.3052 31.9577 41.1964 Constraint 106 207 17.4154 21.7693 32.6539 41.1961 Constraint 66 481 17.8540 22.3175 33.4762 41.0937 Constraint 323 659 15.7488 19.6860 29.5290 40.7322 Constraint 182 625 12.6246 15.7807 23.6711 40.6819 Constraint 435 659 16.0522 20.0652 30.0978 40.6059 Constraint 17 335 10.9138 13.6422 20.4633 40.2998 Constraint 17 633 6.3975 7.9969 11.9953 40.2998 Constraint 9 305 15.9509 19.9386 29.9080 40.1998 Constraint 9 497 16.7924 20.9905 31.4857 40.1998 Constraint 9 257 15.8048 19.7560 29.6340 40.1998 Constraint 9 148 15.8286 19.7857 29.6786 40.1998 Constraint 9 134 15.9925 19.9906 29.9859 40.1998 Constraint 97 603 17.3714 21.7142 32.5713 40.1928 Constraint 134 650 15.1688 18.9610 28.4415 40.1732 Constraint 148 650 14.9253 18.6566 27.9850 40.1732 Constraint 310 650 15.9166 19.8957 29.8436 40.1070 Constraint 24 173 15.8551 19.8188 29.7283 40.0997 Constraint 17 625 6.2239 7.7799 11.6698 39.2998 Constraint 9 213 14.0385 17.5481 26.3221 39.1998 Constraint 142 650 16.1427 20.1784 30.2676 39.1732 Constraint 114 335 13.1057 16.3821 24.5732 39.0997 Constraint 58 200 17.5074 21.8843 32.8264 39.0938 Constraint 248 659 16.1862 20.2327 30.3491 38.6059 Constraint 305 659 15.9577 19.9471 29.9207 38.5999 Constraint 194 552 17.4707 21.8384 32.7576 38.5889 Constraint 315 509 18.3562 22.9452 34.4178 38.3039 Constraint 17 572 17.8018 22.2523 33.3785 38.1998 Constraint 24 534 18.3769 22.9712 34.4568 38.1998 Constraint 9 456 16.5464 20.6831 31.0246 38.1998 Constraint 9 241 15.6559 19.5699 29.3549 38.1998 Constraint 134 659 16.6786 20.8482 31.2723 38.0733 Constraint 335 509 18.1198 22.6497 33.9746 37.2998 Constraint 9 603 10.2355 12.7944 19.1916 37.1998 Constraint 9 595 12.8574 16.0717 24.1076 37.1998 Constraint 9 207 12.2394 15.2992 22.9489 37.1998 Constraint 122 182 17.4835 21.8544 32.7816 36.9000 Constraint 291 465 18.6514 23.3143 34.9714 36.6366 Constraint 443 659 15.5223 19.4028 29.1042 36.6059 Constraint 335 488 18.6458 23.3072 34.9609 36.2999 Constraint 17 200 15.3538 19.1922 28.7883 36.2998 Constraint 44 650 13.6008 17.0010 25.5016 36.2995 Constraint 168 588 17.4731 21.8413 32.7620 36.2891 Constraint 9 122 18.1532 22.6916 34.0373 36.1998 Constraint 97 456 17.4254 21.7817 32.6725 36.1996 Constraint 66 443 17.7475 22.1844 33.2765 36.0996 Constraint 182 642 13.2944 16.6180 24.9270 35.6819 Constraint 472 650 16.9392 21.1740 31.7611 35.5914 Constraint 35 650 13.6198 17.0247 25.5371 35.2995 Constraint 44 168 17.9937 22.4922 33.7383 35.2995 Constraint 84 456 17.7963 22.2454 33.3681 35.2995 Constraint 17 194 15.2444 19.0555 28.5832 35.1997 Constraint 44 659 15.2007 19.0009 28.5013 35.1996 Constraint 182 552 17.3274 21.6592 32.4889 34.4940 Constraint 182 257 16.9556 21.1945 31.7918 34.3906 Constraint 323 481 18.3609 22.9511 34.4267 34.3040 Constraint 335 642 11.5882 14.4853 21.7279 34.2997 Constraint 200 335 17.9101 22.3876 33.5814 34.1997 Constraint 182 581 17.5169 21.8961 32.8442 34.0893 Constraint 148 659 16.2924 20.3655 30.5483 34.0734 Constraint 182 534 15.9910 19.9887 29.9831 34.0000 Constraint 182 588 17.7936 22.2420 33.3630 33.9772 Constraint 24 182 15.8766 19.8457 29.7686 33.1999 Constraint 9 248 16.9572 21.1965 31.7947 33.1998 Constraint 24 559 17.5033 21.8792 32.8187 33.1998 Constraint 9 142 17.6570 22.0713 33.1070 33.1998 Constraint 35 659 14.9879 18.7349 28.1024 33.1997 Constraint 97 388 18.1668 22.7085 34.0627 33.1928 Constraint 526 650 17.5670 21.9587 32.9381 32.9081 Constraint 200 650 14.0757 17.5946 26.3919 32.6818 Constraint 310 659 16.2268 20.2835 30.4252 32.6059 Constraint 182 543 16.6517 20.8147 31.2220 32.5011 Constraint 58 650 17.0567 21.3209 31.9814 32.2935 Constraint 9 613 8.6229 10.7786 16.1679 32.0998 Constraint 51 465 18.1882 22.7352 34.1028 32.0938 Constraint 283 642 18.0656 22.5820 33.8731 31.5400 Constraint 371 671 10.5957 13.2447 19.8670 31.4116 Constraint 363 671 10.5464 13.1830 19.7745 31.4116 Constraint 349 671 10.7376 13.4220 20.1330 31.4116 Constraint 233 671 13.1213 16.4016 24.6024 31.4116 Constraint 221 671 12.4005 15.5007 23.2510 31.4116 Constraint 168 650 13.8085 17.2606 25.8909 31.3938 Constraint 207 315 18.5235 23.1543 34.7315 31.2931 Constraint 9 633 6.1041 7.6302 11.4452 31.1998 Constraint 9 625 6.2002 7.7502 11.6253 31.1998 Constraint 182 305 17.4003 21.7504 32.6256 31.1906 Constraint 168 264 18.0174 22.5218 33.7827 31.0906 Constraint 342 671 13.6700 17.0875 25.6312 30.5379 Constraint 429 659 16.1473 20.1841 30.2761 30.5262 Constraint 388 671 13.4020 16.7524 25.1287 30.4117 Constraint 380 671 13.7113 17.1392 25.7088 30.4117 Constraint 213 671 15.0000 18.7500 28.1250 30.4117 Constraint 194 650 12.8737 16.0922 24.1383 30.3819 Constraint 17 642 8.7182 10.8977 16.3466 30.2998 Constraint 456 650 16.8138 21.0173 31.5260 30.2032 Constraint 9 335 12.1157 15.1447 22.7170 30.1999 Constraint 17 552 18.1344 22.6680 34.0019 30.1998 Constraint 9 526 17.9772 22.4715 33.7073 30.1998 Constraint 9 310 17.0561 21.3202 31.9802 30.1998 Constraint 106 443 18.0987 22.6233 33.9350 30.1962 Constraint 122 650 17.6279 22.0349 33.0523 30.1733 Constraint 315 472 18.1815 22.7268 34.0902 30.1005 Constraint 114 200 17.8843 22.3554 33.5330 29.9013 Constraint 354 671 11.6078 14.5098 21.7647 29.4117 Constraint 257 671 15.0059 18.7573 28.1360 29.4117 Constraint 241 671 14.8790 18.5987 27.8980 29.4117 Constraint 264 650 17.3743 21.7179 32.5768 29.1081 Constraint 142 659 17.1378 21.4222 32.1333 29.0734 Constraint 552 642 17.9844 22.4805 33.7208 29.0128 Constraint 481 642 17.4187 21.7734 32.6601 29.0128 Constraint 9 315 18.0516 22.5645 33.8467 28.9998 Constraint 114 168 17.9729 22.4661 33.6991 28.7999 Constraint 173 650 13.6546 17.0682 25.6023 28.4938 Constraint 248 671 16.2248 20.2810 30.4216 28.4117 Constraint 173 305 17.9192 22.3990 33.5985 28.1903 Constraint 310 481 18.2841 22.8552 34.2828 27.9252 Constraint 497 659 16.9669 21.2086 31.8129 27.6000 Constraint 24 650 10.1365 12.6707 19.0060 27.2998 Constraint 207 559 18.2649 22.8311 34.2467 27.2963 Constraint 51 650 16.2870 20.3587 30.5380 27.2937 Constraint 106 168 17.3653 21.7066 32.5600 27.1962 Constraint 44 182 17.9548 22.4435 33.6653 27.0999 Constraint 9 194 14.7382 18.4227 27.6341 27.0998 Constraint 207 671 13.4124 16.7655 25.1482 27.0746 Constraint 283 472 18.2161 22.7702 34.1553 26.7215 Constraint 399 659 16.0198 20.0248 30.0372 26.5999 Constraint 443 671 15.6905 19.6131 29.4196 26.3117 Constraint 35 168 18.1042 22.6303 33.9454 26.2997 Constraint 9 200 14.8582 18.5727 27.8591 26.1998 Constraint 17 291 18.3553 22.9441 34.4161 26.1998 Constraint 9 168 16.7845 20.9807 31.4710 26.1998 Constraint 17 472 18.2561 22.8201 34.2301 26.0997 Constraint 114 642 18.0300 22.5375 33.8063 25.8734 Constraint 200 659 15.0792 18.8490 28.2735 25.5880 Constraint 194 659 14.2300 17.7875 26.6813 25.4880 Constraint 291 443 18.8681 23.5851 35.3777 25.3044 Constraint 24 659 11.4580 14.3225 21.4838 25.1999 Constraint 9 472 17.7703 22.2129 33.3193 25.1998 Constraint 84 633 17.7369 22.1711 33.2567 25.1998 Constraint 9 173 15.5107 19.3883 29.0825 25.0998 Constraint 44 671 14.3933 17.9916 26.9875 25.0997 Constraint 84 429 17.0837 21.3546 32.0319 25.0878 Constraint 92 456 17.6339 22.0424 33.0635 24.9999 Constraint 134 671 16.1192 20.1490 30.2235 24.9734 Constraint 310 488 18.2534 22.8168 34.2252 24.9251 Constraint 275 435 17.9816 22.4770 33.7156 24.9250 Constraint 275 650 16.9877 21.2347 31.8520 24.5404 Constraint 182 650 14.5007 18.1259 27.1888 24.4820 Constraint 435 671 15.5098 19.3872 29.0808 24.4117 Constraint 168 659 13.9909 17.4887 26.2330 24.3938 Constraint 335 650 13.3073 16.6341 24.9511 24.2997 Constraint 291 650 17.2466 21.5582 32.3373 24.2405 Constraint 315 650 16.4418 20.5522 30.8284 24.2405 Constraint 9 642 7.6341 9.5426 14.3139 24.1999 Constraint 51 200 16.9690 21.2113 31.8169 24.0938 Constraint 3 588 16.4635 20.5794 30.8690 23.9999 Constraint 3 443 14.9285 18.6606 27.9910 23.9999 Constraint 3 435 16.5883 20.7353 31.1030 23.9999 Constraint 3 429 16.6660 20.8326 31.2488 23.9999 Constraint 3 388 11.9820 14.9775 22.4663 23.9999 Constraint 3 380 14.1301 17.6627 26.4940 23.9999 Constraint 3 371 11.2716 14.0895 21.1342 23.9999 Constraint 3 363 10.7652 13.4565 20.1848 23.9999 Constraint 3 354 14.2501 17.8127 26.7190 23.9999 Constraint 3 349 11.3439 14.1799 21.2698 23.9999 Constraint 3 342 13.6086 17.0107 25.5160 23.9999 Constraint 3 233 14.2813 17.8516 26.7774 23.9999 Constraint 3 221 14.3604 17.9506 26.9258 23.9999 Constraint 35 182 17.8010 22.2513 33.3770 23.9999 Constraint 58 194 17.6473 22.0591 33.0887 23.9938 Constraint 148 671 15.9503 19.9379 29.9069 23.9734 Constraint 534 633 18.0734 22.5918 33.8877 23.8758 Constraint 264 443 18.4955 23.1194 34.6791 23.7217 Constraint 472 659 17.5437 21.9296 32.8944 23.5977 Constraint 305 671 15.5805 19.4756 29.2134 23.4117 Constraint 9 518 18.0050 22.5063 33.7594 23.1998 Constraint 97 371 17.4198 21.7747 32.6621 23.1929 Constraint 44 173 17.4648 21.8310 32.7465 23.0996 Constraint 66 642 17.1517 21.4397 32.1595 23.0938 Constraint 200 323 17.7829 22.2286 33.3429 23.0907 Constraint 509 642 18.0908 22.6135 33.9203 23.0128 Constraint 24 114 18.5080 23.1350 34.7025 22.9998 Constraint 406 650 16.9448 21.1810 31.7715 22.7951 Constraint 429 671 16.8378 21.0473 31.5709 22.4380 Constraint 291 429 18.5532 23.1915 34.7872 22.3044 Constraint 194 264 18.2376 22.7970 34.1954 22.2012 Constraint 335 659 14.5165 18.1456 27.2184 22.1998 Constraint 17 168 16.9518 21.1897 31.7846 22.0998 Constraint 35 671 14.0676 17.5845 26.3768 22.0997 Constraint 66 207 16.4452 20.5565 30.8347 22.0939 Constraint 3 399 17.2514 21.5643 32.3464 21.9999 Constraint 3 323 15.3464 19.1830 28.7745 21.9999 Constraint 194 335 18.0963 22.6203 33.9305 21.9998 Constraint 173 581 17.3559 21.6949 32.5424 21.9998 Constraint 142 671 16.8977 21.1221 31.6832 21.9735 Constraint 418 650 16.9450 21.1812 31.7718 21.9214 Constraint 323 671 14.4885 18.1107 27.1660 21.5380 Constraint 310 671 15.6783 19.5979 29.3969 21.4118 Constraint 497 671 17.1108 21.3885 32.0828 21.4118 Constraint 275 659 17.5917 21.9896 32.9844 21.3382 Constraint 298 650 16.7282 20.9103 31.3654 21.2344 Constraint 24 671 11.9724 14.9654 22.4482 21.0999 Constraint 92 221 16.3404 20.4255 30.6382 21.0808 Constraint 3 148 17.5419 21.9274 32.8910 20.9999 Constraint 58 168 18.2760 22.8450 34.2675 20.9996 Constraint 173 588 17.6491 22.0613 33.0920 20.9892 Constraint 182 264 18.1863 22.7329 34.0993 20.7895 Constraint 399 671 16.3858 20.4822 30.7233 20.4117 Constraint 173 659 14.0814 17.6018 26.4027 20.3939 Constraint 9 182 16.0637 20.0797 30.1195 20.1999 Constraint 17 182 16.2892 20.3615 30.5422 20.0999 Constraint 3 213 16.2096 20.2620 30.3930 19.9999 Constraint 3 603 11.8769 14.8461 22.2692 19.9999 Constraint 3 595 14.3255 17.9069 26.8603 19.9999 Constraint 3 305 16.4197 20.5246 30.7869 19.9999 Constraint 3 257 16.0285 20.0356 30.0534 19.9999 Constraint 3 134 17.0643 21.3304 31.9956 19.9999 Constraint 264 659 17.6971 22.1213 33.1820 19.7333 Constraint 315 659 16.3695 20.4619 30.6929 19.7325 Constraint 275 388 18.3345 22.9181 34.3771 19.2024 Constraint 97 465 17.7038 22.1297 33.1945 19.1998 Constraint 17 173 14.7830 18.4788 27.7182 19.0998 Constraint 310 443 18.6964 23.3705 35.0557 19.0108 Constraint 35 481 18.6080 23.2600 34.8900 19.0000 Constraint 9 298 18.1230 22.6538 33.9806 18.9998 Constraint 35 173 17.2603 21.5753 32.3630 18.9997 Constraint 283 435 18.3267 22.9084 34.3626 18.9359 Constraint 315 671 16.6789 20.8486 31.2729 18.5381 Constraint 465 650 17.8924 22.3655 33.5483 18.3247 Constraint 275 509 17.9278 22.4098 33.6147 18.3026 Constraint 106 200 18.0814 22.6018 33.9027 18.1964 Constraint 335 671 14.5849 18.2311 27.3467 18.0998 Constraint 84 625 17.6436 22.0545 33.0817 18.0939 Constraint 3 207 14.2317 17.7897 26.6845 17.9999 Constraint 581 659 16.4942 20.6177 30.9266 17.9990 Constraint 504 650 17.7592 22.1990 33.2985 17.7068 Constraint 173 671 15.9778 19.9723 29.9584 17.4010 Constraint 168 671 15.9219 19.9024 29.8535 17.4009 Constraint 481 633 17.8814 22.3517 33.5276 17.3687 Constraint 291 659 17.4227 21.7784 32.6675 17.3312 Constraint 17 650 7.8759 9.8448 14.7672 17.2999 Constraint 106 625 17.9201 22.4001 33.6001 17.1999 Constraint 51 659 16.4494 20.5618 30.8426 17.1999 Constraint 106 633 18.1026 22.6283 33.9424 17.1998 Constraint 51 671 16.3406 20.4258 30.6387 17.0998 Constraint 58 671 16.7167 20.8958 31.3437 17.0997 Constraint 92 388 16.7978 20.9972 31.4958 17.0808 Constraint 534 642 18.3401 22.9251 34.3877 17.0130 Constraint 3 241 16.8018 21.0022 31.5033 16.9999 Constraint 509 633 18.1737 22.7171 34.0756 16.8688 Constraint 518 650 17.3634 21.7042 32.5563 16.8082 Constraint 182 659 14.8053 18.5066 27.7599 16.5880 Constraint 418 659 16.7666 20.9582 31.4373 16.5263 Constraint 588 671 15.8860 19.8575 29.7862 16.4119 Constraint 200 310 17.9989 22.4986 33.7479 16.2000 Constraint 17 659 9.4809 11.8511 17.7767 16.1999 Constraint 84 465 17.1370 21.4213 32.1319 16.0878 Constraint 84 207 17.4753 21.8441 32.7662 16.0844 Constraint 472 671 17.0041 21.2551 31.8827 16.0106 Constraint 310 429 18.8365 23.5457 35.3185 16.0004 Constraint 3 613 9.8701 12.3377 18.5065 16.0000 Constraint 75 642 17.7989 22.2487 33.3730 15.9938 Constraint 488 650 17.5140 21.8925 32.8387 15.8012 Constraint 298 659 16.4794 20.5992 30.8989 15.7265 Constraint 298 671 16.9019 21.1274 31.6911 15.5381 Constraint 66 200 17.8386 22.2983 33.4474 15.4951 Constraint 194 671 14.3719 17.9648 26.9472 15.4011 Constraint 388 683 15.0587 18.8233 28.2350 15.3106 Constraint 380 683 15.7942 19.7428 29.6142 15.3106 Constraint 371 683 12.1396 15.1745 22.7617 15.3106 Constraint 363 683 12.9955 16.2443 24.3665 15.3106 Constraint 221 683 13.6622 17.0777 25.6166 15.3106 Constraint 213 683 16.4366 20.5458 30.8187 15.3106 Constraint 275 481 18.0218 22.5272 33.7909 15.3028 Constraint 58 659 17.1181 21.3976 32.0965 15.1998 Constraint 66 465 17.2602 21.5752 32.3628 15.0939 Constraint 3 633 7.7460 9.6825 14.5237 15.0000 Constraint 3 625 8.2733 10.3416 15.5124 15.0000 Constraint 51 194 17.4380 21.7975 32.6962 14.9939 Constraint 200 298 18.0542 22.5678 33.8517 14.9773 Constraint 200 671 13.9665 17.4581 26.1872 14.5011 Constraint 406 659 15.9600 19.9500 29.9250 14.4002 Constraint 194 323 18.2874 22.8593 34.2889 14.3905 Constraint 354 683 13.6691 17.0864 25.6296 14.3106 Constraint 349 683 13.3959 16.7448 25.1172 14.3106 Constraint 233 683 14.9138 18.6422 27.9633 14.3106 Constraint 283 509 18.0682 22.5853 33.8779 14.2145 Constraint 283 625 18.2753 22.8441 34.2661 14.1142 Constraint 17 671 10.6380 13.2975 19.9463 14.0999 Constraint 3 335 12.5529 15.6911 23.5367 14.0000 Constraint 3 310 16.3809 20.4761 30.7141 13.9999 Constraint 24 481 18.6295 23.2868 34.9303 13.9999 Constraint 92 429 16.8122 21.0153 31.5229 13.9808 Constraint 122 671 17.6946 22.1182 33.1774 13.9734 Constraint 456 659 16.8365 21.0456 31.5683 13.8021 Constraint 526 659 17.1002 21.3752 32.0628 13.7334 Constraint 264 671 17.3789 21.7236 32.5855 13.5381 Constraint 200 291 17.8885 22.3607 33.5410 13.3000 Constraint 275 406 16.5248 20.6560 30.9840 13.2024 Constraint 9 650 7.8587 9.8234 14.7350 13.1999 Constraint 24 683 13.5740 16.9675 25.4513 13.0999 Constraint 58 182 18.0283 22.5353 33.8030 13.0939 Constraint 264 429 18.2355 22.7944 34.1916 13.0882 Constraint 122 659 17.6215 22.0268 33.0402 13.0735 Constraint 3 315 16.6463 20.8079 31.2118 13.0000 Constraint 3 642 9.4328 11.7910 17.6866 13.0000 Constraint 3 418 18.1441 22.6801 34.0202 12.9999 Constraint 3 248 17.3337 21.6672 32.5008 12.9999 Constraint 97 429 17.6314 22.0392 33.0588 12.9929 Constraint 456 671 17.1200 21.4000 32.1001 12.4010 Constraint 168 323 17.8386 22.2982 33.4474 12.3904 Constraint 323 465 18.7590 23.4487 35.1731 12.3369 Constraint 275 671 16.8533 21.0666 31.6000 12.1370 Constraint 9 659 8.9767 11.2209 16.8314 12.0999 Constraint 17 488 18.4224 23.0280 34.5421 12.0999 Constraint 92 371 16.0937 20.1171 30.1757 12.0929 Constraint 3 581 17.4151 21.7688 32.6532 12.0000 Constraint 92 465 17.0296 21.2870 31.9305 11.9879 Constraint 207 683 13.7995 17.2494 25.8741 11.9735 Constraint 114 173 17.9754 22.4692 33.7039 11.7000 Constraint 342 683 15.9015 19.8768 29.8153 11.4369 Constraint 518 659 16.9314 21.1643 31.7464 11.4061 Constraint 257 683 16.4542 20.5677 30.8516 11.3106 Constraint 241 683 15.3034 19.1293 28.6939 11.3106 Constraint 24 106 18.7498 23.4372 35.1558 11.1999 Constraint 3 406 17.6668 22.0835 33.1253 11.0000 Constraint 3 200 16.9655 21.2068 31.8102 11.0000 Constraint 114 182 17.8287 22.2858 33.4287 10.9999 Constraint 3 497 18.1229 22.6536 33.9804 10.9999 Constraint 3 456 17.9110 22.3888 33.5832 10.9999 Constraint 9 572 18.8347 23.5434 35.3151 10.9998 Constraint 92 207 16.6630 20.8288 31.2431 10.9809 Constraint 148 683 17.3617 21.7022 32.5532 10.9736 Constraint 182 310 18.6297 23.2871 34.9307 10.6896 Constraint 291 671 16.7761 20.9702 31.4552 10.5381 Constraint 283 650 16.8251 21.0314 31.5471 10.3405 Constraint 9 465 17.2694 21.5868 32.3802 10.1999 Constraint 66 650 17.4463 21.8079 32.7118 10.1939 Constraint 84 443 18.2356 22.7945 34.1917 10.0964 Constraint 97 207 17.1632 21.4540 32.1810 10.0929 Constraint 182 291 18.4335 23.0419 34.5629 10.0894 Constraint 9 671 9.4574 11.8217 17.7326 10.0000 Constraint 3 142 18.3971 22.9964 34.4945 9.9999 Constraint 75 168 18.1539 22.6924 34.0385 9.9999 Constraint 200 572 18.0919 22.6148 33.9222 9.9894 Constraint 182 671 15.8867 19.8584 29.7875 9.5011 Constraint 581 671 15.7969 19.7461 29.6192 9.4120 Constraint 488 659 16.8537 21.0671 31.6007 9.4061 Constraint 443 683 14.4077 18.0096 27.0144 9.2107 Constraint 17 264 18.4551 23.0689 34.6034 9.1999 Constraint 371 692 13.0761 16.3451 24.5177 9.1000 Constraint 363 692 13.9219 17.4024 26.1036 9.1000 Constraint 354 692 14.6686 18.3357 27.5036 9.1000 Constraint 349 692 14.5851 18.2314 27.3471 9.1000 Constraint 221 692 13.9977 17.4971 26.2457 9.1000 Constraint 200 683 15.0569 18.8211 28.2317 9.0999 Constraint 17 683 12.8023 16.0029 24.0044 9.0999 Constraint 106 182 16.4516 20.5645 30.8467 9.0965 Constraint 106 173 16.4438 20.5547 30.8321 9.0964 Constraint 182 323 17.8243 22.2803 33.4205 9.0907 Constraint 173 335 17.0594 21.3243 31.9864 9.0000 Constraint 3 298 17.6130 22.0163 33.0244 9.0000 Constraint 3 291 18.3083 22.8854 34.3282 9.0000 Constraint 9 291 17.8295 22.2868 33.4302 8.9999 Constraint 58 173 18.4785 23.0982 34.6472 8.9998 Constraint 75 200 15.9318 19.9148 29.8721 8.9939 Constraint 354 559 17.8294 22.2868 33.4302 8.7438 Constraint 559 633 17.5947 21.9933 32.9900 8.7347 Constraint 283 659 17.5455 21.9319 32.8978 8.5396 Constraint 526 671 16.9246 21.1558 31.7337 8.4120 Constraint 406 671 16.0058 20.0072 30.0109 8.3119 Constraint 248 683 16.3223 20.4028 30.6043 8.3106 Constraint 275 543 16.7546 20.9433 31.4150 8.2144 Constraint 504 659 17.2839 21.6048 32.4072 8.1383 Constraint 572 659 15.1898 18.9872 28.4808 8.1253 Constraint 24 692 15.1235 18.9044 28.3566 8.1000 Constraint 194 683 14.9050 18.6312 27.9468 8.1000 Constraint 35 683 14.5192 18.1490 27.2235 8.0999 Constraint 106 194 16.9372 21.1715 31.7572 8.0964 Constraint 92 633 17.3000 21.6250 32.4375 8.0964 Constraint 3 572 18.2343 22.7928 34.1892 8.0000 Constraint 3 526 18.6534 23.3168 34.9751 8.0000 Constraint 3 122 17.9747 22.4684 33.7026 8.0000 Constraint 194 310 18.4906 23.1132 34.6698 8.0000 Constraint 194 291 18.5383 23.1728 34.7593 8.0000 Constraint 173 683 16.1295 20.1619 30.2428 7.9999 Constraint 3 194 16.0077 20.0096 30.0143 7.9999 Constraint 92 625 16.9820 21.2275 31.8413 7.9964 Constraint 97 168 15.6736 19.5920 29.3880 7.9929 Constraint 182 298 18.9746 23.7182 35.5773 7.9894 Constraint 168 310 16.9391 21.1738 31.7607 7.9894 Constraint 168 291 17.8971 22.3714 33.5571 7.9894 Constraint 142 683 17.9994 22.4992 33.7489 7.9736 Constraint 435 683 15.7923 19.7404 29.6106 7.3106 Constraint 315 456 18.4639 23.0798 34.6197 7.2031 Constraint 9 488 16.7319 20.9148 31.3722 7.1999 Constraint 51 168 18.1282 22.6603 33.9905 7.1000 Constraint 257 692 17.2882 21.6102 32.4153 7.1000 Constraint 241 692 15.5577 19.4472 29.1707 7.1000 Constraint 233 692 14.6073 18.2591 27.3887 7.1000 Constraint 106 642 18.5750 23.2188 34.8282 7.1000 Constraint 275 418 17.5036 21.8795 32.8193 7.0109 Constraint 168 335 18.0028 22.5035 33.7553 7.0000 Constraint 194 692 15.2474 19.0592 28.5889 7.0000 Constraint 173 692 16.2660 20.3326 30.4988 7.0000 Constraint 9 552 17.9082 22.3852 33.5778 6.9999 Constraint 9 264 18.1834 22.7292 34.0938 6.9999 Constraint 17 504 18.5891 23.2364 34.8546 6.9998 Constraint 134 683 17.0531 21.3164 31.9746 6.9736 Constraint 283 671 16.6376 20.7971 31.1956 6.5381 Constraint 418 671 15.6154 19.5192 29.2788 6.4383 Constraint 572 650 14.4569 18.0711 27.1066 6.4073 Constraint 465 671 17.0405 21.3006 31.9509 6.3370 Constraint 465 659 17.6935 22.1168 33.1753 6.3308 Constraint 595 683 14.9969 18.7461 28.1192 6.3107 Constraint 399 683 16.9116 21.1394 31.7092 6.3107 Constraint 315 488 17.7713 22.2142 33.3213 6.2933 Constraint 543 633 17.8169 22.2711 33.4067 6.2747 Constraint 114 194 17.2856 21.6070 32.4106 6.1011 Constraint 44 683 14.9246 18.6557 27.9836 6.0999 Constraint 17 465 18.1389 22.6736 34.0104 6.0999 Constraint 75 650 17.3670 21.7088 32.5631 6.0940 Constraint 481 659 18.1832 22.7290 34.0934 6.0120 Constraint 3 650 8.9177 11.1471 16.7207 6.0000 Constraint 3 66 17.8698 22.3373 33.5059 6.0000 Constraint 3 275 18.7994 23.4993 35.2489 6.0000 Constraint 3 264 18.6129 23.2661 34.8991 6.0000 Constraint 9 683 12.0636 15.0795 22.6192 6.0000 Constraint 168 683 14.9039 18.6299 27.9448 5.9999 Constraint 283 418 17.3901 21.7376 32.6064 5.9999 Constraint 84 642 18.6970 23.3713 35.0569 5.9998 Constraint 97 443 18.5365 23.1706 34.7559 5.9929 Constraint 168 275 18.1503 22.6879 34.0318 5.9894 Constraint 588 683 17.6035 22.0043 33.0065 5.4370 Constraint 323 683 15.2456 19.0571 28.5856 5.4370 Constraint 194 298 18.1723 22.7154 34.0731 5.4012 Constraint 66 194 17.3088 21.6360 32.4540 5.3951 Constraint 75 194 16.0386 20.0482 30.0723 5.3951 Constraint 518 671 16.0050 20.0063 30.0094 5.3120 Constraint 488 671 16.6387 20.7984 31.1975 5.3120 Constraint 283 481 17.9262 22.4077 33.6116 5.2145 Constraint 283 388 17.4566 21.8207 32.7311 5.2145 Constraint 315 481 18.3760 22.9701 34.4551 5.2040 Constraint 248 692 16.2522 20.3153 30.4729 5.1000 Constraint 17 692 16.6405 20.8006 31.2009 5.1000 Constraint 380 692 13.6240 17.0300 25.5450 5.1000 Constraint 342 692 15.1328 18.9159 28.3739 5.1000 Constraint 213 692 13.8194 17.2742 25.9113 5.1000 Constraint 207 692 11.6808 14.6009 21.9014 5.1000 Constraint 200 692 11.6464 14.5579 21.8369 5.1000 Constraint 148 692 15.8929 19.8661 29.7992 5.1000 Constraint 142 692 17.6649 22.0811 33.1217 5.1000 Constraint 51 683 16.8433 21.0541 31.5812 5.0999 Constraint 97 633 15.9499 19.9374 29.9061 5.0965 Constraint 504 671 17.0777 21.3471 32.0207 5.0371 Constraint 3 659 9.1557 11.4446 17.1669 5.0000 Constraint 168 572 18.6964 23.3705 35.0557 5.0000 Constraint 168 559 17.8360 22.2950 33.4426 5.0000 Constraint 472 692 16.8140 21.0175 31.5263 5.0000 Constraint 168 692 16.4099 20.5123 30.7685 5.0000 Constraint 3 173 11.8757 14.8446 22.2669 4.9999 Constraint 3 168 15.9106 19.8883 29.8324 4.9999 Constraint 17 275 17.9978 22.4972 33.7458 4.9999 Constraint 9 504 17.1926 21.4907 32.2361 4.9999 Constraint 9 275 18.4662 23.0828 34.6242 4.9999 Constraint 200 559 17.9266 22.4082 33.6123 4.9965 Constraint 75 182 16.7583 20.9479 31.4218 4.9940 Constraint 168 298 18.2495 22.8119 34.2179 4.9894 Constraint 114 650 17.7512 22.1890 33.2835 4.8735 Constraint 481 650 17.7659 22.2074 33.3111 4.7130 Constraint 173 310 18.6697 23.3372 35.0058 4.7001 Constraint 543 642 18.3272 22.9089 34.3634 4.6118 Constraint 173 323 18.7655 23.4568 35.1852 4.3906 Constraint 429 683 14.8651 18.5813 27.8720 4.3370 Constraint 504 683 18.4118 23.0148 34.5222 4.3107 Constraint 497 683 15.7831 19.7289 29.5934 4.3107 Constraint 472 683 16.4262 20.5328 30.7991 4.3107 Constraint 310 683 17.2581 21.5726 32.3590 4.3106 Constraint 305 683 16.3303 20.4129 30.6194 4.3106 Constraint 315 429 18.3318 22.9148 34.3722 4.2035 Constraint 35 692 13.3197 16.6496 24.9744 4.1000 Constraint 66 671 17.1632 21.4540 32.1810 4.1000 Constraint 335 683 14.0406 17.5507 26.3261 4.0999 Constraint 97 182 13.2508 16.5635 24.8453 4.0930 Constraint 552 650 17.2079 21.5099 32.2649 4.0070 Constraint 3 75 18.7806 23.4758 35.2137 4.0000 Constraint 24 275 18.5964 23.2455 34.8682 4.0000 Constraint 9 692 14.2647 17.8308 26.7462 4.0000 Constraint 3 683 14.7511 18.4389 27.6583 4.0000 Constraint 3 671 12.5161 15.6451 23.4677 4.0000 Constraint 51 173 18.3889 22.9861 34.4792 4.0000 Constraint 182 335 18.8043 23.5054 35.2580 4.0000 Constraint 194 572 18.4441 23.0551 34.5827 4.0000 Constraint 97 200 16.4502 20.5628 30.8442 3.9930 Constraint 97 194 15.4563 19.3204 28.9806 3.9930 Constraint 97 173 13.5199 16.8998 25.3498 3.9930 Constraint 92 443 17.9561 22.4451 33.6676 3.9930 Constraint 84 200 13.0038 16.2548 24.3822 3.9844 Constraint 92 200 12.1021 15.1277 22.6915 3.9809 Constraint 92 194 12.5289 15.6611 23.4916 3.9809 Constraint 92 182 10.0759 12.5948 18.8922 3.9809 Constraint 509 650 17.5983 21.9979 32.9968 3.7132 Constraint 552 671 18.0291 22.5364 33.8045 3.3370 Constraint 526 683 17.6863 22.1078 33.1618 3.3107 Constraint 518 683 17.1404 21.4255 32.1383 3.2107 Constraint 488 683 16.7240 20.9050 31.3574 3.2107 Constraint 406 683 17.3011 21.6264 32.4396 3.2107 Constraint 559 659 16.5776 20.7220 31.0831 3.1385 Constraint 509 659 17.0279 21.2849 31.9274 3.1385 Constraint 310 692 17.0341 21.2926 31.9389 3.1000 Constraint 275 692 18.5185 23.1481 34.7221 3.1000 Constraint 595 692 12.3505 15.4381 23.1572 3.1000 Constraint 323 692 15.6730 19.5912 29.3869 3.1000 Constraint 305 692 16.3153 20.3941 30.5912 3.1000 Constraint 134 692 15.9395 19.9243 29.8865 3.1000 Constraint 51 692 15.2872 19.1091 28.6636 3.1000 Constraint 66 659 17.7802 22.2253 33.3379 3.1000 Constraint 58 683 18.0484 22.5605 33.8407 3.1000 Constraint 200 275 18.3534 22.9417 34.4126 3.0000 Constraint 17 559 17.9170 22.3962 33.5943 3.0000 Constraint 24 92 17.9952 22.4940 33.7410 3.0000 Constraint 3 692 16.9624 21.2030 31.8045 3.0000 Constraint 603 692 9.8116 12.2645 18.3967 3.0000 Constraint 588 692 14.6485 18.3107 27.4660 3.0000 Constraint 581 692 16.3659 20.4573 30.6860 3.0000 Constraint 552 692 18.6188 23.2735 34.9102 3.0000 Constraint 526 692 16.2854 20.3567 30.5350 3.0000 Constraint 518 692 15.7902 19.7378 29.6066 3.0000 Constraint 497 692 13.8444 17.3055 25.9583 3.0000 Constraint 456 692 13.0839 16.3549 24.5324 3.0000 Constraint 443 692 7.8792 9.8490 14.7735 3.0000 Constraint 435 692 11.2131 14.0163 21.0245 3.0000 Constraint 429 692 10.2378 12.7973 19.1959 3.0000 Constraint 418 692 13.9259 17.4074 26.1111 3.0000 Constraint 406 692 15.7362 19.6703 29.5054 3.0000 Constraint 399 692 13.3538 16.6923 25.0384 3.0000 Constraint 388 692 7.6343 9.5429 14.3143 3.0000 Constraint 58 692 16.5292 20.6615 30.9923 3.0000 Constraint 44 692 12.4424 15.5530 23.3295 3.0000 Constraint 335 481 18.7783 23.4729 35.2093 3.0000 Constraint 315 443 19.0283 23.7854 35.6781 2.9999 Constraint 17 283 18.5923 23.2404 34.8606 2.9999 Constraint 17 114 19.0629 23.8287 35.7430 2.9999 Constraint 9 534 18.7561 23.4451 35.1677 2.9999 Constraint 9 509 18.5660 23.2075 34.8113 2.9999 Constraint 9 481 17.6508 22.0635 33.0952 2.9999 Constraint 9 114 17.7205 22.1506 33.2259 2.9999 Constraint 97 625 15.4326 19.2907 28.9361 2.9964 Constraint 51 182 18.9220 23.6525 35.4788 2.9940 Constraint 182 572 19.1667 23.9584 35.9376 2.9894 Constraint 168 315 18.3114 22.8893 34.3339 2.9894 Constraint 84 194 13.4284 16.7854 25.1782 2.9844 Constraint 84 182 11.5697 14.4621 21.6931 2.9844 Constraint 122 683 18.2038 22.7548 34.1322 2.9736 Constraint 572 671 14.3225 17.9031 26.8547 2.9108 Constraint 173 264 17.1847 21.4809 32.2214 2.8001 Constraint 552 659 17.0403 21.3003 31.9505 2.7382 Constraint 559 642 17.7777 22.2221 33.3331 2.7382 Constraint 315 683 15.2058 19.0073 28.5109 2.4370 Constraint 298 683 13.8806 17.3508 26.0262 2.4370 Constraint 275 683 16.2655 20.3319 30.4979 2.4370 Constraint 264 683 17.0435 21.3044 31.9566 2.4370 Constraint 465 683 16.8286 21.0357 31.5536 2.3370 Constraint 418 683 16.1649 20.2062 30.3093 2.3370 Constraint 275 488 15.6573 19.5716 29.3574 2.2146 Constraint 275 443 18.1757 22.7196 34.0794 2.2146 Constraint 534 659 17.5330 21.9163 32.8744 2.1385 Constraint 66 692 17.9262 22.4078 33.6117 2.1000 Constraint 456 683 14.5053 18.1316 27.1974 2.1000 Constraint 481 671 17.3542 21.6927 32.5391 2.0372 Constraint 3 552 18.9737 23.7172 35.5757 2.0000 Constraint 3 518 18.8860 23.6075 35.4112 2.0000 Constraint 75 173 18.0246 22.5308 33.7961 2.0000 Constraint 9 283 18.2864 22.8580 34.2870 2.0000 Constraint 9 75 18.1616 22.7020 34.0529 2.0000 Constraint 543 692 19.0183 23.7728 35.6593 2.0000 Constraint 509 692 17.3102 21.6378 32.4567 2.0000 Constraint 504 692 16.4800 20.6000 30.8999 2.0000 Constraint 488 692 13.7799 17.2249 25.8374 2.0000 Constraint 481 692 16.7343 20.9179 31.3769 2.0000 Constraint 465 692 13.3561 16.6951 25.0426 2.0000 Constraint 66 168 18.0879 22.6098 33.9148 2.0000 Constraint 3 472 18.2053 22.7566 34.1349 1.9999 Constraint 3 465 18.3280 22.9100 34.3650 1.9999 Constraint 97 642 12.1914 15.2393 22.8589 1.9965 Constraint 84 168 13.7978 17.2472 25.8708 1.9965 Constraint 92 173 5.3838 6.7297 10.0946 1.9930 Constraint 92 168 6.7426 8.4282 12.6423 1.9930 Constraint 173 291 17.6967 22.1209 33.1813 1.8001 Constraint 559 650 16.6533 20.8166 31.2249 1.7382 Constraint 173 298 18.6508 23.3135 34.9703 1.7001 Constraint 543 650 17.4289 21.7861 32.6791 1.6119 Constraint 291 683 15.4255 19.2819 28.9228 1.4370 Constraint 509 683 17.8832 22.3540 33.5309 1.2107 Constraint 481 683 17.6580 22.0725 33.1088 1.2107 Constraint 283 488 18.4844 23.1055 34.6583 1.2035 Constraint 283 456 15.8540 19.8174 29.7262 1.2035 Constraint 275 456 12.4459 15.5574 23.3360 1.2035 Constraint 207 283 18.4228 23.0286 34.5428 1.2035 Constraint 534 650 16.8965 21.1207 31.6810 1.1394 Constraint 335 692 8.1006 10.1258 15.1887 1.1000 Constraint 315 692 14.9142 18.6428 27.9642 1.1000 Constraint 298 692 15.4672 19.3340 29.0009 1.1000 Constraint 291 692 16.0970 20.1213 30.1819 1.1000 Constraint 283 692 18.4963 23.1203 34.6805 1.1000 Constraint 264 692 16.8330 21.0412 31.5619 1.1000 Constraint 122 692 15.7025 19.6281 29.4422 1.1000 Constraint 84 650 18.9919 23.7399 35.6098 1.1000 Constraint 106 650 17.3174 21.6467 32.4701 1.1000 Constraint 84 671 18.8506 23.5632 35.3449 1.1000 Constraint 75 671 16.0227 20.0284 30.0426 1.1000 Constraint 182 683 18.4071 23.0088 34.5132 1.1000 Constraint 66 683 17.5359 21.9199 32.8798 1.1000 Constraint 97 650 9.6656 12.0820 18.1230 1.0965 Constraint 559 671 12.1000 15.1250 22.6875 1.0372 Constraint 534 671 14.4930 18.1163 27.1744 1.0372 Constraint 509 671 15.3948 19.2435 28.8653 1.0372 Constraint 275 429 18.9045 23.6307 35.4460 1.0111 Constraint 572 692 17.1865 21.4832 32.2248 1.0000 Constraint 200 315 17.7245 22.1556 33.2334 1.0000 Constraint 114 692 18.9844 23.7305 35.5958 1.0000 Constraint 75 692 18.4379 23.0474 34.5711 1.0000 Constraint 9 84 19.0234 23.7793 35.6689 1.0000 Constraint 173 572 18.3255 22.9069 34.3604 1.0000 Constraint 173 559 18.2554 22.8193 34.2290 1.0000 Constraint 114 659 14.5894 18.2367 27.3551 1.0000 Constraint 106 659 16.3434 20.4293 30.6439 1.0000 Constraint 3 283 18.7216 23.4020 35.1030 1.0000 Constraint 24 283 17.6965 22.1206 33.1809 1.0000 Constraint 17 543 17.7575 22.1968 33.2952 1.0000 Constraint 17 534 18.4117 23.0146 34.5220 1.0000 Constraint 17 509 18.4540 23.0675 34.6012 1.0000 Constraint 3 182 11.2722 14.0902 21.1353 1.0000 Constraint 182 559 18.3976 22.9970 34.4956 0.9965 Constraint 97 659 11.4169 14.2711 21.4066 0.9965 Constraint 92 659 11.7786 14.7232 22.0848 0.9965 Constraint 92 650 8.0663 10.0828 15.1242 0.9965 Constraint 92 642 6.7873 8.4842 12.7263 0.9965 Constraint 84 173 9.2974 11.6217 17.4326 0.9965 Constraint 66 182 12.9447 16.1809 24.2713 0.9940 Constraint 173 275 16.8510 21.0637 31.5956 0.7001 Constraint 581 683 9.2512 11.5640 17.3460 0.4370 Constraint 283 683 11.8876 14.8595 22.2893 0.4370 Constraint 194 275 18.9033 23.6291 35.4437 0.4012 Constraint 572 683 3.9468 4.9334 7.4002 0.3370 Constraint 559 683 5.1083 6.3854 9.5781 0.3370 Constraint 552 683 8.0065 10.0081 15.0122 0.3370 Constraint 543 683 12.4103 15.5128 23.2692 0.3370 Constraint 543 671 12.1864 15.2330 22.8495 0.3370 Constraint 543 659 14.4461 18.0576 27.0865 0.3370 Constraint 534 683 12.1956 15.2445 22.8668 0.3370 Constraint 310 465 17.8183 22.2729 33.4094 0.3370 Constraint 275 465 15.5082 19.3853 29.0779 0.3370 Constraint 114 683 17.7134 22.1418 33.2127 0.1000 Constraint 114 671 18.2051 22.7563 34.1345 0.1000 Constraint 106 692 18.5365 23.1707 34.7560 0.1000 Constraint 106 683 17.3235 21.6544 32.4816 0.1000 Constraint 106 671 18.1222 22.6528 33.9792 0.1000 Constraint 92 671 18.9612 23.7015 35.5522 0.1000 Constraint 683 692 0.8000 1.0000 1.5000 0.0000 Constraint 671 692 0.8000 1.0000 1.5000 0.0000 Constraint 671 683 0.8000 1.0000 1.5000 0.0000 Constraint 659 692 0.8000 1.0000 1.5000 0.0000 Constraint 659 683 0.8000 1.0000 1.5000 0.0000 Constraint 659 671 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 683 0.8000 1.0000 1.5000 0.0000 Constraint 650 671 0.8000 1.0000 1.5000 0.0000 Constraint 650 659 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 683 0.8000 1.0000 1.5000 0.0000 Constraint 642 671 0.8000 1.0000 1.5000 0.0000 Constraint 642 659 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 633 692 0.8000 1.0000 1.5000 0.0000 Constraint 633 683 0.8000 1.0000 1.5000 0.0000 Constraint 633 671 0.8000 1.0000 1.5000 0.0000 Constraint 633 659 0.8000 1.0000 1.5000 0.0000 Constraint 633 650 0.8000 1.0000 1.5000 0.0000 Constraint 633 642 0.8000 1.0000 1.5000 0.0000 Constraint 625 692 0.8000 1.0000 1.5000 0.0000 Constraint 625 683 0.8000 1.0000 1.5000 0.0000 Constraint 625 671 0.8000 1.0000 1.5000 0.0000 Constraint 625 659 0.8000 1.0000 1.5000 0.0000 Constraint 625 650 0.8000 1.0000 1.5000 0.0000 Constraint 625 642 0.8000 1.0000 1.5000 0.0000 Constraint 625 633 0.8000 1.0000 1.5000 0.0000 Constraint 613 692 0.8000 1.0000 1.5000 0.0000 Constraint 613 683 0.8000 1.0000 1.5000 0.0000 Constraint 613 671 0.8000 1.0000 1.5000 0.0000 Constraint 613 659 0.8000 1.0000 1.5000 0.0000 Constraint 613 650 0.8000 1.0000 1.5000 0.0000 Constraint 613 642 0.8000 1.0000 1.5000 0.0000 Constraint 613 633 0.8000 1.0000 1.5000 0.0000 Constraint 613 625 0.8000 1.0000 1.5000 0.0000 Constraint 603 683 0.8000 1.0000 1.5000 0.0000 Constraint 603 671 0.8000 1.0000 1.5000 0.0000 Constraint 603 659 0.8000 1.0000 1.5000 0.0000 Constraint 603 650 0.8000 1.0000 1.5000 0.0000 Constraint 603 642 0.8000 1.0000 1.5000 0.0000 Constraint 603 633 0.8000 1.0000 1.5000 0.0000 Constraint 603 625 0.8000 1.0000 1.5000 0.0000 Constraint 603 613 0.8000 1.0000 1.5000 0.0000 Constraint 595 671 0.8000 1.0000 1.5000 0.0000 Constraint 595 659 0.8000 1.0000 1.5000 0.0000 Constraint 595 650 0.8000 1.0000 1.5000 0.0000 Constraint 595 642 0.8000 1.0000 1.5000 0.0000 Constraint 595 633 0.8000 1.0000 1.5000 0.0000 Constraint 595 625 0.8000 1.0000 1.5000 0.0000 Constraint 595 613 0.8000 1.0000 1.5000 0.0000 Constraint 595 603 0.8000 1.0000 1.5000 0.0000 Constraint 588 659 0.8000 1.0000 1.5000 0.0000 Constraint 588 650 0.8000 1.0000 1.5000 0.0000 Constraint 588 642 0.8000 1.0000 1.5000 0.0000 Constraint 588 633 0.8000 1.0000 1.5000 0.0000 Constraint 588 625 0.8000 1.0000 1.5000 0.0000 Constraint 588 613 0.8000 1.0000 1.5000 0.0000 Constraint 588 603 0.8000 1.0000 1.5000 0.0000 Constraint 588 595 0.8000 1.0000 1.5000 0.0000 Constraint 581 650 0.8000 1.0000 1.5000 0.0000 Constraint 581 642 0.8000 1.0000 1.5000 0.0000 Constraint 581 633 0.8000 1.0000 1.5000 0.0000 Constraint 581 625 0.8000 1.0000 1.5000 0.0000 Constraint 581 613 0.8000 1.0000 1.5000 0.0000 Constraint 581 603 0.8000 1.0000 1.5000 0.0000 Constraint 581 595 0.8000 1.0000 1.5000 0.0000 Constraint 581 588 0.8000 1.0000 1.5000 0.0000 Constraint 572 642 0.8000 1.0000 1.5000 0.0000 Constraint 572 633 0.8000 1.0000 1.5000 0.0000 Constraint 572 625 0.8000 1.0000 1.5000 0.0000 Constraint 572 613 0.8000 1.0000 1.5000 0.0000 Constraint 572 603 0.8000 1.0000 1.5000 0.0000 Constraint 572 595 0.8000 1.0000 1.5000 0.0000 Constraint 572 588 0.8000 1.0000 1.5000 0.0000 Constraint 572 581 0.8000 1.0000 1.5000 0.0000 Constraint 559 692 0.8000 1.0000 1.5000 0.0000 Constraint 559 625 0.8000 1.0000 1.5000 0.0000 Constraint 559 613 0.8000 1.0000 1.5000 0.0000 Constraint 559 603 0.8000 1.0000 1.5000 0.0000 Constraint 559 595 0.8000 1.0000 1.5000 0.0000 Constraint 559 588 0.8000 1.0000 1.5000 0.0000 Constraint 559 581 0.8000 1.0000 1.5000 0.0000 Constraint 559 572 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 603 0.8000 1.0000 1.5000 0.0000 Constraint 552 595 0.8000 1.0000 1.5000 0.0000 Constraint 552 588 0.8000 1.0000 1.5000 0.0000 Constraint 552 581 0.8000 1.0000 1.5000 0.0000 Constraint 552 572 0.8000 1.0000 1.5000 0.0000 Constraint 552 559 0.8000 1.0000 1.5000 0.0000 Constraint 543 603 0.8000 1.0000 1.5000 0.0000 Constraint 543 595 0.8000 1.0000 1.5000 0.0000 Constraint 543 588 0.8000 1.0000 1.5000 0.0000 Constraint 543 581 0.8000 1.0000 1.5000 0.0000 Constraint 543 572 0.8000 1.0000 1.5000 0.0000 Constraint 543 559 0.8000 1.0000 1.5000 0.0000 Constraint 543 552 0.8000 1.0000 1.5000 0.0000 Constraint 534 692 0.8000 1.0000 1.5000 0.0000 Constraint 534 595 0.8000 1.0000 1.5000 0.0000 Constraint 534 588 0.8000 1.0000 1.5000 0.0000 Constraint 534 581 0.8000 1.0000 1.5000 0.0000 Constraint 534 572 0.8000 1.0000 1.5000 0.0000 Constraint 534 559 0.8000 1.0000 1.5000 0.0000 Constraint 534 552 0.8000 1.0000 1.5000 0.0000 Constraint 534 543 0.8000 1.0000 1.5000 0.0000 Constraint 526 588 0.8000 1.0000 1.5000 0.0000 Constraint 526 581 0.8000 1.0000 1.5000 0.0000 Constraint 526 572 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 552 0.8000 1.0000 1.5000 0.0000 Constraint 526 543 0.8000 1.0000 1.5000 0.0000 Constraint 526 534 0.8000 1.0000 1.5000 0.0000 Constraint 518 581 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 559 0.8000 1.0000 1.5000 0.0000 Constraint 518 552 0.8000 1.0000 1.5000 0.0000 Constraint 518 543 0.8000 1.0000 1.5000 0.0000 Constraint 518 534 0.8000 1.0000 1.5000 0.0000 Constraint 518 526 0.8000 1.0000 1.5000 0.0000 Constraint 509 572 0.8000 1.0000 1.5000 0.0000 Constraint 509 559 0.8000 1.0000 1.5000 0.0000 Constraint 509 552 0.8000 1.0000 1.5000 0.0000 Constraint 509 543 0.8000 1.0000 1.5000 0.0000 Constraint 509 534 0.8000 1.0000 1.5000 0.0000 Constraint 509 526 0.8000 1.0000 1.5000 0.0000 Constraint 509 518 0.8000 1.0000 1.5000 0.0000 Constraint 504 559 0.8000 1.0000 1.5000 0.0000 Constraint 504 552 0.8000 1.0000 1.5000 0.0000 Constraint 504 543 0.8000 1.0000 1.5000 0.0000 Constraint 504 534 0.8000 1.0000 1.5000 0.0000 Constraint 504 526 0.8000 1.0000 1.5000 0.0000 Constraint 504 518 0.8000 1.0000 1.5000 0.0000 Constraint 504 509 0.8000 1.0000 1.5000 0.0000 Constraint 497 559 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 543 0.8000 1.0000 1.5000 0.0000 Constraint 497 534 0.8000 1.0000 1.5000 0.0000 Constraint 497 526 0.8000 1.0000 1.5000 0.0000 Constraint 497 518 0.8000 1.0000 1.5000 0.0000 Constraint 497 509 0.8000 1.0000 1.5000 0.0000 Constraint 497 504 0.8000 1.0000 1.5000 0.0000 Constraint 488 552 0.8000 1.0000 1.5000 0.0000 Constraint 488 543 0.8000 1.0000 1.5000 0.0000 Constraint 488 534 0.8000 1.0000 1.5000 0.0000 Constraint 488 526 0.8000 1.0000 1.5000 0.0000 Constraint 488 518 0.8000 1.0000 1.5000 0.0000 Constraint 488 509 0.8000 1.0000 1.5000 0.0000 Constraint 488 504 0.8000 1.0000 1.5000 0.0000 Constraint 488 497 0.8000 1.0000 1.5000 0.0000 Constraint 481 543 0.8000 1.0000 1.5000 0.0000 Constraint 481 534 0.8000 1.0000 1.5000 0.0000 Constraint 481 526 0.8000 1.0000 1.5000 0.0000 Constraint 481 518 0.8000 1.0000 1.5000 0.0000 Constraint 481 509 0.8000 1.0000 1.5000 0.0000 Constraint 481 504 0.8000 1.0000 1.5000 0.0000 Constraint 481 497 0.8000 1.0000 1.5000 0.0000 Constraint 481 488 0.8000 1.0000 1.5000 0.0000 Constraint 472 534 0.8000 1.0000 1.5000 0.0000 Constraint 472 526 0.8000 1.0000 1.5000 0.0000 Constraint 472 518 0.8000 1.0000 1.5000 0.0000 Constraint 472 509 0.8000 1.0000 1.5000 0.0000 Constraint 472 504 0.8000 1.0000 1.5000 0.0000 Constraint 472 497 0.8000 1.0000 1.5000 0.0000 Constraint 472 488 0.8000 1.0000 1.5000 0.0000 Constraint 472 481 0.8000 1.0000 1.5000 0.0000 Constraint 465 526 0.8000 1.0000 1.5000 0.0000 Constraint 465 518 0.8000 1.0000 1.5000 0.0000 Constraint 465 509 0.8000 1.0000 1.5000 0.0000 Constraint 465 504 0.8000 1.0000 1.5000 0.0000 Constraint 465 497 0.8000 1.0000 1.5000 0.0000 Constraint 465 488 0.8000 1.0000 1.5000 0.0000 Constraint 465 481 0.8000 1.0000 1.5000 0.0000 Constraint 465 472 0.8000 1.0000 1.5000 0.0000 Constraint 456 518 0.8000 1.0000 1.5000 0.0000 Constraint 456 509 0.8000 1.0000 1.5000 0.0000 Constraint 456 504 0.8000 1.0000 1.5000 0.0000 Constraint 456 497 0.8000 1.0000 1.5000 0.0000 Constraint 456 488 0.8000 1.0000 1.5000 0.0000 Constraint 456 481 0.8000 1.0000 1.5000 0.0000 Constraint 456 472 0.8000 1.0000 1.5000 0.0000 Constraint 456 465 0.8000 1.0000 1.5000 0.0000 Constraint 443 504 0.8000 1.0000 1.5000 0.0000 Constraint 443 497 0.8000 1.0000 1.5000 0.0000 Constraint 443 488 0.8000 1.0000 1.5000 0.0000 Constraint 443 481 0.8000 1.0000 1.5000 0.0000 Constraint 443 472 0.8000 1.0000 1.5000 0.0000 Constraint 443 465 0.8000 1.0000 1.5000 0.0000 Constraint 443 456 0.8000 1.0000 1.5000 0.0000 Constraint 435 497 0.8000 1.0000 1.5000 0.0000 Constraint 435 488 0.8000 1.0000 1.5000 0.0000 Constraint 435 481 0.8000 1.0000 1.5000 0.0000 Constraint 435 472 0.8000 1.0000 1.5000 0.0000 Constraint 435 465 0.8000 1.0000 1.5000 0.0000 Constraint 435 456 0.8000 1.0000 1.5000 0.0000 Constraint 435 443 0.8000 1.0000 1.5000 0.0000 Constraint 429 488 0.8000 1.0000 1.5000 0.0000 Constraint 429 481 0.8000 1.0000 1.5000 0.0000 Constraint 429 472 0.8000 1.0000 1.5000 0.0000 Constraint 429 465 0.8000 1.0000 1.5000 0.0000 Constraint 429 456 0.8000 1.0000 1.5000 0.0000 Constraint 429 443 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 418 481 0.8000 1.0000 1.5000 0.0000 Constraint 418 472 0.8000 1.0000 1.5000 0.0000 Constraint 418 465 0.8000 1.0000 1.5000 0.0000 Constraint 418 456 0.8000 1.0000 1.5000 0.0000 Constraint 418 443 0.8000 1.0000 1.5000 0.0000 Constraint 418 435 0.8000 1.0000 1.5000 0.0000 Constraint 418 429 0.8000 1.0000 1.5000 0.0000 Constraint 406 465 0.8000 1.0000 1.5000 0.0000 Constraint 406 456 0.8000 1.0000 1.5000 0.0000 Constraint 406 443 0.8000 1.0000 1.5000 0.0000 Constraint 406 435 0.8000 1.0000 1.5000 0.0000 Constraint 406 429 0.8000 1.0000 1.5000 0.0000 Constraint 406 418 0.8000 1.0000 1.5000 0.0000 Constraint 399 456 0.8000 1.0000 1.5000 0.0000 Constraint 399 443 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 418 0.8000 1.0000 1.5000 0.0000 Constraint 399 406 0.8000 1.0000 1.5000 0.0000 Constraint 388 443 0.8000 1.0000 1.5000 0.0000 Constraint 388 435 0.8000 1.0000 1.5000 0.0000 Constraint 388 429 0.8000 1.0000 1.5000 0.0000 Constraint 388 418 0.8000 1.0000 1.5000 0.0000 Constraint 388 406 0.8000 1.0000 1.5000 0.0000 Constraint 388 399 0.8000 1.0000 1.5000 0.0000 Constraint 380 435 0.8000 1.0000 1.5000 0.0000 Constraint 380 429 0.8000 1.0000 1.5000 0.0000 Constraint 380 418 0.8000 1.0000 1.5000 0.0000 Constraint 380 406 0.8000 1.0000 1.5000 0.0000 Constraint 380 399 0.8000 1.0000 1.5000 0.0000 Constraint 380 388 0.8000 1.0000 1.5000 0.0000 Constraint 371 429 0.8000 1.0000 1.5000 0.0000 Constraint 371 418 0.8000 1.0000 1.5000 0.0000 Constraint 371 406 0.8000 1.0000 1.5000 0.0000 Constraint 371 399 0.8000 1.0000 1.5000 0.0000 Constraint 371 388 0.8000 1.0000 1.5000 0.0000 Constraint 371 380 0.8000 1.0000 1.5000 0.0000 Constraint 363 418 0.8000 1.0000 1.5000 0.0000 Constraint 363 406 0.8000 1.0000 1.5000 0.0000 Constraint 363 399 0.8000 1.0000 1.5000 0.0000 Constraint 363 388 0.8000 1.0000 1.5000 0.0000 Constraint 363 380 0.8000 1.0000 1.5000 0.0000 Constraint 363 371 0.8000 1.0000 1.5000 0.0000 Constraint 354 406 0.8000 1.0000 1.5000 0.0000 Constraint 354 399 0.8000 1.0000 1.5000 0.0000 Constraint 354 388 0.8000 1.0000 1.5000 0.0000 Constraint 354 380 0.8000 1.0000 1.5000 0.0000 Constraint 354 371 0.8000 1.0000 1.5000 0.0000 Constraint 354 363 0.8000 1.0000 1.5000 0.0000 Constraint 349 399 0.8000 1.0000 1.5000 0.0000 Constraint 349 388 0.8000 1.0000 1.5000 0.0000 Constraint 349 380 0.8000 1.0000 1.5000 0.0000 Constraint 349 371 0.8000 1.0000 1.5000 0.0000 Constraint 349 363 0.8000 1.0000 1.5000 0.0000 Constraint 349 354 0.8000 1.0000 1.5000 0.0000 Constraint 342 388 0.8000 1.0000 1.5000 0.0000 Constraint 342 380 0.8000 1.0000 1.5000 0.0000 Constraint 342 371 0.8000 1.0000 1.5000 0.0000 Constraint 342 363 0.8000 1.0000 1.5000 0.0000 Constraint 342 354 0.8000 1.0000 1.5000 0.0000 Constraint 342 349 0.8000 1.0000 1.5000 0.0000 Constraint 335 465 0.8000 1.0000 1.5000 0.0000 Constraint 335 388 0.8000 1.0000 1.5000 0.0000 Constraint 335 380 0.8000 1.0000 1.5000 0.0000 Constraint 335 371 0.8000 1.0000 1.5000 0.0000 Constraint 335 363 0.8000 1.0000 1.5000 0.0000 Constraint 335 354 0.8000 1.0000 1.5000 0.0000 Constraint 335 349 0.8000 1.0000 1.5000 0.0000 Constraint 335 342 0.8000 1.0000 1.5000 0.0000 Constraint 323 371 0.8000 1.0000 1.5000 0.0000 Constraint 323 363 0.8000 1.0000 1.5000 0.0000 Constraint 323 354 0.8000 1.0000 1.5000 0.0000 Constraint 323 349 0.8000 1.0000 1.5000 0.0000 Constraint 323 342 0.8000 1.0000 1.5000 0.0000 Constraint 323 335 0.8000 1.0000 1.5000 0.0000 Constraint 315 465 0.8000 1.0000 1.5000 0.0000 Constraint 315 363 0.8000 1.0000 1.5000 0.0000 Constraint 315 354 0.8000 1.0000 1.5000 0.0000 Constraint 315 349 0.8000 1.0000 1.5000 0.0000 Constraint 315 342 0.8000 1.0000 1.5000 0.0000 Constraint 315 335 0.8000 1.0000 1.5000 0.0000 Constraint 315 323 0.8000 1.0000 1.5000 0.0000 Constraint 310 354 0.8000 1.0000 1.5000 0.0000 Constraint 310 349 0.8000 1.0000 1.5000 0.0000 Constraint 310 342 0.8000 1.0000 1.5000 0.0000 Constraint 310 335 0.8000 1.0000 1.5000 0.0000 Constraint 310 323 0.8000 1.0000 1.5000 0.0000 Constraint 310 315 0.8000 1.0000 1.5000 0.0000 Constraint 305 354 0.8000 1.0000 1.5000 0.0000 Constraint 305 349 0.8000 1.0000 1.5000 0.0000 Constraint 305 342 0.8000 1.0000 1.5000 0.0000 Constraint 305 335 0.8000 1.0000 1.5000 0.0000 Constraint 305 323 0.8000 1.0000 1.5000 0.0000 Constraint 305 315 0.8000 1.0000 1.5000 0.0000 Constraint 305 310 0.8000 1.0000 1.5000 0.0000 Constraint 298 349 0.8000 1.0000 1.5000 0.0000 Constraint 298 342 0.8000 1.0000 1.5000 0.0000 Constraint 298 335 0.8000 1.0000 1.5000 0.0000 Constraint 298 323 0.8000 1.0000 1.5000 0.0000 Constraint 298 315 0.8000 1.0000 1.5000 0.0000 Constraint 298 310 0.8000 1.0000 1.5000 0.0000 Constraint 298 305 0.8000 1.0000 1.5000 0.0000 Constraint 291 342 0.8000 1.0000 1.5000 0.0000 Constraint 291 335 0.8000 1.0000 1.5000 0.0000 Constraint 291 323 0.8000 1.0000 1.5000 0.0000 Constraint 291 315 0.8000 1.0000 1.5000 0.0000 Constraint 291 310 0.8000 1.0000 1.5000 0.0000 Constraint 291 305 0.8000 1.0000 1.5000 0.0000 Constraint 291 298 0.8000 1.0000 1.5000 0.0000 Constraint 283 465 0.8000 1.0000 1.5000 0.0000 Constraint 283 443 0.8000 1.0000 1.5000 0.0000 Constraint 283 429 0.8000 1.0000 1.5000 0.0000 Constraint 283 335 0.8000 1.0000 1.5000 0.0000 Constraint 283 323 0.8000 1.0000 1.5000 0.0000 Constraint 283 315 0.8000 1.0000 1.5000 0.0000 Constraint 283 310 0.8000 1.0000 1.5000 0.0000 Constraint 283 305 0.8000 1.0000 1.5000 0.0000 Constraint 283 298 0.8000 1.0000 1.5000 0.0000 Constraint 283 291 0.8000 1.0000 1.5000 0.0000 Constraint 275 323 0.8000 1.0000 1.5000 0.0000 Constraint 275 315 0.8000 1.0000 1.5000 0.0000 Constraint 275 310 0.8000 1.0000 1.5000 0.0000 Constraint 275 305 0.8000 1.0000 1.5000 0.0000 Constraint 275 298 0.8000 1.0000 1.5000 0.0000 Constraint 275 291 0.8000 1.0000 1.5000 0.0000 Constraint 275 283 0.8000 1.0000 1.5000 0.0000 Constraint 264 323 0.8000 1.0000 1.5000 0.0000 Constraint 264 315 0.8000 1.0000 1.5000 0.0000 Constraint 264 310 0.8000 1.0000 1.5000 0.0000 Constraint 264 305 0.8000 1.0000 1.5000 0.0000 Constraint 264 298 0.8000 1.0000 1.5000 0.0000 Constraint 264 291 0.8000 1.0000 1.5000 0.0000 Constraint 264 283 0.8000 1.0000 1.5000 0.0000 Constraint 264 275 0.8000 1.0000 1.5000 0.0000 Constraint 257 315 0.8000 1.0000 1.5000 0.0000 Constraint 257 310 0.8000 1.0000 1.5000 0.0000 Constraint 257 305 0.8000 1.0000 1.5000 0.0000 Constraint 257 298 0.8000 1.0000 1.5000 0.0000 Constraint 257 291 0.8000 1.0000 1.5000 0.0000 Constraint 257 283 0.8000 1.0000 1.5000 0.0000 Constraint 257 275 0.8000 1.0000 1.5000 0.0000 Constraint 257 264 0.8000 1.0000 1.5000 0.0000 Constraint 248 310 0.8000 1.0000 1.5000 0.0000 Constraint 248 305 0.8000 1.0000 1.5000 0.0000 Constraint 248 298 0.8000 1.0000 1.5000 0.0000 Constraint 248 291 0.8000 1.0000 1.5000 0.0000 Constraint 248 283 0.8000 1.0000 1.5000 0.0000 Constraint 248 275 0.8000 1.0000 1.5000 0.0000 Constraint 248 264 0.8000 1.0000 1.5000 0.0000 Constraint 248 257 0.8000 1.0000 1.5000 0.0000 Constraint 241 305 0.8000 1.0000 1.5000 0.0000 Constraint 241 298 0.8000 1.0000 1.5000 0.0000 Constraint 241 291 0.8000 1.0000 1.5000 0.0000 Constraint 241 283 0.8000 1.0000 1.5000 0.0000 Constraint 241 275 0.8000 1.0000 1.5000 0.0000 Constraint 241 264 0.8000 1.0000 1.5000 0.0000 Constraint 241 257 0.8000 1.0000 1.5000 0.0000 Constraint 241 248 0.8000 1.0000 1.5000 0.0000 Constraint 233 298 0.8000 1.0000 1.5000 0.0000 Constraint 233 291 0.8000 1.0000 1.5000 0.0000 Constraint 233 283 0.8000 1.0000 1.5000 0.0000 Constraint 233 275 0.8000 1.0000 1.5000 0.0000 Constraint 233 264 0.8000 1.0000 1.5000 0.0000 Constraint 233 257 0.8000 1.0000 1.5000 0.0000 Constraint 233 248 0.8000 1.0000 1.5000 0.0000 Constraint 233 241 0.8000 1.0000 1.5000 0.0000 Constraint 221 291 0.8000 1.0000 1.5000 0.0000 Constraint 221 283 0.8000 1.0000 1.5000 0.0000 Constraint 221 275 0.8000 1.0000 1.5000 0.0000 Constraint 221 264 0.8000 1.0000 1.5000 0.0000 Constraint 221 257 0.8000 1.0000 1.5000 0.0000 Constraint 221 248 0.8000 1.0000 1.5000 0.0000 Constraint 221 241 0.8000 1.0000 1.5000 0.0000 Constraint 221 233 0.8000 1.0000 1.5000 0.0000 Constraint 213 283 0.8000 1.0000 1.5000 0.0000 Constraint 213 275 0.8000 1.0000 1.5000 0.0000 Constraint 213 264 0.8000 1.0000 1.5000 0.0000 Constraint 213 257 0.8000 1.0000 1.5000 0.0000 Constraint 213 248 0.8000 1.0000 1.5000 0.0000 Constraint 213 241 0.8000 1.0000 1.5000 0.0000 Constraint 213 233 0.8000 1.0000 1.5000 0.0000 Constraint 213 221 0.8000 1.0000 1.5000 0.0000 Constraint 207 275 0.8000 1.0000 1.5000 0.0000 Constraint 207 264 0.8000 1.0000 1.5000 0.0000 Constraint 207 257 0.8000 1.0000 1.5000 0.0000 Constraint 207 248 0.8000 1.0000 1.5000 0.0000 Constraint 207 241 0.8000 1.0000 1.5000 0.0000 Constraint 207 233 0.8000 1.0000 1.5000 0.0000 Constraint 207 221 0.8000 1.0000 1.5000 0.0000 Constraint 207 213 0.8000 1.0000 1.5000 0.0000 Constraint 200 283 0.8000 1.0000 1.5000 0.0000 Constraint 200 264 0.8000 1.0000 1.5000 0.0000 Constraint 200 257 0.8000 1.0000 1.5000 0.0000 Constraint 200 248 0.8000 1.0000 1.5000 0.0000 Constraint 200 241 0.8000 1.0000 1.5000 0.0000 Constraint 200 233 0.8000 1.0000 1.5000 0.0000 Constraint 200 221 0.8000 1.0000 1.5000 0.0000 Constraint 200 213 0.8000 1.0000 1.5000 0.0000 Constraint 200 207 0.8000 1.0000 1.5000 0.0000 Constraint 194 559 0.8000 1.0000 1.5000 0.0000 Constraint 194 315 0.8000 1.0000 1.5000 0.0000 Constraint 194 283 0.8000 1.0000 1.5000 0.0000 Constraint 194 257 0.8000 1.0000 1.5000 0.0000 Constraint 194 248 0.8000 1.0000 1.5000 0.0000 Constraint 194 241 0.8000 1.0000 1.5000 0.0000 Constraint 194 233 0.8000 1.0000 1.5000 0.0000 Constraint 194 221 0.8000 1.0000 1.5000 0.0000 Constraint 194 213 0.8000 1.0000 1.5000 0.0000 Constraint 194 207 0.8000 1.0000 1.5000 0.0000 Constraint 194 200 0.8000 1.0000 1.5000 0.0000 Constraint 182 692 0.8000 1.0000 1.5000 0.0000 Constraint 182 315 0.8000 1.0000 1.5000 0.0000 Constraint 182 283 0.8000 1.0000 1.5000 0.0000 Constraint 182 275 0.8000 1.0000 1.5000 0.0000 Constraint 182 248 0.8000 1.0000 1.5000 0.0000 Constraint 182 241 0.8000 1.0000 1.5000 0.0000 Constraint 182 233 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 213 0.8000 1.0000 1.5000 0.0000 Constraint 182 207 0.8000 1.0000 1.5000 0.0000 Constraint 182 200 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 173 315 0.8000 1.0000 1.5000 0.0000 Constraint 173 283 0.8000 1.0000 1.5000 0.0000 Constraint 173 241 0.8000 1.0000 1.5000 0.0000 Constraint 173 233 0.8000 1.0000 1.5000 0.0000 Constraint 173 221 0.8000 1.0000 1.5000 0.0000 Constraint 173 213 0.8000 1.0000 1.5000 0.0000 Constraint 173 207 0.8000 1.0000 1.5000 0.0000 Constraint 173 200 0.8000 1.0000 1.5000 0.0000 Constraint 173 194 0.8000 1.0000 1.5000 0.0000 Constraint 173 182 0.8000 1.0000 1.5000 0.0000 Constraint 168 283 0.8000 1.0000 1.5000 0.0000 Constraint 168 233 0.8000 1.0000 1.5000 0.0000 Constraint 168 221 0.8000 1.0000 1.5000 0.0000 Constraint 168 213 0.8000 1.0000 1.5000 0.0000 Constraint 168 207 0.8000 1.0000 1.5000 0.0000 Constraint 168 200 0.8000 1.0000 1.5000 0.0000 Constraint 168 194 0.8000 1.0000 1.5000 0.0000 Constraint 168 182 0.8000 1.0000 1.5000 0.0000 Constraint 168 173 0.8000 1.0000 1.5000 0.0000 Constraint 148 200 0.8000 1.0000 1.5000 0.0000 Constraint 148 194 0.8000 1.0000 1.5000 0.0000 Constraint 148 182 0.8000 1.0000 1.5000 0.0000 Constraint 148 173 0.8000 1.0000 1.5000 0.0000 Constraint 148 168 0.8000 1.0000 1.5000 0.0000 Constraint 142 194 0.8000 1.0000 1.5000 0.0000 Constraint 142 182 0.8000 1.0000 1.5000 0.0000 Constraint 142 173 0.8000 1.0000 1.5000 0.0000 Constraint 142 168 0.8000 1.0000 1.5000 0.0000 Constraint 142 148 0.8000 1.0000 1.5000 0.0000 Constraint 134 182 0.8000 1.0000 1.5000 0.0000 Constraint 134 173 0.8000 1.0000 1.5000 0.0000 Constraint 134 168 0.8000 1.0000 1.5000 0.0000 Constraint 134 148 0.8000 1.0000 1.5000 0.0000 Constraint 134 142 0.8000 1.0000 1.5000 0.0000 Constraint 122 168 0.8000 1.0000 1.5000 0.0000 Constraint 122 148 0.8000 1.0000 1.5000 0.0000 Constraint 122 142 0.8000 1.0000 1.5000 0.0000 Constraint 122 134 0.8000 1.0000 1.5000 0.0000 Constraint 114 148 0.8000 1.0000 1.5000 0.0000 Constraint 114 142 0.8000 1.0000 1.5000 0.0000 Constraint 114 134 0.8000 1.0000 1.5000 0.0000 Constraint 114 122 0.8000 1.0000 1.5000 0.0000 Constraint 106 148 0.8000 1.0000 1.5000 0.0000 Constraint 106 142 0.8000 1.0000 1.5000 0.0000 Constraint 106 134 0.8000 1.0000 1.5000 0.0000 Constraint 106 122 0.8000 1.0000 1.5000 0.0000 Constraint 106 114 0.8000 1.0000 1.5000 0.0000 Constraint 97 692 0.8000 1.0000 1.5000 0.0000 Constraint 97 683 0.8000 1.0000 1.5000 0.0000 Constraint 97 671 0.8000 1.0000 1.5000 0.0000 Constraint 97 148 0.8000 1.0000 1.5000 0.0000 Constraint 97 142 0.8000 1.0000 1.5000 0.0000 Constraint 97 134 0.8000 1.0000 1.5000 0.0000 Constraint 97 122 0.8000 1.0000 1.5000 0.0000 Constraint 97 114 0.8000 1.0000 1.5000 0.0000 Constraint 97 106 0.8000 1.0000 1.5000 0.0000 Constraint 92 692 0.8000 1.0000 1.5000 0.0000 Constraint 92 683 0.8000 1.0000 1.5000 0.0000 Constraint 92 148 0.8000 1.0000 1.5000 0.0000 Constraint 92 142 0.8000 1.0000 1.5000 0.0000 Constraint 92 134 0.8000 1.0000 1.5000 0.0000 Constraint 92 122 0.8000 1.0000 1.5000 0.0000 Constraint 92 114 0.8000 1.0000 1.5000 0.0000 Constraint 92 106 0.8000 1.0000 1.5000 0.0000 Constraint 92 97 0.8000 1.0000 1.5000 0.0000 Constraint 84 692 0.8000 1.0000 1.5000 0.0000 Constraint 84 683 0.8000 1.0000 1.5000 0.0000 Constraint 84 659 0.8000 1.0000 1.5000 0.0000 Constraint 84 142 0.8000 1.0000 1.5000 0.0000 Constraint 84 134 0.8000 1.0000 1.5000 0.0000 Constraint 84 122 0.8000 1.0000 1.5000 0.0000 Constraint 84 114 0.8000 1.0000 1.5000 0.0000 Constraint 84 106 0.8000 1.0000 1.5000 0.0000 Constraint 84 97 0.8000 1.0000 1.5000 0.0000 Constraint 84 92 0.8000 1.0000 1.5000 0.0000 Constraint 75 683 0.8000 1.0000 1.5000 0.0000 Constraint 75 659 0.8000 1.0000 1.5000 0.0000 Constraint 75 134 0.8000 1.0000 1.5000 0.0000 Constraint 75 122 0.8000 1.0000 1.5000 0.0000 Constraint 75 114 0.8000 1.0000 1.5000 0.0000 Constraint 75 106 0.8000 1.0000 1.5000 0.0000 Constraint 75 97 0.8000 1.0000 1.5000 0.0000 Constraint 75 92 0.8000 1.0000 1.5000 0.0000 Constraint 75 84 0.8000 1.0000 1.5000 0.0000 Constraint 66 173 0.8000 1.0000 1.5000 0.0000 Constraint 66 122 0.8000 1.0000 1.5000 0.0000 Constraint 66 114 0.8000 1.0000 1.5000 0.0000 Constraint 66 106 0.8000 1.0000 1.5000 0.0000 Constraint 66 97 0.8000 1.0000 1.5000 0.0000 Constraint 66 92 0.8000 1.0000 1.5000 0.0000 Constraint 66 84 0.8000 1.0000 1.5000 0.0000 Constraint 66 75 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 114 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 97 0.8000 1.0000 1.5000 0.0000 Constraint 58 92 0.8000 1.0000 1.5000 0.0000 Constraint 58 84 0.8000 1.0000 1.5000 0.0000 Constraint 58 75 0.8000 1.0000 1.5000 0.0000 Constraint 58 66 0.8000 1.0000 1.5000 0.0000 Constraint 51 114 0.8000 1.0000 1.5000 0.0000 Constraint 51 106 0.8000 1.0000 1.5000 0.0000 Constraint 51 97 0.8000 1.0000 1.5000 0.0000 Constraint 51 92 0.8000 1.0000 1.5000 0.0000 Constraint 51 84 0.8000 1.0000 1.5000 0.0000 Constraint 51 75 0.8000 1.0000 1.5000 0.0000 Constraint 51 66 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 44 106 0.8000 1.0000 1.5000 0.0000 Constraint 44 97 0.8000 1.0000 1.5000 0.0000 Constraint 44 92 0.8000 1.0000 1.5000 0.0000 Constraint 44 84 0.8000 1.0000 1.5000 0.0000 Constraint 44 75 0.8000 1.0000 1.5000 0.0000 Constraint 44 66 0.8000 1.0000 1.5000 0.0000 Constraint 44 58 0.8000 1.0000 1.5000 0.0000 Constraint 44 51 0.8000 1.0000 1.5000 0.0000 Constraint 35 97 0.8000 1.0000 1.5000 0.0000 Constraint 35 92 0.8000 1.0000 1.5000 0.0000 Constraint 35 84 0.8000 1.0000 1.5000 0.0000 Constraint 35 75 0.8000 1.0000 1.5000 0.0000 Constraint 35 66 0.8000 1.0000 1.5000 0.0000 Constraint 35 58 0.8000 1.0000 1.5000 0.0000 Constraint 35 51 0.8000 1.0000 1.5000 0.0000 Constraint 35 44 0.8000 1.0000 1.5000 0.0000 Constraint 24 97 0.8000 1.0000 1.5000 0.0000 Constraint 24 84 0.8000 1.0000 1.5000 0.0000 Constraint 24 75 0.8000 1.0000 1.5000 0.0000 Constraint 24 66 0.8000 1.0000 1.5000 0.0000 Constraint 24 58 0.8000 1.0000 1.5000 0.0000 Constraint 24 51 0.8000 1.0000 1.5000 0.0000 Constraint 24 44 0.8000 1.0000 1.5000 0.0000 Constraint 24 35 0.8000 1.0000 1.5000 0.0000 Constraint 17 481 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 92 0.8000 1.0000 1.5000 0.0000 Constraint 17 84 0.8000 1.0000 1.5000 0.0000 Constraint 17 75 0.8000 1.0000 1.5000 0.0000 Constraint 17 66 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 51 0.8000 1.0000 1.5000 0.0000 Constraint 17 44 0.8000 1.0000 1.5000 0.0000 Constraint 17 35 0.8000 1.0000 1.5000 0.0000 Constraint 17 24 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 543 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 92 0.8000 1.0000 1.5000 0.0000 Constraint 9 66 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 51 0.8000 1.0000 1.5000 0.0000 Constraint 9 44 0.8000 1.0000 1.5000 0.0000 Constraint 9 35 0.8000 1.0000 1.5000 0.0000 Constraint 9 24 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 543 0.8000 1.0000 1.5000 0.0000 Constraint 3 534 0.8000 1.0000 1.5000 0.0000 Constraint 3 509 0.8000 1.0000 1.5000 0.0000 Constraint 3 504 0.8000 1.0000 1.5000 0.0000 Constraint 3 488 0.8000 1.0000 1.5000 0.0000 Constraint 3 481 0.8000 1.0000 1.5000 0.0000 Constraint 3 114 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 92 0.8000 1.0000 1.5000 0.0000 Constraint 3 84 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 44 0.8000 1.0000 1.5000 0.0000 Constraint 3 35 0.8000 1.0000 1.5000 0.0000 Constraint 3 24 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: