parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 23.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint (T0288)N58.CB (T0288)M73.CB 4.5610 7.6017 9.8822 100.2126 Constraint (T0288)N58.CB (T0288)K72.CB 7.4492 12.4154 16.1400 100.2126 Constraint (T0288)N58.CB (T0288)A71.CB 8.3357 13.8928 18.0606 100.2126 Constraint (T0288)N58.CB (T0288)V70.CB 6.9225 11.5375 14.9988 100.2126 Constraint (T0288)N58.CB (T0288)E69.CB 7.9477 13.2461 17.2199 100.2126 Constraint (T0288)N58.CB (T0288)V68.CB 10.2834 17.1390 22.2807 100.2126 Constraint (T0288)V57.CB (T0288)M73.CB 3.2260 5.3766 6.9896 100.2126 Constraint (T0288)V57.CB (T0288)K72.CB 6.1907 10.3178 13.4131 100.2126 Constraint (T0288)V57.CB (T0288)A71.CB 6.2412 10.4019 13.5225 100.2126 Constraint (T0288)V57.CB (T0288)V70.CB 4.3155 7.1925 9.3503 100.2126 Constraint (T0288)V57.CB (T0288)E69.CB 6.0575 10.0958 13.1245 100.2126 Constraint (T0288)V57.CB (T0288)V68.CB 8.1973 13.6621 17.7607 100.2126 Constraint (T0288)T55.CB (T0288)M73.CB 7.5868 12.6446 16.4380 100.2126 Constraint (T0288)T55.CB (T0288)K72.CB 10.1310 16.8850 21.9505 100.2126 Constraint (T0288)T55.CB (T0288)A71.CB 9.4567 15.7611 20.4895 100.2126 Constraint (T0288)T55.CB (T0288)V70.CB 6.5064 10.8440 14.0972 100.2126 Constraint (T0288)T55.CB (T0288)E69.CB 8.3054 13.8424 17.9951 100.2126 Constraint (T0288)T55.CB (T0288)V68.CB 10.4939 17.4898 22.7368 100.2126 Constraint (T0288)I54.CB (T0288)M73.CB 6.0446 10.0744 13.0967 100.2126 Constraint (T0288)I54.CB (T0288)K72.CB 8.1799 13.6331 17.7231 100.2126 Constraint (T0288)I54.CB (T0288)A71.CB 6.7084 11.1807 14.5349 100.2126 Constraint (T0288)I54.CB (T0288)V70.CB 4.3257 7.2094 9.3723 100.2126 Constraint (T0288)I54.CB (T0288)E69.CB 7.1087 11.8478 15.4021 100.2126 Constraint (T0288)I54.CB (T0288)V68.CB 8.4867 14.1445 18.3878 100.2126 Constraint (T0288)A50.CB (T0288)M73.CB 12.1677 20.2795 26.3633 100.2126 Constraint (T0288)A50.CB (T0288)A71.CB 10.4923 17.4872 22.7333 100.2126 Constraint (T0288)A50.CB (T0288)V70.CB 9.8309 16.3848 21.3003 100.2126 Constraint (T0288)A49.CB (T0288)A71.CB 11.6786 19.4643 25.3037 100.2126 Constraint (T0288)A49.CB (T0288)V70.CB 10.5191 17.5319 22.7914 100.2126 Constraint (T0288)A49.CB (T0288)N58.CB 11.9842 19.9736 25.9657 100.2126 Constraint (T0288)A42.CB (T0288)A71.CB 8.9754 14.9591 19.4468 100.2126 Constraint (T0288)A42.CB (T0288)N58.CB 9.1437 15.2395 19.8114 100.2126 Constraint (T0288)A42.CB (T0288)V57.CB 7.8042 13.0070 16.9091 100.2126 Constraint (T0288)A42.CB (T0288)I54.CB 6.7559 11.2599 14.6379 100.2126 Constraint (T0288)D38.CB (T0288)A71.CB 12.4697 20.7828 27.0176 100.2126 Constraint (T0288)D38.CB (T0288)I54.CB 11.7244 19.5406 25.4028 100.2126 Constraint (T0288)D38.CB (T0288)A50.CB 7.3410 12.2350 15.9055 100.2126 Constraint (T0288)D38.CB (T0288)A49.CB 7.8699 13.1166 17.0515 100.2126 Constraint (T0288)F37.CB (T0288)M73.CB 11.4604 19.1006 24.8308 100.2126 Constraint (T0288)F37.CB (T0288)K72.CB 11.8972 19.8286 25.7772 100.2126 Constraint (T0288)F37.CB (T0288)A71.CB 9.3792 15.6321 20.3217 100.2126 Constraint (T0288)F37.CB (T0288)V70.CB 10.4228 17.3713 22.5827 100.2126 Constraint (T0288)F37.CB (T0288)V57.CB 10.7413 17.9021 23.2727 100.2126 Constraint (T0288)F37.CB (T0288)T55.CB 12.8306 21.3843 27.7995 100.2126 Constraint (T0288)F37.CB (T0288)I54.CB 9.5138 15.8564 20.6133 100.2126 Constraint (T0288)F37.CB (T0288)A50.CB 6.6678 11.1129 14.4468 100.2126 Constraint (T0288)F37.CB (T0288)A49.CB 7.6200 12.6999 16.5099 100.2126 Constraint (T0288)V36.CB (T0288)M73.CB 11.1530 18.5884 24.1649 100.2126 Constraint (T0288)V36.CB (T0288)K72.CB 12.2469 20.4115 26.5349 100.2126 Constraint (T0288)V36.CB (T0288)A71.CB 9.6557 16.0928 20.9206 100.2126 Constraint (T0288)V36.CB (T0288)V70.CB 9.6493 16.0822 20.9069 100.2126 Constraint (T0288)V36.CB (T0288)N58.CB 11.5583 19.2638 25.0430 100.2126 Constraint (T0288)V36.CB (T0288)V57.CB 9.6854 16.1423 20.9850 100.2126 Constraint (T0288)V36.CB (T0288)T55.CB 10.4830 17.4716 22.7131 100.2126 Constraint (T0288)V36.CB (T0288)I54.CB 7.4897 12.4828 16.2277 100.2126 Constraint (T0288)V36.CB (T0288)A50.CB 3.7444 6.2407 8.1129 100.2126 Constraint (T0288)V36.CB (T0288)A49.CB 4.2283 7.0472 9.1613 100.2126 Constraint (T0288)I33.CB (T0288)M73.CB 8.8279 14.7132 19.1271 100.2126 Constraint (T0288)I33.CB (T0288)K72.CB 10.1636 16.9393 22.0211 100.2126 Constraint (T0288)I33.CB (T0288)A71.CB 7.6473 12.7455 16.5691 100.2126 Constraint (T0288)I33.CB (T0288)V70.CB 6.6439 11.0732 14.3952 100.2126 Constraint (T0288)I33.CB (T0288)E69.CB 9.7325 16.2209 21.0871 100.2126 Constraint (T0288)I33.CB (T0288)V68.CB 9.8789 16.4648 21.4043 100.2126 Constraint (T0288)I33.CB (T0288)N58.CB 9.7694 16.2823 21.1670 100.2126 Constraint (T0288)I33.CB (T0288)V57.CB 7.2771 12.1286 15.7671 100.2126 Constraint (T0288)I33.CB (T0288)T55.CB 7.0356 11.7260 15.2438 100.2126 Constraint (T0288)I33.CB (T0288)I54.CB 4.0383 6.7306 8.7497 100.2126 Constraint (T0288)I33.CB (T0288)A50.CB 3.4221 5.7035 7.4146 100.2126 Constraint (T0288)I33.CB (T0288)A49.CB 4.2069 7.0114 9.1148 100.2126 Constraint (T0288)I33.CB (T0288)A42.CB 4.8712 8.1187 10.5542 100.2126 Constraint (T0288)Y32.CB (T0288)M73.CB 9.2898 15.4831 20.1280 100.2126 Constraint (T0288)Y32.CB (T0288)K72.CB 10.3268 17.2113 22.3747 100.2126 Constraint (T0288)Y32.CB (T0288)A71.CB 7.8882 13.1471 17.0912 100.2126 Constraint (T0288)Y32.CB (T0288)V70.CB 6.3176 10.5293 13.6880 100.2126 Constraint (T0288)Y32.CB (T0288)E69.CB 8.9148 14.8581 19.3155 100.2126 Constraint (T0288)Y32.CB (T0288)V68.CB 9.0043 15.0071 19.5093 100.2126 Constraint (T0288)Y32.CB (T0288)N58.CB 11.0037 18.3396 23.8414 100.2126 Constraint (T0288)Y32.CB (T0288)V57.CB 8.1669 13.6115 17.6950 100.2126 Constraint (T0288)Y32.CB (T0288)T55.CB 6.5083 10.8471 14.1013 100.2126 Constraint (T0288)Y32.CB (T0288)I54.CB 4.4106 7.3509 9.5562 100.2126 Constraint (T0288)Y32.CB (T0288)A50.CB 4.9894 8.3157 10.8104 100.2126 Constraint (T0288)Y32.CB (T0288)A49.CB 6.3715 10.6191 13.8048 100.2126 Constraint (T0288)Y32.CB (T0288)A42.CB 8.1649 13.6082 17.6907 100.2126 Constraint (T0288)M73.CB (T0288)T82.CB 7.1146 11.8577 15.4150 99.5125 Constraint (T0288)K72.CB (T0288)T82.CB 10.0546 16.7576 21.7849 99.5125 Constraint (T0288)K72.CB (T0288)V81.CB 7.9556 13.2593 17.2371 99.5125 Constraint (T0288)A71.CB (T0288)T82.CB 10.1408 16.9014 21.9718 99.5125 Constraint (T0288)A71.CB (T0288)V81.CB 7.7489 12.9149 16.7893 99.5125 Constraint (T0288)V70.CB (T0288)T82.CB 8.5845 14.3074 18.5996 99.5125 Constraint (T0288)V70.CB (T0288)V81.CB 7.1869 11.9781 15.5715 99.5125 Constraint (T0288)E69.CB (T0288)T82.CB 10.4160 17.3599 22.5679 99.5125 Constraint (T0288)E69.CB (T0288)V81.CB 9.2007 15.3344 19.9348 99.5125 Constraint (T0288)V68.CB (T0288)V81.CB 10.6086 17.6810 22.9853 99.5125 Constraint (T0288)N58.CB (T0288)T82.CB 3.3554 5.5924 7.2701 99.5125 Constraint (T0288)N58.CB (T0288)V81.CB 3.7480 6.2467 8.1208 99.5125 Constraint (T0288)N58.CB (T0288)I74.CB 5.5024 9.1707 11.9219 99.5125 Constraint (T0288)V57.CB (T0288)T82.CB 4.5077 7.5129 9.7667 99.5125 Constraint (T0288)V57.CB (T0288)V81.CB 4.0361 6.7268 8.7449 99.5125 Constraint (T0288)V57.CB (T0288)I74.CB 3.8576 6.4293 8.3581 99.5125 Constraint (T0288)T55.CB (T0288)T82.CB 6.9924 11.6539 15.1501 99.5125 Constraint (T0288)T55.CB (T0288)V81.CB 8.2830 13.8050 17.9465 99.5125 Constraint (T0288)T55.CB (T0288)I74.CB 8.1904 13.6507 17.7459 99.5125 Constraint (T0288)I54.CB (T0288)T82.CB 6.7167 11.1946 14.5530 99.5125 Constraint (T0288)I54.CB (T0288)V81.CB 6.4472 10.7453 13.9689 99.5125 Constraint (T0288)I54.CB (T0288)I74.CB 5.4653 9.1088 11.8415 99.5125 Constraint (T0288)A50.CB (T0288)I74.CB 10.0177 16.6961 21.7050 99.5125 Constraint (T0288)A49.CB (T0288)T82.CB 10.2054 17.0091 22.1118 99.5125 Constraint (T0288)A49.CB (T0288)V81.CB 9.9328 16.5546 21.5210 99.5125 Constraint (T0288)A49.CB (T0288)I74.CB 10.3033 17.1722 22.3238 99.5125 Constraint (T0288)A42.CB (T0288)T82.CB 7.8061 13.0102 16.9132 99.5125 Constraint (T0288)A42.CB (T0288)V81.CB 5.9974 9.9956 12.9943 99.5125 Constraint (T0288)A42.CB (T0288)I74.CB 6.7956 11.3260 14.7239 99.5125 Constraint (T0288)D38.CB (T0288)V81.CB 11.2825 18.8042 24.4454 99.5125 Constraint (T0288)D38.CB (T0288)I74.CB 11.3143 18.8572 24.5144 99.5125 Constraint (T0288)F37.CB (T0288)T82.CB 11.5759 19.2932 25.0811 99.5125 Constraint (T0288)F37.CB (T0288)V81.CB 9.0657 15.1095 19.6423 99.5125 Constraint (T0288)F37.CB (T0288)I74.CB 8.4059 14.0098 18.2128 99.5125 Constraint (T0288)V36.CB (T0288)T82.CB 10.3582 17.2637 22.4428 99.5125 Constraint (T0288)V36.CB (T0288)V81.CB 8.6956 14.4926 18.8404 99.5125 Constraint (T0288)V36.CB (T0288)I74.CB 8.4463 14.0772 18.3004 99.5125 Constraint (T0288)I33.CB (T0288)T82.CB 9.1078 15.1796 19.7335 99.5125 Constraint (T0288)I33.CB (T0288)V81.CB 7.9920 13.3200 17.3160 99.5125 Constraint (T0288)I33.CB (T0288)I74.CB 6.8792 11.4654 14.9050 99.5125 Constraint (T0288)Y32.CB (T0288)I74.CB 8.2192 13.6987 17.8083 99.5125 Constraint (T0288)F37.CB (T0288)V68.CB 12.3694 20.6157 26.8004 99.2128 Constraint (T0288)A50.CB (T0288)T82.CB 11.8714 19.7857 25.7215 99.1113 Constraint (T0288)A50.CB (T0288)V81.CB 10.8618 18.1030 23.5339 99.1113 Constraint (T0288)N58.CB (T0288)K67.CB 10.2594 17.0990 22.2288 99.0091 Constraint (T0288)V57.CB (T0288)K67.CB 7.6134 12.6890 16.4957 99.0091 Constraint (T0288)T55.CB (T0288)K67.CB 8.6980 14.4967 18.8457 99.0091 Constraint (T0288)I54.CB (T0288)K67.CB 6.4440 10.7400 13.9620 99.0091 Constraint (T0288)A50.CB (T0288)K67.CB 9.8123 16.3539 21.2600 99.0091 Constraint (T0288)A49.CB (T0288)K67.CB 11.4163 19.0272 24.7354 99.0091 Constraint (T0288)F37.CB (T0288)K67.CB 10.8903 18.1505 23.5957 99.0091 Constraint (T0288)V36.CB (T0288)K67.CB 10.3209 17.2014 22.3618 99.0091 Constraint (T0288)I33.CB (T0288)K67.CB 7.3344 12.2240 15.8912 99.0091 Constraint (T0288)Y32.CB (T0288)K67.CB 6.0078 10.0131 13.0170 99.0091 Constraint (T0288)Y32.CB (T0288)T82.CB 10.8776 18.1294 23.5682 98.7743 Constraint (T0288)K67.CB (T0288)T82.CB 11.8012 19.6686 25.5692 98.3090 Constraint (T0288)K67.CB (T0288)V81.CB 10.1687 16.9478 22.0321 98.3090 Constraint (T0288)I62.CB (T0288)M73.CB 4.4048 7.3413 9.5437 98.2247 Constraint (T0288)I62.CB (T0288)K72.CB 6.5731 10.9552 14.2417 98.2247 Constraint (T0288)I62.CB (T0288)A71.CB 6.2557 10.4261 13.5539 98.2247 Constraint (T0288)E53.CB (T0288)M73.CB 9.2018 15.3364 19.9373 98.2247 Constraint (T0288)E53.CB (T0288)K72.CB 11.0923 18.4871 24.0332 98.2247 Constraint (T0288)E53.CB (T0288)A71.CB 9.3739 15.6232 20.3102 98.2247 Constraint (T0288)E53.CB (T0288)V70.CB 6.8941 11.4902 14.9372 98.2247 Constraint (T0288)E53.CB (T0288)E69.CB 9.3294 15.5490 20.2137 98.2247 Constraint (T0288)E53.CB (T0288)V68.CB 10.4954 17.4924 22.7401 98.2247 Constraint (T0288)E53.CB (T0288)I62.CB 5.5056 9.1760 11.9289 98.2247 Constraint (T0288)D52.CB (T0288)M73.CB 9.9074 16.5123 21.4659 98.2247 Constraint (T0288)D52.CB (T0288)A71.CB 9.7769 16.2949 21.1834 98.2247 Constraint (T0288)D52.CB (T0288)V70.CB 8.0020 13.3366 17.3376 98.2247 Constraint (T0288)D52.CB (T0288)V68.CB 11.7731 19.6218 25.5083 98.2247 Constraint (T0288)D52.CB (T0288)I62.CB 7.3117 12.1861 15.8419 98.2247 Constraint (T0288)A50.CB (T0288)I62.CB 10.3193 17.1989 22.3585 98.2247 Constraint (T0288)A49.CB (T0288)I62.CB 10.2757 17.1262 22.2641 98.2247 Constraint (T0288)A42.CB (T0288)D52.CB 6.0595 10.0991 13.1288 98.2247 Constraint (T0288)N39.CB (T0288)I54.CB 12.3762 20.6269 26.8150 98.2247 Constraint (T0288)N39.CB (T0288)D52.CB 10.9931 18.3218 23.8183 98.2247 Constraint (T0288)N39.CB (T0288)A50.CB 9.2338 15.3896 20.0065 98.2247 Constraint (T0288)N39.CB (T0288)A49.CB 9.1051 15.1751 19.7277 98.2247 Constraint (T0288)D38.CB (T0288)E53.CB 12.8668 21.4447 27.8781 98.2247 Constraint (T0288)D38.CB (T0288)D52.CB 9.9609 16.6016 21.5820 98.2247 Constraint (T0288)F37.CB (T0288)I62.CB 12.0928 20.1547 26.2011 98.2247 Constraint (T0288)F37.CB (T0288)E53.CB 11.2040 18.6734 24.2754 98.2247 Constraint (T0288)F37.CB (T0288)D52.CB 8.7102 14.5170 18.8721 98.2247 Constraint (T0288)V36.CB (T0288)I62.CB 10.5760 17.6267 22.9147 98.2247 Constraint (T0288)V36.CB (T0288)E53.CB 8.4598 14.0997 18.3296 98.2247 Constraint (T0288)V36.CB (T0288)D52.CB 5.6027 9.3379 12.1392 98.2247 Constraint (T0288)Q35.CB (T0288)M73.CB 11.2536 18.7560 24.3827 98.2247 Constraint (T0288)Q35.CB (T0288)K72.CB 11.5953 19.3255 25.1232 98.2247 Constraint (T0288)Q35.CB (T0288)A71.CB 8.6053 14.3421 18.6447 98.2247 Constraint (T0288)Q35.CB (T0288)V70.CB 9.0991 15.1652 19.7147 98.2247 Constraint (T0288)Q35.CB (T0288)E69.CB 11.9190 19.8651 25.8246 98.2247 Constraint (T0288)Q35.CB (T0288)V68.CB 10.9138 18.1896 23.6465 98.2247 Constraint (T0288)Q35.CB (T0288)I62.CB 10.6648 17.7746 23.1070 98.2247 Constraint (T0288)Q35.CB (T0288)V57.CB 10.5545 17.5908 22.8681 98.2247 Constraint (T0288)Q35.CB (T0288)T55.CB 11.2937 18.8228 24.4696 98.2247 Constraint (T0288)Q35.CB (T0288)I54.CB 8.0527 13.4212 17.4476 98.2247 Constraint (T0288)Q35.CB (T0288)E53.CB 8.7351 14.5586 18.9261 98.2247 Constraint (T0288)Q35.CB (T0288)D52.CB 6.8168 11.3614 14.7698 98.2247 Constraint (T0288)Q35.CB (T0288)A50.CB 3.7948 6.3247 8.2221 98.2247 Constraint (T0288)Q35.CB (T0288)A49.CB 6.2398 10.3997 13.5196 98.2247 Constraint (T0288)V34.CB (T0288)M73.CB 10.2657 17.1096 22.2424 98.2247 Constraint (T0288)V34.CB (T0288)K72.CB 10.5988 17.6646 22.9640 98.2247 Constraint (T0288)V34.CB (T0288)A71.CB 7.5883 12.6472 16.4414 98.2247 Constraint (T0288)V34.CB (T0288)V70.CB 7.5090 12.5151 16.2696 98.2247 Constraint (T0288)V34.CB (T0288)E69.CB 10.1941 16.9901 22.0872 98.2247 Constraint (T0288)V34.CB (T0288)V68.CB 9.2690 15.4483 20.0828 98.2247 Constraint (T0288)V34.CB (T0288)I62.CB 8.9192 14.8654 19.3250 98.2247 Constraint (T0288)V34.CB (T0288)V57.CB 9.6860 16.1433 20.9863 98.2247 Constraint (T0288)V34.CB (T0288)T55.CB 9.6658 16.1097 20.9427 98.2247 Constraint (T0288)V34.CB (T0288)I54.CB 6.6560 11.0933 14.4212 98.2247 Constraint (T0288)V34.CB (T0288)E53.CB 6.8258 11.3763 14.7891 98.2247 Constraint (T0288)V34.CB (T0288)D52.CB 5.9527 9.9212 12.8975 98.2247 Constraint (T0288)V34.CB (T0288)A50.CB 3.8941 6.4902 8.4373 98.2247 Constraint (T0288)V34.CB (T0288)A49.CB 6.5602 10.9336 14.2137 98.2247 Constraint (T0288)I33.CB (T0288)I62.CB 7.1151 11.8586 15.4161 98.2247 Constraint (T0288)I33.CB (T0288)E53.CB 4.7180 7.8633 10.2223 98.2247 Constraint (T0288)I33.CB (T0288)D52.CB 2.8733 4.7888 6.2254 98.2247 Constraint (T0288)Y32.CB (T0288)I62.CB 6.4709 10.7849 14.0204 98.2247 Constraint (T0288)Y32.CB (T0288)E53.CB 3.3719 5.6199 7.3058 98.2247 Constraint (T0288)Y32.CB (T0288)D52.CB 4.1767 6.9611 9.0495 98.2247 Constraint (T0288)Y32.CB (T0288)V81.CB 10.1310 16.8849 21.9504 98.1755 Constraint (T0288)F37.CB (T0288)N58.CB 12.2473 20.4122 26.5358 98.0093 Constraint (T0288)S61.CB (T0288)M73.CB 6.2361 10.3935 13.5115 97.5916 Constraint (T0288)S61.CB (T0288)K72.CB 8.6666 14.4443 18.7776 97.5916 Constraint (T0288)S61.CB (T0288)A71.CB 9.2205 15.3675 19.9777 97.5916 Constraint (T0288)S61.CB (T0288)V70.CB 6.2832 10.4720 13.6136 97.5916 Constraint (T0288)R60.CB (T0288)M73.CB 3.8160 6.3601 8.2681 97.5916 Constraint (T0288)R60.CB (T0288)K72.CB 6.5078 10.8464 14.1003 97.5916 Constraint (T0288)R60.CB (T0288)A71.CB 7.7588 12.9313 16.8107 97.5916 Constraint (T0288)R60.CB (T0288)V70.CB 5.6060 9.3433 12.1463 97.5916 Constraint (T0288)R60.CB (T0288)E69.CB 5.6925 9.4874 12.3337 97.5916 Constraint (T0288)A50.CB (T0288)S61.CB 13.0608 21.7680 28.2985 97.5916 Constraint (T0288)A49.CB (T0288)S61.CB 12.4982 20.8303 27.0794 97.5916 Constraint (T0288)V48.CB (T0288)M73.CB 9.8120 16.3534 21.2594 97.5916 Constraint (T0288)V48.CB (T0288)K72.CB 11.7159 19.5264 25.3844 97.5916 Constraint (T0288)V48.CB (T0288)A71.CB 9.6835 16.1391 20.9808 97.5916 Constraint (T0288)V48.CB (T0288)V70.CB 8.7755 14.6259 19.0137 97.5916 Constraint (T0288)V48.CB (T0288)E69.CB 11.8802 19.8004 25.7405 97.5916 Constraint (T0288)V48.CB (T0288)V68.CB 12.4819 20.8032 27.0441 97.5916 Constraint (T0288)V48.CB (T0288)S61.CB 10.9923 18.3205 23.8167 97.5916 Constraint (T0288)V48.CB (T0288)R60.CB 10.7000 17.8333 23.1833 97.5916 Constraint (T0288)V48.CB (T0288)N58.CB 9.1433 15.2388 19.8105 97.5916 Constraint (T0288)V48.CB (T0288)V57.CB 7.5379 12.5632 16.3321 97.5916 Constraint (T0288)A42.CB (T0288)R60.CB 11.1365 18.5608 24.1291 97.5916 Constraint (T0288)P41.CB (T0288)M73.CB 9.8753 16.4588 21.3964 97.5916 Constraint (T0288)P41.CB (T0288)K72.CB 11.2701 18.7835 24.4185 97.5916 Constraint (T0288)P41.CB (T0288)A71.CB 9.8189 16.3649 21.2744 97.5916 Constraint (T0288)P41.CB (T0288)V70.CB 10.2236 17.0393 22.1511 97.5916 Constraint (T0288)P41.CB (T0288)R60.CB 11.5993 19.3322 25.1319 97.5916 Constraint (T0288)P41.CB (T0288)N58.CB 8.9308 14.8847 19.3502 97.5916 Constraint (T0288)P41.CB (T0288)V57.CB 8.4779 14.1299 18.3688 97.5916 Constraint (T0288)P41.CB (T0288)T55.CB 11.4384 19.0639 24.7831 97.5916 Constraint (T0288)P41.CB (T0288)I54.CB 8.7777 14.6295 19.0183 97.5916 Constraint (T0288)P41.CB (T0288)A50.CB 9.1463 15.2438 19.8170 97.5916 Constraint (T0288)D38.CB (T0288)V48.CB 7.3225 12.2041 15.8654 97.5916 Constraint (T0288)F37.CB (T0288)V48.CB 6.2273 10.3788 13.4924 97.5916 Constraint (T0288)V36.CB (T0288)V48.CB 3.5279 5.8799 7.6438 97.5916 Constraint (T0288)I33.CB (T0288)S61.CB 9.9852 16.6420 21.6346 97.5916 Constraint (T0288)I33.CB (T0288)R60.CB 10.1529 16.9214 21.9979 97.5916 Constraint (T0288)I33.CB (T0288)V48.CB 3.6941 6.1569 8.0039 97.5916 Constraint (T0288)Y32.CB (T0288)S61.CB 9.2307 15.3846 20.0000 97.5916 Constraint (T0288)Y32.CB (T0288)R60.CB 10.2666 17.1110 22.2442 97.5916 Constraint (T0288)Y32.CB (T0288)V48.CB 6.7829 11.3048 14.6962 97.5916 Constraint (T0288)Y32.CB (T0288)P41.CB 10.8606 18.1011 23.5314 97.5916 Constraint (T0288)I62.CB (T0288)T82.CB 7.3804 12.3006 15.9908 97.5246 Constraint (T0288)I62.CB (T0288)V81.CB 7.3503 12.2505 15.9256 97.5246 Constraint (T0288)I62.CB (T0288)I74.CB 5.6578 9.4296 12.2585 97.5246 Constraint (T0288)E53.CB (T0288)T82.CB 9.3178 15.5297 20.1886 97.5246 Constraint (T0288)E53.CB (T0288)V81.CB 9.6700 16.1166 20.9516 97.5246 Constraint (T0288)E53.CB (T0288)I74.CB 8.7873 14.6455 19.0392 97.5246 Constraint (T0288)D52.CB (T0288)T82.CB 8.6205 14.3674 18.6777 97.5246 Constraint (T0288)D52.CB (T0288)I74.CB 8.5137 14.1896 18.4464 97.5246 Constraint (T0288)N39.CB (T0288)V81.CB 10.5464 17.5774 22.8506 97.5246 Constraint (T0288)N39.CB (T0288)I74.CB 11.3172 18.8619 24.5205 97.5246 Constraint (T0288)Q35.CB (T0288)T82.CB 12.3860 20.6434 26.8364 97.5246 Constraint (T0288)Q35.CB (T0288)V81.CB 10.3353 17.2254 22.3931 97.5246 Constraint (T0288)Q35.CB (T0288)I74.CB 8.6359 14.3932 18.7112 97.5246 Constraint (T0288)V34.CB (T0288)I74.CB 8.2366 13.7277 17.8460 97.5246 Constraint (T0288)A49.CB (T0288)M73.CB 12.2248 20.3747 26.4872 97.2127 Constraint (T0288)A42.CB (T0288)M73.CB 9.3260 15.5434 20.2064 97.2127 Constraint (T0288)A42.CB (T0288)K72.CB 10.8608 18.1013 23.5317 97.2127 Constraint (T0288)A42.CB (T0288)V70.CB 8.6687 14.4478 18.7822 97.2127 Constraint (T0288)A42.CB (T0288)E69.CB 11.6762 19.4603 25.2985 97.2127 Constraint (T0288)A42.CB (T0288)V68.CB 11.9535 19.9226 25.8993 97.2127 Constraint (T0288)A42.CB (T0288)T55.CB 9.4841 15.8069 20.5490 97.2127 Constraint (T0288)V68.CB (T0288)V77.CB 9.3088 15.5147 20.1692 97.1158 Constraint (T0288)N58.CB (T0288)V77.CB 3.9624 6.6040 8.5853 97.1158 Constraint (T0288)V57.CB (T0288)V77.CB 4.5034 7.5057 9.7575 97.1158 Constraint (T0288)I54.CB (T0288)V77.CB 7.7212 12.8687 16.7293 97.1158 Constraint (T0288)A42.CB (T0288)V77.CB 8.0522 13.4204 17.4465 97.1158 Constraint (T0288)F37.CB (T0288)V77.CB 10.1604 16.9339 22.0141 97.1158 Constraint (T0288)V36.CB (T0288)V77.CB 10.4586 17.4310 22.6603 97.1158 Constraint (T0288)I33.CB (T0288)V77.CB 9.5377 15.8962 20.6650 97.1158 Constraint (T0288)E53.CB (T0288)K67.CB 7.8498 13.0830 17.0079 97.0212 Constraint (T0288)D52.CB (T0288)K67.CB 9.1827 15.3045 19.8959 97.0212 Constraint (T0288)Q35.CB (T0288)K67.CB 8.6707 14.4511 18.7864 97.0212 Constraint (T0288)Q35.CB (T0288)N58.CB 12.8633 21.4388 27.8705 97.0212 Constraint (T0288)V34.CB (T0288)K67.CB 6.5694 10.9489 14.2336 97.0212 Constraint (T0288)V34.CB (T0288)N58.CB 12.3439 20.5732 26.7452 97.0212 Constraint (T0288)S61.CB (T0288)T82.CB 7.6927 12.8212 16.6675 96.8915 Constraint (T0288)S61.CB (T0288)V81.CB 8.8862 14.8104 19.2535 96.8915 Constraint (T0288)S61.CB (T0288)I74.CB 8.2820 13.8033 17.9443 96.8915 Constraint (T0288)R60.CB (T0288)T82.CB 6.1934 10.3223 13.4190 96.8915 Constraint (T0288)R60.CB (T0288)V81.CB 6.6748 11.1247 14.4621 96.8915 Constraint (T0288)R60.CB (T0288)I74.CB 6.2214 10.3690 13.4797 96.8915 Constraint (T0288)V48.CB (T0288)T82.CB 7.4059 12.3431 16.0460 96.8915 Constraint (T0288)V48.CB (T0288)V81.CB 6.6674 11.1124 14.4461 96.8915 Constraint (T0288)V48.CB (T0288)I74.CB 7.6191 12.6986 16.5081 96.8915 Constraint (T0288)P41.CB (T0288)T82.CB 7.6271 12.7118 16.5254 96.8915 Constraint (T0288)P41.CB (T0288)V81.CB 5.3504 8.9173 11.5925 96.8915 Constraint (T0288)P41.CB (T0288)I74.CB 7.1717 11.9528 15.5387 96.8915 Constraint (T0288)D52.CB (T0288)V81.CB 8.5460 14.2434 18.5164 96.5246 Constraint (T0288)N58.CB (T0288)Q75.CB 7.3046 12.1743 15.8266 96.5125 Constraint (T0288)V57.CB (T0288)Q75.CB 6.4354 10.7257 13.9434 96.5125 Constraint (T0288)T55.CB (T0288)Q75.CB 11.0704 18.4507 23.9859 96.5125 Constraint (T0288)I54.CB (T0288)Q75.CB 8.4628 14.1047 18.3361 96.5125 Constraint (T0288)A50.CB (T0288)Q75.CB 12.4015 20.6691 26.8699 96.5125 Constraint (T0288)A42.CB (T0288)Q75.CB 8.9964 14.9940 19.4921 96.5125 Constraint (T0288)F37.CB (T0288)Q75.CB 9.5464 15.9106 20.6838 96.5125 Constraint (T0288)V36.CB (T0288)Q75.CB 10.5425 17.5708 22.8420 96.5125 Constraint (T0288)I33.CB (T0288)Q75.CB 9.5273 15.8788 20.6424 96.5125 Constraint (T0288)Y32.CB (T0288)Q75.CB 10.7117 17.8528 23.2086 96.5125 Constraint (T0288)A71.CB (T0288)E80.CB 10.7752 17.9587 23.3464 96.5125 Constraint (T0288)V70.CB (T0288)E80.CB 10.4027 17.3378 22.5392 96.5125 Constraint (T0288)N58.CB (T0288)E80.CB 5.2280 8.7134 11.3274 96.5125 Constraint (T0288)V57.CB (T0288)E80.CB 6.9231 11.5384 15.0000 96.5125 Constraint (T0288)I54.CB (T0288)E80.CB 9.5737 15.9561 20.7430 96.5125 Constraint (T0288)A42.CB (T0288)E80.CB 8.0127 13.3546 17.3609 96.5125 Constraint (T0288)V36.CB (T0288)E80.CB 10.9764 18.2939 23.7821 96.5125 Constraint (T0288)A49.CB (T0288)R60.CB 12.9575 21.5958 28.0745 96.3881 Constraint (T0288)V48.CB (T0288)K67.CB 10.4065 17.3442 22.5475 96.3881 Constraint (T0288)A50.CB (T0288)V68.CB 12.4994 20.8324 27.0821 96.2128 Constraint (T0288)A42.CB (T0288)K67.CB 10.2741 17.1235 22.2605 96.0092 Constraint (T0288)V34.CB (T0288)T82.CB 12.2024 20.3374 26.4386 95.9127 Constraint (T0288)V34.CB (T0288)V81.CB 10.4932 17.4886 22.7352 95.9127 Constraint (T0288)K67.CB (T0288)V77.CB 9.7165 16.1942 21.0525 95.9123 Constraint (T0288)F37.CB (T0288)E80.CB 10.9991 18.3319 23.8315 95.7102 Constraint (T0288)D52.CB (T0288)S61.CB 9.4735 15.7892 20.5260 95.6037 Constraint (T0288)V48.CB (T0288)I62.CB 8.7353 14.5589 18.9265 95.6037 Constraint (T0288)D45.CB (T0288)N58.CB 9.3352 15.5586 20.2262 95.6037 Constraint (T0288)D45.CB (T0288)V57.CB 8.8271 14.7118 19.1253 95.6037 Constraint (T0288)D45.CB (T0288)T55.CB 10.1008 16.8346 21.8850 95.6037 Constraint (T0288)D45.CB (T0288)I54.CB 8.2697 13.7829 17.9177 95.6037 Constraint (T0288)P41.CB (T0288)I62.CB 11.0731 18.4552 23.9917 95.6037 Constraint (T0288)P41.CB (T0288)E53.CB 11.2508 18.7513 24.3767 95.6037 Constraint (T0288)P41.CB (T0288)D52.CB 8.7714 14.6190 19.0047 95.6037 Constraint (T0288)T40.CB (T0288)M73.CB 11.1094 18.5156 24.0703 95.6037 Constraint (T0288)T40.CB (T0288)A71.CB 9.9440 16.5734 21.5454 95.6037 Constraint (T0288)T40.CB (T0288)N58.CB 11.0927 18.4878 24.0341 95.6037 Constraint (T0288)T40.CB (T0288)V57.CB 10.0429 16.7382 21.7597 95.6037 Constraint (T0288)T40.CB (T0288)T55.CB 12.5285 20.8809 27.1451 95.6037 Constraint (T0288)T40.CB (T0288)I54.CB 9.4623 15.7705 20.5016 95.6037 Constraint (T0288)T40.CB (T0288)E53.CB 11.4772 19.1287 24.8672 95.6037 Constraint (T0288)T40.CB (T0288)D52.CB 8.8120 14.6866 19.0926 95.6037 Constraint (T0288)T40.CB (T0288)A50.CB 7.8338 13.0563 16.9732 95.6037 Constraint (T0288)T40.CB (T0288)A49.CB 7.7728 12.9546 16.8410 95.6037 Constraint (T0288)N39.CB (T0288)V48.CB 7.7987 12.9977 16.8971 95.6037 Constraint (T0288)V36.CB (T0288)D45.CB 5.8554 9.7590 12.6867 95.6037 Constraint (T0288)Q35.CB (T0288)V48.CB 6.2067 10.3446 13.4480 95.6037 Constraint (T0288)Q35.CB (T0288)D45.CB 9.0195 15.0326 19.5423 95.6037 Constraint (T0288)V34.CB (T0288)S61.CB 12.1014 20.1690 26.2197 95.6037 Constraint (T0288)V34.CB (T0288)V48.CB 6.8136 11.3559 14.7627 95.6037 Constraint (T0288)V34.CB (T0288)D45.CB 10.2122 17.0203 22.1264 95.6037 Constraint (T0288)I33.CB (T0288)D45.CB 7.2900 12.1501 15.7951 95.6037 Constraint (T0288)Y32.CB (T0288)D45.CB 10.3759 17.2932 22.4811 95.6037 Constraint (T0288)V68.CB (T0288)T82.CB 12.4605 20.7676 26.9978 95.5125 Constraint (T0288)I33.CB (T0288)E80.CB 10.9582 18.2637 23.7428 95.5125 Constraint (T0288)D52.CB (T0288)K72.CB 11.7649 19.6081 25.4905 95.2248 Constraint (T0288)D52.CB (T0288)E69.CB 10.8561 18.0935 23.5216 95.2248 Constraint (T0288)A42.CB (T0288)I62.CB 9.4416 15.7360 20.4568 95.2247 Constraint (T0288)A42.CB (T0288)E53.CB 8.5512 14.2520 18.5275 95.2247 Constraint (T0288)K63.CB (T0288)M73.CB 7.4622 12.4369 16.1680 95.2247 Constraint (T0288)K63.CB (T0288)K72.CB 9.2454 15.4089 20.0316 95.2247 Constraint (T0288)I54.CB (T0288)K63.CB 5.6447 9.4078 12.2302 95.2247 Constraint (T0288)E53.CB (T0288)K63.CB 5.6820 9.4701 12.3111 95.2247 Constraint (T0288)D52.CB (T0288)K63.CB 8.5541 14.2569 18.5339 95.2247 Constraint (T0288)V34.CB (T0288)K63.CB 10.5987 17.6645 22.9638 95.2247 Constraint (T0288)I33.CB (T0288)K63.CB 9.0540 15.0900 19.6170 95.2247 Constraint (T0288)Y32.CB (T0288)K63.CB 7.3668 12.2780 15.9614 95.2247 Constraint (T0288)A43.CB (T0288)M73.CB 12.4511 20.7518 26.9774 95.2247 Constraint (T0288)A43.CB (T0288)A71.CB 11.6151 19.3585 25.1661 95.2247 Constraint (T0288)A43.CB (T0288)N58.CB 11.9673 19.9455 25.9291 95.2247 Constraint (T0288)A43.CB (T0288)V57.CB 10.8020 18.0034 23.4044 95.2247 Constraint (T0288)A43.CB (T0288)T55.CB 12.1236 20.2060 26.2679 95.2247 Constraint (T0288)A43.CB (T0288)I54.CB 9.4373 15.7288 20.4474 95.2247 Constraint (T0288)A43.CB (T0288)D52.CB 7.6445 12.7408 16.5631 95.2247 Constraint (T0288)I33.CB (T0288)A43.CB 6.7456 11.2427 14.6154 95.2247 Constraint (T0288)I62.CB (T0288)V77.CB 7.5838 12.6396 16.4315 95.1278 Constraint (T0288)N39.CB (T0288)V77.CB 12.0269 20.0449 26.0584 95.1278 Constraint (T0288)Q35.CB (T0288)V77.CB 11.4053 19.0089 24.7115 95.1278 Constraint (T0288)V34.CB (T0288)V77.CB 11.4404 19.0673 24.7875 95.1278 Constraint (T0288)N58.CB (T0288)E76.CB 5.6857 9.4762 12.3190 95.1122 Constraint (T0288)V57.CB (T0288)E76.CB 5.8478 9.7463 12.6702 95.1122 Constraint (T0288)T55.CB (T0288)E76.CB 10.8259 18.0431 23.4561 95.1122 Constraint (T0288)I54.CB (T0288)E76.CB 9.0558 15.0929 19.6208 95.1122 Constraint (T0288)V36.CB (T0288)E76.CB 12.5703 20.9506 27.2357 95.1122 Constraint (T0288)I33.CB (T0288)E76.CB 11.1622 18.6036 24.1847 95.1122 Constraint (T0288)D45.CB (T0288)T82.CB 6.9112 11.5187 14.9743 94.9035 Constraint (T0288)D45.CB (T0288)V81.CB 6.4144 10.6907 13.8979 94.9035 Constraint (T0288)D45.CB (T0288)I74.CB 9.0082 15.0136 19.5177 94.9035 Constraint (T0288)T40.CB (T0288)T82.CB 9.9861 16.6435 21.6365 94.9035 Constraint (T0288)T40.CB (T0288)V81.CB 7.5267 12.5446 16.3079 94.9035 Constraint (T0288)T40.CB (T0288)I74.CB 8.0888 13.4814 17.5258 94.9035 Constraint (T0288)A42.CB (T0288)S61.CB 12.0241 20.0401 26.0521 94.5916 Constraint (T0288)K63.CB (T0288)T82.CB 9.7087 16.1812 21.0355 94.5246 Constraint (T0288)K63.CB (T0288)V81.CB 10.4538 17.4230 22.6499 94.5246 Constraint (T0288)K63.CB (T0288)I74.CB 8.9825 14.9709 19.4622 94.5246 Constraint (T0288)I62.CB (T0288)Q75.CB 8.0761 13.4602 17.4983 94.5246 Constraint (T0288)E53.CB (T0288)Q75.CB 11.6900 19.4834 25.3284 94.5246 Constraint (T0288)D52.CB (T0288)Q75.CB 11.4747 19.1246 24.8619 94.5246 Constraint (T0288)Q35.CB (T0288)Q75.CB 10.2379 17.0632 22.1822 94.5246 Constraint (T0288)V34.CB (T0288)Q75.CB 10.1153 16.8588 21.9164 94.5246 Constraint (T0288)I62.CB (T0288)E80.CB 10.3194 17.1990 22.3587 94.5246 Constraint (T0288)A43.CB (T0288)T82.CB 10.2246 17.0410 22.1533 94.5246 Constraint (T0288)A43.CB (T0288)V81.CB 8.6596 14.4327 18.7625 94.5246 Constraint (T0288)A43.CB (T0288)E80.CB 10.0056 16.6759 21.6787 94.5246 Constraint (T0288)A43.CB (T0288)I74.CB 9.6680 16.1133 20.9473 94.5246 Constraint (T0288)N39.CB (T0288)E80.CB 11.4167 19.0279 24.7363 94.5246 Constraint (T0288)R60.CB (T0288)V77.CB 6.1802 10.3004 13.3905 94.4947 Constraint (T0288)V48.CB (T0288)V77.CB 9.0302 15.0503 19.5654 94.4947 Constraint (T0288)P41.CB (T0288)V77.CB 7.1649 11.9416 15.5241 94.4947 Constraint (T0288)V34.CB (T0288)R60.CB 12.2433 20.4054 26.5271 94.4002 Constraint (T0288)V36.CB (T0288)V68.CB 12.3641 20.6068 26.7889 94.2127 Constraint (T0288)L31.CB (T0288)M73.CB 6.1282 10.2137 13.2778 94.2126 Constraint (T0288)L31.CB (T0288)K72.CB 7.3062 12.1770 15.8301 94.2126 Constraint (T0288)L31.CB (T0288)A71.CB 5.4938 9.1564 11.9033 94.2126 Constraint (T0288)L31.CB (T0288)V70.CB 3.1404 5.2340 6.8042 94.2126 Constraint (T0288)L31.CB (T0288)E69.CB 5.6380 9.3966 12.2156 94.2126 Constraint (T0288)L31.CB (T0288)V68.CB 6.4295 10.7158 13.9306 94.2126 Constraint (T0288)L31.CB (T0288)N58.CB 8.4303 14.0504 18.2656 94.2126 Constraint (T0288)L31.CB (T0288)V57.CB 5.5107 9.1845 11.9399 94.2126 Constraint (T0288)L31.CB (T0288)T55.CB 5.0844 8.4739 11.0161 94.2126 Constraint (T0288)L31.CB (T0288)I54.CB 2.9331 4.8885 6.3551 94.2126 Constraint (T0288)L31.CB (T0288)A50.CB 7.7689 12.9482 16.8327 94.2126 Constraint (T0288)L31.CB (T0288)A49.CB 8.5705 14.2841 18.5693 94.2126 Constraint (T0288)E69.CB (T0288)E80.CB 12.0122 20.0203 26.0263 94.1755 Constraint (T0288)T55.CB (T0288)V77.CB 9.4214 15.7023 20.4130 94.1158 Constraint (T0288)A49.CB (T0288)V77.CB 12.0983 20.1638 26.2129 94.1158 Constraint (T0288)Y32.CB (T0288)V77.CB 11.1499 18.5831 24.1580 94.1158 Constraint (T0288)K67.CB (T0288)E76.CB 8.8845 14.8075 19.2498 93.9087 Constraint (T0288)S61.CB (T0288)Q75.CB 10.4626 17.4377 22.6690 93.8915 Constraint (T0288)R60.CB (T0288)Q75.CB 7.9063 13.1771 17.1302 93.8915 Constraint (T0288)V48.CB (T0288)Q75.CB 10.3150 17.1916 22.3491 93.8915 Constraint (T0288)P41.CB (T0288)Q75.CB 8.6331 14.3885 18.7051 93.8915 Constraint (T0288)R60.CB (T0288)E80.CB 8.7293 14.5488 18.9134 93.8915 Constraint (T0288)V48.CB (T0288)E80.CB 8.8610 14.7684 19.1989 93.8915 Constraint (T0288)P41.CB (T0288)E80.CB 6.2964 10.4939 13.6421 93.8915 Constraint (T0288)A49.CB (T0288)E80.CB 12.0350 20.0584 26.0759 93.7744 Constraint (T0288)N58.CB (T0288)K78.CB 6.0262 10.0437 13.0568 93.6459 Constraint (T0288)V57.CB (T0288)K78.CB 7.5878 12.6464 16.4403 93.6459 Constraint (T0288)I54.CB (T0288)K78.CB 10.7717 17.9528 23.3386 93.6459 Constraint (T0288)A42.CB (T0288)K78.CB 9.6464 16.0773 20.9004 93.6459 Constraint (T0288)L31.CB (T0288)T82.CB 9.2041 15.3402 19.9423 93.5125 Constraint (T0288)L31.CB (T0288)V81.CB 8.4132 14.0220 18.2286 93.5125 Constraint (T0288)L31.CB (T0288)I74.CB 5.8759 9.7932 12.7312 93.5125 Constraint (T0288)I74.CB (T0288)I83.CB 5.3859 8.9765 11.6694 93.5125 Constraint (T0288)M73.CB (T0288)I83.CB 6.2983 10.4972 13.6464 93.5125 Constraint (T0288)K72.CB (T0288)I83.CB 8.9899 14.9832 19.4781 93.5125 Constraint (T0288)A71.CB (T0288)I83.CB 8.1086 13.5144 17.5687 93.5125 Constraint (T0288)V70.CB (T0288)I83.CB 6.3566 10.5943 13.7725 93.5125 Constraint (T0288)E69.CB (T0288)I83.CB 8.9259 14.8765 19.3394 93.5125 Constraint (T0288)V68.CB (T0288)I83.CB 10.5724 17.6206 22.9068 93.5125 Constraint (T0288)N58.CB (T0288)I83.CB 4.7773 7.9622 10.3509 93.5125 Constraint (T0288)V57.CB (T0288)I83.CB 3.4609 5.7681 7.4985 93.5125 Constraint (T0288)T55.CB (T0288)I83.CB 5.1116 8.5193 11.0751 93.5125 Constraint (T0288)I54.CB (T0288)I83.CB 3.6085 6.0142 7.8184 93.5125 Constraint (T0288)A50.CB (T0288)I83.CB 8.5907 14.3178 18.6132 93.5125 Constraint (T0288)A49.CB (T0288)I83.CB 7.2992 12.1654 15.8150 93.5125 Constraint (T0288)A42.CB (T0288)I83.CB 5.5541 9.2568 12.0339 93.5125 Constraint (T0288)D38.CB (T0288)I83.CB 11.1637 18.6062 24.1880 93.5125 Constraint (T0288)F37.CB (T0288)I83.CB 9.2432 15.4053 20.0269 93.5125 Constraint (T0288)V36.CB (T0288)I83.CB 7.5388 12.5647 16.3340 93.5125 Constraint (T0288)I33.CB (T0288)I83.CB 5.6990 9.4984 12.3479 93.5125 Constraint (T0288)Y32.CB (T0288)I83.CB 7.5241 12.5402 16.3023 93.5125 Constraint (T0288)V36.CB (T0288)R60.CB 12.8737 21.4561 27.8930 93.3881 Constraint (T0288)P41.CB (T0288)K67.CB 12.1289 20.2148 26.2793 93.3881 Constraint (T0288)V36.CB (T0288)K78.CB 12.3122 20.5203 26.6764 93.2447 Constraint (T0288)A50.CB (T0288)E69.CB 12.7503 21.2505 27.6256 93.2129 Constraint (T0288)I62.CB (T0288)E76.CB 7.8433 13.0721 16.9938 93.1243 Constraint (T0288)Y32.CB (T0288)E76.CB 12.1332 20.2220 26.2885 93.1243 Constraint (T0288)L31.CB (T0288)K67.CB 3.9542 6.5903 8.5674 93.0091 Constraint (T0288)F37.CB (T0288)K78.CB 11.4930 19.1551 24.9016 92.9077 Constraint (T0288)T55.CB (T0288)E80.CB 10.6695 17.7825 23.1173 92.9007 Constraint (T0288)F37.CB (T0288)E76.CB 11.9385 19.8976 25.8668 92.8977 Constraint (T0288)I17.CB (T0288)K72.CB 8.2012 13.6687 17.7693 92.6576 Constraint (T0288)T40.CB (T0288)V70.CB 10.6446 17.7411 23.0634 92.6038 Constraint (T0288)D45.CB (T0288)M73.CB 11.0464 18.4107 23.9339 92.6037 Constraint (T0288)D45.CB (T0288)A71.CB 11.7256 19.5427 25.4055 92.6037 Constraint (T0288)D45.CB (T0288)V70.CB 11.0546 18.4244 23.9517 92.6037 Constraint (T0288)D45.CB (T0288)I62.CB 10.9123 18.1872 23.6433 92.6037 Constraint (T0288)V48.CB (T0288)K63.CB 10.8808 18.1347 23.5751 92.6037 Constraint (T0288)T40.CB (T0288)I62.CB 11.9638 19.9397 25.9216 92.6037 Constraint (T0288)L44.CB (T0288)N58.CB 11.4075 19.0125 24.7163 92.6037 Constraint (T0288)L44.CB (T0288)V57.CB 10.9763 18.2938 23.7820 92.6037 Constraint (T0288)L44.CB (T0288)I54.CB 10.5214 17.5356 22.7963 92.6037 Constraint (T0288)L44.CB (T0288)E53.CB 12.2047 20.3412 26.4435 92.6037 Constraint (T0288)Q35.CB (T0288)L44.CB 9.1033 15.1721 19.7238 92.6037 Constraint (T0288)V34.CB (T0288)L44.CB 11.0187 18.3645 23.8739 92.6037 Constraint (T0288)I33.CB (T0288)L44.CB 8.7932 14.6553 19.0519 92.6037 Constraint (T0288)Y32.CB (T0288)L44.CB 12.0804 20.1340 26.1742 92.6037 Constraint (T0288)D45.CB (T0288)V77.CB 9.0932 15.1554 19.7020 92.5068 Constraint (T0288)T40.CB (T0288)V77.CB 8.9988 14.9980 19.4974 92.5068 Constraint (T0288)S61.CB (T0288)E76.CB 9.3450 15.5750 20.2474 92.4912 Constraint (T0288)R60.CB (T0288)E76.CB 6.2453 10.4088 13.5315 92.4912 Constraint (T0288)V48.CB (T0288)E76.CB 11.5718 19.2863 25.0722 92.4912 Constraint (T0288)P41.CB (T0288)E76.CB 9.9567 16.5945 21.5729 92.4912 Constraint (T0288)I21.CB (T0288)K72.CB 7.0829 11.8049 15.3464 92.3586 Constraint (T0288)K67.CB (T0288)I83.CB 9.1781 15.2968 19.8858 92.3090 Constraint (T0288)A43.CB (T0288)V70.CB 11.6124 19.3541 25.1603 92.2247 Constraint (T0288)A43.CB (T0288)I62.CB 12.4067 20.6778 26.8812 92.2247 Constraint (T0288)A43.CB (T0288)E53.CB 10.6326 17.7210 23.0373 92.2247 Constraint (T0288)V34.CB (T0288)A43.CB 8.2647 13.7745 17.9068 92.2247 Constraint (T0288)Y32.CB (T0288)A43.CB 9.8694 16.4489 21.3836 92.2247 Constraint (T0288)L31.CB (T0288)I62.CB 3.3128 5.5213 7.1777 92.2247 Constraint (T0288)L31.CB (T0288)E53.CB 4.1998 6.9997 9.0996 92.2247 Constraint (T0288)L31.CB (T0288)D52.CB 5.7889 9.6482 12.5427 92.2247 Constraint (T0288)A50.CB (T0288)K63.CB 11.7096 19.5160 25.3708 92.2247 Constraint (T0288)A49.CB (T0288)K63.CB 11.5898 19.3163 25.1112 92.2247 Constraint (T0288)E53.CB (T0288)V77.CB 10.9866 18.3110 23.8043 92.1278 Constraint (T0288)D52.CB (T0288)V77.CB 10.4932 17.4886 22.7352 92.1278 Constraint (T0288)A43.CB (T0288)V77.CB 10.7082 17.8471 23.2012 92.1278 Constraint (T0288)A42.CB (T0288)E76.CB 10.4571 17.4285 22.6571 92.1123 Constraint (T0288)I21.CB (T0288)I74.CB 4.7603 7.9339 10.3140 92.0216 Constraint (T0288)I21.CB (T0288)M73.CB 6.5000 10.8333 14.0832 92.0216 Constraint (T0288)I17.CB (T0288)N58.CB 7.1799 11.9665 15.5564 92.0216 Constraint (T0288)I21.CB (T0288)A71.CB 4.3359 7.2264 9.3943 91.9574 Constraint (T0288)I21.CB (T0288)V68.CB 6.4991 10.8318 14.0813 91.9574 Constraint (T0288)I19.CB (T0288)K72.CB 9.2523 15.4205 20.0466 91.9574 Constraint (T0288)I19.CB (T0288)A71.CB 6.8670 11.4449 14.8784 91.9574 Constraint (T0288)I19.CB (T0288)V68.CB 9.8601 16.4334 21.3635 91.9574 Constraint (T0288)I17.CB (T0288)E69.CB 9.7588 16.2646 21.1440 91.9574 Constraint (T0288)I17.CB (T0288)V68.CB 9.9886 16.6477 21.6421 91.9574 Constraint (T0288)T40.CB (T0288)Q75.CB 9.3471 15.5785 20.2521 91.9035 Constraint (T0288)D45.CB (T0288)E80.CB 7.1336 11.8894 15.4562 91.9035 Constraint (T0288)L44.CB (T0288)T82.CB 9.2746 15.4577 20.0950 91.9035 Constraint (T0288)L44.CB (T0288)V81.CB 8.0182 13.3637 17.3728 91.9035 Constraint (T0288)L44.CB (T0288)E80.CB 8.3979 13.9965 18.1955 91.9035 Constraint (T0288)L44.CB (T0288)I74.CB 10.2511 17.0852 22.2108 91.9035 Constraint (T0288)T40.CB (T0288)E80.CB 8.9905 14.9842 19.4795 91.9035 Constraint (T0288)R60.CB (T0288)K78.CB 8.7743 14.6238 19.0109 91.8985 Constraint (T0288)V48.CB (T0288)K78.CB 11.0538 18.4230 23.9498 91.8985 Constraint (T0288)P41.CB (T0288)K78.CB 7.8070 13.0117 16.9152 91.8985 Constraint (T0288)D52.CB (T0288)E80.CB 11.1715 18.6192 24.2050 91.7864 Constraint (T0288)I21.CB (T0288)V70.CB 3.9253 6.5422 8.5049 91.6204 Constraint (T0288)I21.CB (T0288)E69.CB 6.8176 11.3627 14.7715 91.6204 Constraint (T0288)I21.CB (T0288)K67.CB 4.2195 7.0326 9.1424 91.6204 Constraint (T0288)S20.CB (T0288)K72.CB 9.0818 15.1363 19.6772 91.6204 Constraint (T0288)S20.CB (T0288)A71.CB 6.0927 10.1544 13.2007 91.6204 Constraint (T0288)S20.CB (T0288)V68.CB 8.5341 14.2235 18.4906 91.6204 Constraint (T0288)I19.CB (T0288)I74.CB 5.4298 9.0496 11.7645 91.6204 Constraint (T0288)I17.CB (T0288)M73.CB 6.9703 11.6172 15.1024 91.6204 Constraint (T0288)I17.CB (T0288)A71.CB 6.6523 11.0872 14.4133 91.6204 Constraint (T0288)I17.CB (T0288)V70.CB 7.2100 12.0166 15.6216 91.6204 Constraint (T0288)I17.CB (T0288)K67.CB 9.1633 15.2721 19.8537 91.6204 Constraint (T0288)I17.CB (T0288)I62.CB 8.4368 14.0613 18.2797 91.6204 Constraint (T0288)I17.CB (T0288)V57.CB 6.0699 10.1165 13.1514 91.6204 Constraint (T0288)I17.CB (T0288)T55.CB 9.6139 16.0231 20.8300 91.6204 Constraint (T0288)I17.CB (T0288)I54.CB 6.5918 10.9863 14.2822 91.6204 Constraint (T0288)I17.CB (T0288)E53.CB 9.5292 15.8821 20.6467 91.6204 Constraint (T0288)I17.CB (T0288)D52.CB 7.7917 12.9861 16.8819 91.6204 Constraint (T0288)I17.CB (T0288)A50.CB 8.4693 14.1154 18.3501 91.6204 Constraint (T0288)I17.CB (T0288)A49.CB 8.3775 13.9626 18.1513 91.6204 Constraint (T0288)I17.CB (T0288)A42.CB 3.5351 5.8918 7.6593 91.6204 Constraint (T0288)I17.CB (T0288)N39.CB 7.5564 12.5940 16.3722 91.6204 Constraint (T0288)I17.CB (T0288)D38.CB 7.9997 13.3329 17.3328 91.6204 Constraint (T0288)I17.CB (T0288)F37.CB 5.2759 8.7932 11.4312 91.6204 Constraint (T0288)I17.CB (T0288)V36.CB 5.7422 9.5704 12.4415 91.6204 Constraint (T0288)I17.CB (T0288)Q35.CB 7.0107 11.6845 15.1898 91.6204 Constraint (T0288)I17.CB (T0288)V34.CB 7.8671 13.1118 17.0454 91.6204 Constraint (T0288)I17.CB (T0288)I33.CB 6.0827 10.1378 13.1791 91.6204 Constraint (T0288)I17.CB (T0288)Y32.CB 8.7785 14.6308 19.0200 91.6204 Constraint (T0288)L31.CB (T0288)S61.CB 6.4544 10.7574 13.9846 91.5916 Constraint (T0288)L31.CB (T0288)R60.CB 7.1389 11.8982 15.4676 91.5916 Constraint (T0288)L31.CB (T0288)V48.CB 7.6249 12.7081 16.5206 91.5916 Constraint (T0288)L31.CB (T0288)P41.CB 10.5876 17.6460 22.9398 91.5916 Constraint (T0288)K63.CB (T0288)Q75.CB 11.2477 18.7462 24.3701 91.5246 Constraint (T0288)A43.CB (T0288)Q75.CB 11.5767 19.2946 25.0829 91.5246 Constraint (T0288)I62.CB (T0288)I83.CB 5.5143 9.1905 11.9476 91.5246 Constraint (T0288)E53.CB (T0288)I83.CB 6.3099 10.5165 13.6715 91.5246 Constraint (T0288)D52.CB (T0288)I83.CB 5.4165 9.0275 11.7357 91.5246 Constraint (T0288)A43.CB (T0288)I83.CB 8.2710 13.7850 17.9205 91.5246 Constraint (T0288)N39.CB (T0288)I83.CB 11.1246 18.5410 24.1033 91.5246 Constraint (T0288)Q35.CB (T0288)I83.CB 9.2631 15.4384 20.0700 91.5246 Constraint (T0288)V34.CB (T0288)I83.CB 8.8831 14.8052 19.2468 91.5246 Constraint (T0288)S61.CB (T0288)V77.CB 8.8929 14.8215 19.2680 91.4947 Constraint (T0288)T40.CB (T0288)K67.CB 11.8756 19.7927 25.7304 91.4003 Constraint (T0288)I21.CB (T0288)T82.CB 9.5040 15.8400 20.5919 91.3215 Constraint (T0288)I21.CB (T0288)V81.CB 7.6737 12.7894 16.6263 91.3215 Constraint (T0288)I21.CB (T0288)V77.CB 8.1053 13.5088 17.5615 91.3215 Constraint (T0288)I21.CB (T0288)N58.CB 8.9387 14.8978 19.3672 91.3215 Constraint (T0288)I21.CB (T0288)V57.CB 6.2145 10.3574 13.4647 91.3215 Constraint (T0288)S20.CB (T0288)V81.CB 8.9154 14.8589 19.3166 91.3215 Constraint (T0288)S20.CB (T0288)V77.CB 9.4915 15.8192 20.5650 91.3215 Constraint (T0288)S20.CB (T0288)N58.CB 11.1736 18.6227 24.2095 91.3215 Constraint (T0288)I19.CB (T0288)V81.CB 6.3224 10.5373 13.6985 91.3215 Constraint (T0288)I19.CB (T0288)V77.CB 7.7024 12.8373 16.6884 91.3215 Constraint (T0288)I19.CB (T0288)N58.CB 9.0509 15.0849 19.6103 91.3215 Constraint (T0288)I17.CB (T0288)T82.CB 6.9471 11.5785 15.0520 91.3215 Constraint (T0288)I17.CB (T0288)V81.CB 3.9205 6.5342 8.4944 91.3215 Constraint (T0288)I17.CB (T0288)V77.CB 5.0904 8.4839 11.0291 91.3215 Constraint (T0288)L31.CB (T0288)A42.CB 8.2968 13.8280 17.9764 91.2127 Constraint (T0288)S61.CB (T0288)E80.CB 11.0450 18.4084 23.9309 91.1533 Constraint (T0288)A50.CB (T0288)V77.CB 12.4569 20.7615 26.9900 90.9243 Constraint (T0288)I21.CB (T0288)I62.CB 5.6943 9.4905 12.3377 90.9203 Constraint (T0288)I21.CB (T0288)T55.CB 7.4643 12.4406 16.1727 90.9203 Constraint (T0288)I21.CB (T0288)I54.CB 4.1369 6.8948 8.9633 90.9203 Constraint (T0288)I21.CB (T0288)E53.CB 6.0434 10.0724 13.0941 90.9203 Constraint (T0288)I21.CB (T0288)D52.CB 5.9513 9.9188 12.8944 90.9203 Constraint (T0288)I21.CB (T0288)A50.CB 6.4091 10.6818 13.8863 90.9203 Constraint (T0288)I21.CB (T0288)A49.CB 7.7878 12.9797 16.8736 90.9203 Constraint (T0288)I21.CB (T0288)A42.CB 6.6860 11.1433 14.4863 90.9203 Constraint (T0288)I21.CB (T0288)N39.CB 11.2275 18.7125 24.3263 90.9203 Constraint (T0288)I21.CB (T0288)D38.CB 10.2040 17.0067 22.1087 90.9203 Constraint (T0288)I21.CB (T0288)F37.CB 7.4496 12.4161 16.1409 90.9203 Constraint (T0288)I21.CB (T0288)V36.CB 6.4855 10.8091 14.0519 90.9203 Constraint (T0288)I21.CB (T0288)Q35.CB 5.3809 8.9682 11.6587 90.9203 Constraint (T0288)I21.CB (T0288)V34.CB 3.8070 6.3450 8.2485 90.9203 Constraint (T0288)I21.CB (T0288)I33.CB 3.6511 6.0851 7.9107 90.9203 Constraint (T0288)I21.CB (T0288)Y32.CB 3.9681 6.6135 8.5976 90.9203 Constraint (T0288)S20.CB (T0288)T82.CB 11.2880 18.8134 24.4574 90.9203 Constraint (T0288)S20.CB (T0288)I74.CB 6.4191 10.6984 13.9079 90.9203 Constraint (T0288)S20.CB (T0288)M73.CB 8.9964 14.9940 19.4922 90.9203 Constraint (T0288)S20.CB (T0288)V70.CB 6.9607 11.6012 15.0815 90.9203 Constraint (T0288)S20.CB (T0288)E69.CB 9.6249 16.0414 20.8539 90.9203 Constraint (T0288)S20.CB (T0288)K67.CB 6.5785 10.9641 14.2534 90.9203 Constraint (T0288)S20.CB (T0288)I62.CB 8.9726 14.9543 19.4405 90.9203 Constraint (T0288)S20.CB (T0288)V57.CB 8.7842 14.6403 19.0323 90.9203 Constraint (T0288)S20.CB (T0288)T55.CB 10.3493 17.2489 22.4236 90.9203 Constraint (T0288)S20.CB (T0288)I54.CB 6.8813 11.4689 14.9096 90.9203 Constraint (T0288)S20.CB (T0288)E53.CB 8.3766 13.9610 18.1493 90.9203 Constraint (T0288)S20.CB (T0288)D52.CB 7.1015 11.8359 15.3866 90.9203 Constraint (T0288)S20.CB (T0288)A50.CB 5.4928 9.1547 11.9012 90.9203 Constraint (T0288)S20.CB (T0288)A49.CB 7.5708 12.6181 16.4035 90.9203 Constraint (T0288)S20.CB (T0288)A42.CB 5.9579 9.9298 12.9088 90.9203 Constraint (T0288)S20.CB (T0288)N39.CB 8.8782 14.7970 19.2361 90.9203 Constraint (T0288)S20.CB (T0288)D38.CB 7.5170 12.5284 16.2869 90.9203 Constraint (T0288)S20.CB (T0288)F37.CB 4.7892 7.9820 10.3766 90.9203 Constraint (T0288)S20.CB (T0288)V36.CB 4.7517 7.9196 10.2954 90.9203 Constraint (T0288)S20.CB (T0288)Q35.CB 2.6305 4.3842 5.6995 90.9203 Constraint (T0288)S20.CB (T0288)V34.CB 2.8756 4.7927 6.2305 90.9203 Constraint (T0288)S20.CB (T0288)I33.CB 4.2595 7.0992 9.2289 90.9203 Constraint (T0288)S20.CB (T0288)Y32.CB 5.7347 9.5578 12.4251 90.9203 Constraint (T0288)I19.CB (T0288)T82.CB 8.5129 14.1881 18.4445 90.9203 Constraint (T0288)I19.CB (T0288)M73.CB 8.1735 13.6226 17.7093 90.9203 Constraint (T0288)I19.CB (T0288)V70.CB 6.9597 11.5994 15.0793 90.9203 Constraint (T0288)I19.CB (T0288)E69.CB 9.9697 16.6162 21.6010 90.9203 Constraint (T0288)I19.CB (T0288)K67.CB 8.0653 13.4422 17.4748 90.9203 Constraint (T0288)I19.CB (T0288)I62.CB 8.1806 13.6343 17.7246 90.9203 Constraint (T0288)I19.CB (T0288)V57.CB 7.0325 11.7209 15.2372 90.9203 Constraint (T0288)I19.CB (T0288)T55.CB 8.8801 14.8002 19.2403 90.9203 Constraint (T0288)I19.CB (T0288)I54.CB 5.5098 9.1830 11.9379 90.9203 Constraint (T0288)I19.CB (T0288)E53.CB 7.5595 12.5992 16.3790 90.9203 Constraint (T0288)I19.CB (T0288)D52.CB 5.5074 9.1791 11.9328 90.9203 Constraint (T0288)I19.CB (T0288)A50.CB 5.2735 8.7892 11.4260 90.9203 Constraint (T0288)I19.CB (T0288)A49.CB 5.8772 9.7953 12.7339 90.9203 Constraint (T0288)I19.CB (T0288)A42.CB 2.8744 4.7907 6.2279 90.9203 Constraint (T0288)I19.CB (T0288)N39.CB 7.3616 12.2694 15.9502 90.9203 Constraint (T0288)I19.CB (T0288)D38.CB 6.7043 11.1738 14.5259 90.9203 Constraint (T0288)I19.CB (T0288)F37.CB 4.1038 6.8397 8.8916 90.9203 Constraint (T0288)I19.CB (T0288)V36.CB 3.1530 5.2550 6.8315 90.9203 Constraint (T0288)I19.CB (T0288)Q35.CB 4.0104 6.6840 8.6891 90.9203 Constraint (T0288)I19.CB (T0288)V34.CB 4.8079 8.0132 10.4172 90.9203 Constraint (T0288)I19.CB (T0288)I33.CB 3.2217 5.3695 6.9803 90.9203 Constraint (T0288)I19.CB (T0288)Y32.CB 6.1508 10.2513 13.3267 90.9203 Constraint (T0288)I17.CB (T0288)I74.CB 4.0678 6.7797 8.8137 90.9203 Constraint (T0288)S61.CB (T0288)I83.CB 7.0850 11.8084 15.3509 90.8915 Constraint (T0288)R60.CB (T0288)I83.CB 6.3794 10.6324 13.8221 90.8915 Constraint (T0288)V48.CB (T0288)I83.CB 4.6519 7.7532 10.0791 90.8915 Constraint (T0288)P41.CB (T0288)I83.CB 6.6233 11.0388 14.3504 90.8915 Constraint (T0288)T66.CB (T0288)V81.CB 11.3305 18.8841 24.5493 90.6242 Constraint (T0288)V57.CB (T0288)T66.CB 8.0768 13.4613 17.4997 90.6242 Constraint (T0288)T55.CB (T0288)T66.CB 9.0183 15.0305 19.5396 90.6242 Constraint (T0288)I54.CB (T0288)T66.CB 7.8394 13.0657 16.9854 90.6242 Constraint (T0288)I33.CB (T0288)T66.CB 9.9434 16.5723 21.5439 90.6242 Constraint (T0288)Y32.CB (T0288)T66.CB 8.2694 13.7824 17.9171 90.6242 Constraint (T0288)N39.CB (T0288)T82.CB 12.6058 21.0096 27.3125 90.5247 Constraint (T0288)I74.CB (T0288)H84.CB 7.9322 13.2203 17.1864 90.5127 Constraint (T0288)M73.CB (T0288)H84.CB 7.6677 12.7795 16.6134 90.5127 Constraint (T0288)K72.CB (T0288)H84.CB 10.6115 17.6858 22.9915 90.5127 Constraint (T0288)A71.CB (T0288)H84.CB 10.1546 16.9244 22.0017 90.5127 Constraint (T0288)V70.CB (T0288)H84.CB 7.5871 12.6452 16.4387 90.5127 Constraint (T0288)E69.CB (T0288)H84.CB 9.6020 16.0033 20.8043 90.5127 Constraint (T0288)V68.CB (T0288)H84.CB 11.8644 19.7740 25.7061 90.5127 Constraint (T0288)N58.CB (T0288)H84.CB 5.6277 9.3795 12.1934 90.5127 Constraint (T0288)V57.CB (T0288)H84.CB 4.7223 7.8705 10.2317 90.5127 Constraint (T0288)T55.CB (T0288)H84.CB 2.9989 4.9981 6.4976 90.5127 Constraint (T0288)I54.CB (T0288)H84.CB 4.4799 7.4665 9.7065 90.5127 Constraint (T0288)A50.CB (T0288)H84.CB 10.1753 16.9588 22.0465 90.5127 Constraint (T0288)A49.CB (T0288)H84.CB 8.5263 14.2106 18.4737 90.5127 Constraint (T0288)A42.CB (T0288)H84.CB 8.5780 14.2967 18.5857 90.5127 Constraint (T0288)F37.CB (T0288)H84.CB 12.3144 20.5240 26.6812 90.5127 Constraint (T0288)V36.CB (T0288)H84.CB 10.1209 16.8681 21.9285 90.5127 Constraint (T0288)I33.CB (T0288)H84.CB 7.5480 12.5801 16.3541 90.5127 Constraint (T0288)Y32.CB (T0288)H84.CB 8.2511 13.7518 17.8773 90.5127 Constraint (T0288)L31.CB (T0288)Q75.CB 8.3069 13.8448 17.9982 90.5125 Constraint (T0288)T40.CB (T0288)E76.CB 11.3491 18.9151 24.5896 90.5033 Constraint (T0288)V36.CB (T0288)E69.CB 12.5638 20.9396 27.2215 90.2129 Constraint (T0288)A50.CB (T0288)K72.CB 13.1928 21.9880 28.5843 90.2128 Constraint (T0288)C30.CB (T0288)M73.CB 8.5974 14.3290 18.6277 90.2016 Constraint (T0288)C30.CB (T0288)K72.CB 9.8768 16.4613 21.3996 90.2016 Constraint (T0288)C30.CB (T0288)A71.CB 8.3739 13.9566 18.1435 90.2016 Constraint (T0288)C30.CB (T0288)V70.CB 5.8072 9.6786 12.5822 90.2016 Constraint (T0288)C30.CB (T0288)E69.CB 7.4719 12.4532 16.1891 90.2016 Constraint (T0288)C30.CB (T0288)V68.CB 8.5031 14.1718 18.4233 90.2016 Constraint (T0288)C30.CB (T0288)N58.CB 10.3632 17.2720 22.4535 90.2016 Constraint (T0288)C30.CB (T0288)V57.CB 7.6511 12.7518 16.5774 90.2016 Constraint (T0288)C30.CB (T0288)T55.CB 4.8316 8.0527 10.4686 90.2016 Constraint (T0288)C30.CB (T0288)I54.CB 4.6613 7.7688 10.0994 90.2016 Constraint (T0288)C30.CB (T0288)A50.CB 8.5854 14.3090 18.6017 90.2016 Constraint (T0288)C30.CB (T0288)A49.CB 9.2225 15.3708 19.9821 90.2016 Constraint (T0288)Q35.CB (T0288)E76.CB 12.6579 21.0966 27.4255 90.1349 Constraint (T0288)V34.CB (T0288)E76.CB 12.2828 20.4713 26.6127 90.1349 Constraint (T0288)E53.CB (T0288)E76.CB 12.3079 20.5131 26.6671 90.1244 Constraint (T0288)K63.CB (T0288)E76.CB 10.8589 18.0982 23.5277 90.1243 Constraint (T0288)D45.CB (T0288)K78.CB 10.1136 16.8560 21.9129 89.9106 Constraint (T0288)T40.CB (T0288)K78.CB 9.9357 16.5595 21.5273 89.9106 Constraint (T0288)T66.CB (T0288)T82.CB 12.4080 20.6800 26.8840 89.6243 Constraint (T0288)T40.CB (T0288)K72.CB 11.8574 19.7624 25.6911 89.6038 Constraint (T0288)D45.CB (T0288)R60.CB 11.7241 19.5402 25.4023 89.6037 Constraint (T0288)L31.CB (T0288)D45.CB 10.6969 17.8282 23.1767 89.6037 Constraint (T0288)L31.CB (T0288)T40.CB 10.7902 17.9837 23.3788 89.6037 Constraint (T0288)L44.CB (T0288)V77.CB 10.2550 17.0916 22.2191 89.5068 Constraint (T0288)K65.CB (T0288)T82.CB 9.6700 16.1166 20.9516 89.5028 Constraint (T0288)K65.CB (T0288)V81.CB 9.2077 15.3462 19.9501 89.5028 Constraint (T0288)K65.CB (T0288)I74.CB 6.3860 10.6433 13.8363 89.5028 Constraint (T0288)T55.CB (T0288)K65.CB 6.1976 10.3293 13.4281 89.5028 Constraint (T0288)I54.CB (T0288)K65.CB 5.6557 9.4262 12.2541 89.5028 Constraint (T0288)E53.CB (T0288)K65.CB 7.3400 12.2334 15.9034 89.5028 Constraint (T0288)D52.CB (T0288)K65.CB 9.4476 15.7459 20.4697 89.5028 Constraint (T0288)A50.CB (T0288)K65.CB 11.8176 19.6961 25.6049 89.5028 Constraint (T0288)V48.CB (T0288)K65.CB 10.9599 18.2664 23.7464 89.5028 Constraint (T0288)Q35.CB (T0288)K65.CB 11.6513 19.4188 25.2444 89.5028 Constraint (T0288)V34.CB (T0288)K65.CB 9.6009 16.0015 20.8019 89.5028 Constraint (T0288)I33.CB (T0288)K65.CB 8.7695 14.6158 19.0005 89.5028 Constraint (T0288)Y32.CB (T0288)K65.CB 7.4938 12.4897 16.2366 89.5028 Constraint (T0288)C30.CB (T0288)I74.CB 8.8645 14.7741 19.2064 89.5014 Constraint (T0288)I21.CB (T0288)Q75.CB 6.8768 11.4613 14.8996 89.3586 Constraint (T0288)K67.CB (T0288)H84.CB 10.3526 17.2544 22.4307 89.3092 Constraint (T0288)A42.CB (T0288)K63.CB 12.0372 20.0621 26.0807 89.2247 Constraint (T0288)L31.CB (T0288)K63.CB 5.1065 8.5109 11.0642 89.2247 Constraint (T0288)K63.CB (T0288)V77.CB 10.5966 17.6610 22.9592 89.1278 Constraint (T0288)D52.CB (T0288)E76.CB 12.4195 20.6992 26.9089 89.1133 Constraint (T0288)L31.CB (T0288)E76.CB 9.2520 15.4200 20.0460 89.1122 Constraint (T0288)I17.CB (T0288)S61.CB 11.0205 18.3675 23.8778 88.9994 Constraint (T0288)I17.CB (T0288)R60.CB 9.1402 15.2337 19.8037 88.9994 Constraint (T0288)I17.CB (T0288)V48.CB 5.3501 8.9169 11.5920 88.9994 Constraint (T0288)I17.CB (T0288)D45.CB 5.9675 9.9458 12.9295 88.9994 Constraint (T0288)I17.CB (T0288)P41.CB 3.3610 5.6016 7.2821 88.9994 Constraint (T0288)I17.CB (T0288)T40.CB 4.3161 7.1935 9.3516 88.9994 Constraint (T0288)C30.CB (T0288)K67.CB 5.9226 9.8711 12.8324 88.9981 Constraint (T0288)I19.CB (T0288)Q75.CB 7.5771 12.6286 16.4171 88.9574 Constraint (T0288)I17.CB (T0288)Q75.CB 5.7781 9.6302 12.5193 88.9574 Constraint (T0288)E53.CB (T0288)E80.CB 12.4130 20.6884 26.8949 88.9128 Constraint (T0288)D45.CB (T0288)Q75.CB 11.2017 18.6695 24.2703 88.9036 Constraint (T0288)D45.CB (T0288)I83.CB 5.7597 9.5995 12.4793 88.9035 Constraint (T0288)L44.CB (T0288)I83.CB 8.3340 13.8901 18.0571 88.9035 Constraint (T0288)T40.CB (T0288)I83.CB 8.2290 13.7149 17.8294 88.9035 Constraint (T0288)L31.CB (T0288)E80.CB 11.6593 19.4322 25.2619 88.7743 Constraint (T0288)I21.CB (T0288)R60.CB 8.6071 14.3452 18.6487 88.7004 Constraint (T0288)I21.CB (T0288)E76.CB 8.7038 14.5063 18.8582 88.6585 Constraint (T0288)I19.CB (T0288)E76.CB 9.5594 15.9323 20.7120 88.6585 Constraint (T0288)I62.CB (T0288)K78.CB 10.6689 17.7814 23.1158 88.6579 Constraint (T0288)I33.CB (T0288)K78.CB 12.1310 20.2183 26.2838 88.6459 Constraint (T0288)E53.CB (T0288)T66.CB 9.2050 15.3417 19.9442 88.6363 Constraint (T0288)Q35.CB (T0288)T66.CB 11.8385 19.7308 25.6500 88.6363 Constraint (T0288)V34.CB (T0288)T66.CB 9.6168 16.0281 20.8365 88.6363 Constraint (T0288)I17.CB (T0288)K63.CB 11.6185 19.3642 25.1734 88.6204 Constraint (T0288)S20.CB (T0288)Q75.CB 7.8324 13.0540 16.9702 88.6204 Constraint (T0288)I17.CB (T0288)A43.CB 6.1097 10.1828 13.2376 88.6204 Constraint (T0288)P41.CB (T0288)E69.CB 12.7274 21.2123 27.5759 88.5917 Constraint (T0288)I62.CB (T0288)H84.CB 5.3290 8.8817 11.5463 88.5248 Constraint (T0288)E53.CB (T0288)H84.CB 5.7634 9.6057 12.4874 88.5248 Constraint (T0288)D52.CB (T0288)H84.CB 6.1369 10.2281 13.2966 88.5248 Constraint (T0288)A43.CB (T0288)H84.CB 10.9924 18.3207 23.8169 88.5248 Constraint (T0288)Q35.CB (T0288)H84.CB 11.7014 19.5024 25.3531 88.5248 Constraint (T0288)V34.CB (T0288)H84.CB 10.7519 17.9199 23.2958 88.5248 Constraint (T0288)K63.CB (T0288)I83.CB 8.0398 13.3996 17.4195 88.5246 Constraint (T0288)C30.CB (T0288)T82.CB 10.8094 18.0157 23.4205 88.5015 Constraint (T0288)C30.CB (T0288)V81.CB 10.7784 17.9640 23.3532 88.5015 Constraint (T0288)S20.CB (T0288)E76.CB 10.3625 17.2708 22.4520 88.3215 Constraint (T0288)I21.CB (T0288)E80.CB 11.0195 18.3659 23.8756 88.3215 Constraint (T0288)S20.CB (T0288)E80.CB 11.9331 19.8884 25.8550 88.3215 Constraint (T0288)I19.CB (T0288)E80.CB 9.1777 15.2961 19.8849 88.3215 Constraint (T0288)I17.CB (T0288)E80.CB 6.4040 10.6733 13.8752 88.3215 Constraint (T0288)I21.CB (T0288)T66.CB 6.8698 11.4497 14.8846 88.2993 Constraint (T0288)I21.CB (T0288)K65.CB 6.3897 10.6495 13.8443 88.2993 Constraint (T0288)I21.CB (T0288)S61.CB 9.0292 15.0487 19.5634 88.2993 Constraint (T0288)I21.CB (T0288)V48.CB 6.5544 10.9241 14.2013 88.2993 Constraint (T0288)I21.CB (T0288)D45.CB 9.5980 15.9967 20.7957 88.2993 Constraint (T0288)I21.CB (T0288)P41.CB 8.6950 14.4917 18.8392 88.2993 Constraint (T0288)I21.CB (T0288)T40.CB 8.3084 13.8473 18.0015 88.2993 Constraint (T0288)S20.CB (T0288)T66.CB 9.6447 16.0744 20.8968 88.2993 Constraint (T0288)S20.CB (T0288)K65.CB 9.6604 16.1006 20.9308 88.2993 Constraint (T0288)S20.CB (T0288)S61.CB 12.2691 20.4485 26.5831 88.2993 Constraint (T0288)S20.CB (T0288)R60.CB 11.5143 19.1905 24.9476 88.2993 Constraint (T0288)S20.CB (T0288)V48.CB 6.5940 10.9901 14.2871 88.2993 Constraint (T0288)S20.CB (T0288)D45.CB 9.3802 15.6337 20.3238 88.2993 Constraint (T0288)S20.CB (T0288)P41.CB 7.8959 13.1598 17.1078 88.2993 Constraint (T0288)S20.CB (T0288)T40.CB 6.4477 10.7462 13.9701 88.2993 Constraint (T0288)I19.CB (T0288)T66.CB 10.7069 17.8449 23.1984 88.2993 Constraint (T0288)I19.CB (T0288)K65.CB 9.6927 16.1545 21.0008 88.2993 Constraint (T0288)I19.CB (T0288)S61.CB 11.1439 18.5732 24.1451 88.2993 Constraint (T0288)I19.CB (T0288)R60.CB 10.1853 16.9755 22.0682 88.2993 Constraint (T0288)I19.CB (T0288)V48.CB 3.7648 6.2746 8.1570 88.2993 Constraint (T0288)I19.CB (T0288)D45.CB 6.2312 10.3854 13.5010 88.2993 Constraint (T0288)I19.CB (T0288)P41.CB 5.0755 8.4591 10.9969 88.2993 Constraint (T0288)I19.CB (T0288)T40.CB 4.4237 7.3728 9.5847 88.2993 Constraint (T0288)I17.CB (T0288)T66.CB 11.2994 18.8323 24.4820 88.2993 Constraint (T0288)I17.CB (T0288)K65.CB 9.9856 16.6427 21.6355 88.2993 Constraint (T0288)C30.CB (T0288)I62.CB 4.7234 7.8723 10.2340 88.2136 Constraint (T0288)C30.CB (T0288)E53.CB 3.3897 5.6495 7.3443 88.2136 Constraint (T0288)C30.CB (T0288)D52.CB 6.3016 10.5026 13.6534 88.2136 Constraint (T0288)L31.CB (T0288)V77.CB 8.7480 14.5800 18.9540 88.1158 Constraint (T0288)I21.CB (T0288)K63.CB 8.1606 13.6010 17.6813 87.9203 Constraint (T0288)S20.CB (T0288)K63.CB 11.4399 19.0665 24.7865 87.9203 Constraint (T0288)I19.CB (T0288)K63.CB 10.8694 18.1157 23.5504 87.9203 Constraint (T0288)I17.CB (T0288)E76.CB 7.3200 12.2000 15.8600 87.9203 Constraint (T0288)I21.CB (T0288)A43.CB 9.0564 15.0940 19.6222 87.9203 Constraint (T0288)S20.CB (T0288)A43.CB 7.4242 12.3737 16.0858 87.9203 Constraint (T0288)I19.CB (T0288)A43.CB 5.1571 8.5951 11.1737 87.9203 Constraint (T0288)S61.CB (T0288)H84.CB 5.3187 8.8644 11.5238 87.8917 Constraint (T0288)R60.CB (T0288)H84.CB 6.0382 10.0637 13.0829 87.8917 Constraint (T0288)V48.CB (T0288)H84.CB 6.9344 11.5574 15.0246 87.8917 Constraint (T0288)P41.CB (T0288)H84.CB 9.8326 16.3877 21.3040 87.8917 Constraint (T0288)A43.CB (T0288)K78.CB 11.7643 19.6071 25.4893 87.6580 Constraint (T0288)T66.CB (T0288)V77.CB 10.2580 17.0967 22.2257 87.6242 Constraint (T0288)T66.CB (T0288)E76.CB 8.9093 14.8489 19.3035 87.6242 Constraint (T0288)T66.CB (T0288)Q75.CB 8.4620 14.1033 18.3343 87.6242 Constraint (T0288)C30.CB (T0288)S61.CB 6.6943 11.1572 14.5043 87.5805 Constraint (T0288)C30.CB (T0288)R60.CB 8.6198 14.3664 18.6763 87.5805 Constraint (T0288)C30.CB (T0288)V48.CB 9.2169 15.3615 19.9700 87.5805 Constraint (T0288)Q75.CB (T0288)H84.CB 10.8687 18.1146 23.5489 87.5127 Constraint (T0288)L31.CB (T0288)I83.CB 6.2864 10.4773 13.6205 87.5125 Constraint (T0288)D38.CB (T0288)Q75.CB 12.4361 20.7269 26.9449 87.5125 Constraint (T0288)I21.CB (T0288)K78.CB 11.1426 18.5710 24.1423 87.4478 Constraint (T0288)I19.CB (T0288)K78.CB 9.9839 16.6398 21.6317 87.4478 Constraint (T0288)I17.CB (T0288)K78.CB 6.8980 11.4967 14.9458 87.4478 Constraint (T0288)N39.CB (T0288)K78.CB 12.3765 20.6275 26.8158 87.3580 Constraint (T0288)C30.CB (T0288)A42.CB 10.5122 17.5204 22.7765 87.2016 Constraint (T0288)L44.CB (T0288)K78.CB 10.6974 17.8291 23.1778 86.9106 Constraint (T0288)L44.CB (T0288)T55.CB 12.6929 21.1549 27.5013 86.6037 Constraint (T0288)D38.CB (T0288)E80.CB 12.5782 20.9636 27.2527 86.5126 Constraint (T0288)A42.CB (T0288)K65.CB 11.4210 19.0351 24.7456 86.5028 Constraint (T0288)K65.CB (T0288)V77.CB 8.4478 14.0797 18.3036 86.5028 Constraint (T0288)K65.CB (T0288)E76.CB 7.8346 13.0577 16.9750 86.5028 Constraint (T0288)K65.CB (T0288)Q75.CB 8.0301 13.3835 17.3985 86.5028 Constraint (T0288)C30.CB (T0288)Q75.CB 11.2788 18.7980 24.4374 86.5014 Constraint (T0288)K63.CB (T0288)E80.CB 13.0094 21.6823 28.1870 86.2388 Constraint (T0288)L31.CB (T0288)A43.CB 10.9567 18.2612 23.7395 86.2247 Constraint (T0288)I17.CB (T0288)L44.CB 6.5087 10.8479 14.1022 85.9994 Constraint (T0288)Q35.CB (T0288)K63.CB 12.6157 21.0262 27.3340 85.9247 Constraint (T0288)D45.CB (T0288)H84.CB 8.1324 13.5540 17.6202 85.9038 Constraint (T0288)L44.CB (T0288)H84.CB 11.0302 18.3837 23.8988 85.9038 Constraint (T0288)T40.CB (T0288)H84.CB 11.4337 19.0562 24.7730 85.9038 Constraint (T0288)L44.CB (T0288)Q75.CB 11.9327 19.8878 25.8542 85.9035 Constraint (T0288)D38.CB (T0288)V77.CB 12.5837 20.9729 27.2647 85.8228 Constraint (T0288)D52.CB (T0288)T66.CB 11.1256 18.5426 24.1054 85.6364 Constraint (T0288)I17.CB (T0288)L31.CB 7.8967 13.1612 17.1095 85.6204 Constraint (T0288)K63.CB (T0288)H84.CB 6.4532 10.7553 13.9819 85.5248 Constraint (T0288)N39.CB (T0288)Q75.CB 12.1869 20.3116 26.4050 85.5246 Constraint (T0288)A49.CB (T0288)K65.CB 12.2797 20.4661 26.6060 85.5030 Constraint (T0288)I21.CB (T0288)L44.CB 10.8743 18.1239 23.5610 85.2993 Constraint (T0288)S20.CB (T0288)L44.CB 9.7533 16.2554 21.1321 85.2993 Constraint (T0288)I19.CB (T0288)L44.CB 6.9698 11.6163 15.1012 85.2993 Constraint (T0288)C30.CB (T0288)K63.CB 4.4290 7.3817 9.5963 85.2136 Constraint (T0288)E69.CB (T0288)K78.CB 10.7735 17.9559 23.3426 84.9840 Constraint (T0288)I21.CB (T0288)L31.CB 3.1659 5.2764 6.8594 84.9203 Constraint (T0288)S20.CB (T0288)L31.CB 6.4079 10.6798 13.8837 84.9203 Constraint (T0288)I19.CB (T0288)L31.CB 6.4878 10.8129 14.0568 84.9203 Constraint (T0288)I21.CB (T0288)I83.CB 6.4119 10.6866 13.8925 84.9203 Constraint (T0288)S20.CB (T0288)I83.CB 8.2685 13.7808 17.9150 84.9203 Constraint (T0288)I19.CB (T0288)I83.CB 5.6494 9.4157 12.2404 84.9203 Constraint (T0288)I17.CB (T0288)I83.CB 5.2830 8.8051 11.4466 84.9203 Constraint (T0288)L9.CB (T0288)K72.CB 10.5554 17.5923 22.8700 84.6302 Constraint (T0288)L31.CB (T0288)T66.CB 5.5122 9.1870 11.9431 84.6242 Constraint (T0288)T66.CB (T0288)I83.CB 10.4709 17.4515 22.6870 84.6242 Constraint (T0288)L31.CB (T0288)H84.CB 6.9580 11.5966 15.0756 84.5127 Constraint (T0288)D45.CB (T0288)E76.CB 11.9662 19.9437 25.9268 84.5034 Constraint (T0288)S20.CB (T0288)K78.CB 11.8973 19.8288 25.7775 84.4478 Constraint (T0288)Q10.CB (T0288)T82.CB 5.9697 9.9495 12.9344 84.2932 Constraint (T0288)Q10.CB (T0288)V81.CB 4.4784 7.4639 9.7031 84.2932 Constraint (T0288)Q10.CB (T0288)V77.CB 6.3641 10.6068 13.7888 84.2932 Constraint (T0288)Q10.CB (T0288)E76.CB 9.4435 15.7392 20.4609 84.2932 Constraint (T0288)Q10.CB (T0288)Q75.CB 9.1840 15.3066 19.8986 84.2932 Constraint (T0288)Q10.CB (T0288)I74.CB 7.9290 13.2149 17.1794 84.2932 Constraint (T0288)Q10.CB (T0288)M73.CB 9.8231 16.3719 21.2834 84.2932 Constraint (T0288)Q10.CB (T0288)A71.CB 11.1159 18.5264 24.0844 84.2932 Constraint (T0288)Q10.CB (T0288)V70.CB 11.1440 18.5734 24.1454 84.2932 Constraint (T0288)Q10.CB (T0288)R60.CB 10.6232 17.7054 23.0170 84.2932 Constraint (T0288)Q10.CB (T0288)N58.CB 7.4591 12.4318 16.1614 84.2932 Constraint (T0288)Q10.CB (T0288)V57.CB 8.1475 13.5791 17.6528 84.2932 Constraint (T0288)Q10.CB (T0288)T55.CB 11.4876 19.1460 24.8899 84.2932 Constraint (T0288)Q10.CB (T0288)I54.CB 9.6360 16.0600 20.8779 84.2932 Constraint (T0288)Q10.CB (T0288)A50.CB 11.8092 19.6819 25.5865 84.2932 Constraint (T0288)Q10.CB (T0288)A49.CB 10.4790 17.4649 22.7044 84.2932 Constraint (T0288)Q10.CB (T0288)V48.CB 7.3230 12.2051 15.8666 84.2932 Constraint (T0288)Q10.CB (T0288)A42.CB 6.0516 10.0861 13.1119 84.2932 Constraint (T0288)Q10.CB (T0288)P41.CB 3.9345 6.5575 8.5247 84.2932 Constraint (T0288)Q10.CB (T0288)D38.CB 10.1273 16.8788 21.9424 84.2932 Constraint (T0288)Q10.CB (T0288)F37.CB 8.6957 14.4929 18.8408 84.2932 Constraint (T0288)Q10.CB (T0288)V36.CB 8.8845 14.8075 19.2498 84.2932 Constraint (T0288)Q10.CB (T0288)I33.CB 9.7867 16.3112 21.2046 84.2932 Constraint (T0288)L9.CB (T0288)T82.CB 4.5443 7.5739 9.8460 84.2932 Constraint (T0288)L9.CB (T0288)V81.CB 3.2529 5.4216 7.0480 84.2932 Constraint (T0288)L9.CB (T0288)V77.CB 5.8215 9.7025 12.6132 84.2932 Constraint (T0288)L9.CB (T0288)E76.CB 8.9847 14.9745 19.4669 84.2932 Constraint (T0288)L9.CB (T0288)Q75.CB 8.5245 14.2075 18.4697 84.2932 Constraint (T0288)L9.CB (T0288)I74.CB 6.4677 10.7795 14.0133 84.2932 Constraint (T0288)L9.CB (T0288)M73.CB 8.4243 14.0405 18.2526 84.2932 Constraint (T0288)L9.CB (T0288)A71.CB 9.6441 16.0735 20.8956 84.2932 Constraint (T0288)L9.CB (T0288)V70.CB 9.1838 15.3064 19.8983 84.2932 Constraint (T0288)L9.CB (T0288)E69.CB 11.6769 19.4615 25.2999 84.2932 Constraint (T0288)L9.CB (T0288)S61.CB 10.6897 17.8162 23.1610 84.2932 Constraint (T0288)L9.CB (T0288)R60.CB 9.0804 15.1340 19.6743 84.2932 Constraint (T0288)L9.CB (T0288)N58.CB 6.3161 10.5268 13.6849 84.2932 Constraint (T0288)L9.CB (T0288)V57.CB 6.2583 10.4306 13.5597 84.2932 Constraint (T0288)L9.CB (T0288)T55.CB 9.0008 15.0013 19.5016 84.2932 Constraint (T0288)L9.CB (T0288)I54.CB 7.1140 11.8567 15.4137 84.2932 Constraint (T0288)L9.CB (T0288)A50.CB 9.5982 15.9970 20.7960 84.2932 Constraint (T0288)L9.CB (T0288)A49.CB 8.2069 13.6782 17.7816 84.2932 Constraint (T0288)L9.CB (T0288)V48.CB 5.0159 8.3599 10.8679 84.2932 Constraint (T0288)L9.CB (T0288)A42.CB 4.3094 7.1823 9.3370 84.2932 Constraint (T0288)L9.CB (T0288)P41.CB 3.6431 6.0719 7.8934 84.2932 Constraint (T0288)L9.CB (T0288)D38.CB 9.5020 15.8367 20.5877 84.2932 Constraint (T0288)L9.CB (T0288)F37.CB 7.8052 13.0087 16.9113 84.2932 Constraint (T0288)L9.CB (T0288)V36.CB 7.1488 11.9147 15.4891 84.2932 Constraint (T0288)L9.CB (T0288)I33.CB 7.3612 12.2687 15.9493 84.2932 Constraint (T0288)T8.CB (T0288)T82.CB 3.3424 5.5706 7.2418 84.2932 Constraint (T0288)T8.CB (T0288)V81.CB 4.5272 7.5454 9.8090 84.2932 Constraint (T0288)T8.CB (T0288)V77.CB 7.0635 11.7725 15.3043 84.2932 Constraint (T0288)T8.CB (T0288)E76.CB 10.2684 17.1141 22.2483 84.2932 Constraint (T0288)T8.CB (T0288)Q75.CB 10.4934 17.4889 22.7356 84.2932 Constraint (T0288)T8.CB (T0288)I74.CB 8.2306 13.7176 17.8329 84.2932 Constraint (T0288)T8.CB (T0288)M73.CB 9.3979 15.6631 20.3621 84.2932 Constraint (T0288)T8.CB (T0288)K72.CB 12.0043 20.0072 26.0094 84.2932 Constraint (T0288)T8.CB (T0288)A71.CB 11.4787 19.1312 24.8706 84.2932 Constraint (T0288)T8.CB (T0288)V70.CB 10.3826 17.3043 22.4956 84.2932 Constraint (T0288)T8.CB (T0288)S61.CB 10.2277 17.0462 22.1601 84.2932 Constraint (T0288)T8.CB (T0288)R60.CB 8.9836 14.9727 19.4646 84.2932 Constraint (T0288)T8.CB (T0288)N58.CB 6.1484 10.2473 13.3214 84.2932 Constraint (T0288)T8.CB (T0288)V57.CB 6.7447 11.2412 14.6136 84.2932 Constraint (T0288)T8.CB (T0288)T55.CB 8.5491 14.2485 18.5230 84.2932 Constraint (T0288)T8.CB (T0288)I54.CB 7.7683 12.9472 16.8314 84.2932 Constraint (T0288)T8.CB (T0288)A50.CB 10.9716 18.2860 23.7717 84.2932 Constraint (T0288)T8.CB (T0288)A49.CB 8.9417 14.9028 19.3737 84.2932 Constraint (T0288)T8.CB (T0288)V48.CB 6.1812 10.3020 13.3926 84.2932 Constraint (T0288)T8.CB (T0288)A42.CB 6.5080 10.8467 14.1007 84.2932 Constraint (T0288)T8.CB (T0288)P41.CB 6.1371 10.2285 13.2970 84.2932 Constraint (T0288)T8.CB (T0288)F37.CB 10.3358 17.2264 22.3943 84.2932 Constraint (T0288)T8.CB (T0288)V36.CB 9.1062 15.1770 19.7301 84.2932 Constraint (T0288)T8.CB (T0288)I33.CB 8.7954 14.6590 19.0567 84.2932 Constraint (T0288)T8.CB (T0288)Y32.CB 11.2137 18.6895 24.2963 84.2932 Constraint (T0288)A49.CB (T0288)Q75.CB 12.9027 21.5046 27.9559 84.1243 Constraint (T0288)K65.CB (T0288)E80.CB 12.0576 20.0959 26.1247 84.1016 Constraint (T0288)Q10.CB (T0288)I21.CB 10.5382 17.5637 22.8328 84.0375 Constraint (T0288)Q10.CB (T0288)S20.CB 10.5987 17.6645 22.9639 84.0375 Constraint (T0288)Q10.CB (T0288)I19.CB 7.7044 12.8406 16.6928 84.0375 Constraint (T0288)L9.CB (T0288)I21.CB 8.3987 13.9979 18.1972 83.6363 Constraint (T0288)L9.CB (T0288)S20.CB 8.8740 14.7900 19.2270 83.6363 Constraint (T0288)L9.CB (T0288)I19.CB 5.7816 9.6360 12.5268 83.6363 Constraint (T0288)A50.CB (T0288)T66.CB 12.4824 20.8041 27.0453 83.6245 Constraint (T0288)L44.CB (T0288)M73.CB 12.7101 21.1836 27.5386 83.6038 Constraint (T0288)L31.CB (T0288)L44.CB 12.5661 20.9435 27.2266 83.6037 Constraint (T0288)V36.CB (T0288)K65.CB 12.1890 20.3151 26.4096 83.5029 Constraint (T0288)L31.CB (T0288)K65.CB 4.1818 6.9696 9.0605 83.5028 Constraint (T0288)K65.CB (T0288)I83.CB 8.0222 13.3704 17.3815 83.5028 Constraint (T0288)C30.CB (T0288)I83.CB 8.0782 13.4636 17.5027 83.5014 Constraint (T0288)Q10.CB (T0288)I62.CB 11.3261 18.8768 24.5399 83.2993 Constraint (T0288)Q10.CB (T0288)E53.CB 12.4044 20.6740 26.8762 83.2993 Constraint (T0288)Q10.CB (T0288)D52.CB 10.3694 17.2824 22.4671 83.2993 Constraint (T0288)Q10.CB (T0288)D45.CB 5.2339 8.7232 11.3401 83.2993 Constraint (T0288)Q10.CB (T0288)T40.CB 6.5164 10.8607 14.1189 83.2993 Constraint (T0288)Q10.CB (T0288)N39.CB 8.5722 14.2870 18.5731 83.2993 Constraint (T0288)Q10.CB (T0288)Q35.CB 11.2957 18.8262 24.4741 83.2993 Constraint (T0288)L9.CB (T0288)K65.CB 11.2503 18.7505 24.3757 83.2993 Constraint (T0288)L9.CB (T0288)I62.CB 9.1226 15.2043 19.7656 83.2993 Constraint (T0288)L9.CB (T0288)E53.CB 9.7327 16.2212 21.0876 83.2993 Constraint (T0288)L9.CB (T0288)D52.CB 7.7668 12.9447 16.8281 83.2993 Constraint (T0288)L9.CB (T0288)D45.CB 3.9057 6.5096 8.4625 83.2993 Constraint (T0288)L9.CB (T0288)T40.CB 6.0155 10.0258 13.0335 83.2993 Constraint (T0288)L9.CB (T0288)N39.CB 8.6172 14.3620 18.6706 83.2993 Constraint (T0288)L9.CB (T0288)Q35.CB 9.5474 15.9124 20.6861 83.2993 Constraint (T0288)L9.CB (T0288)V34.CB 10.2740 17.1233 22.2603 83.2993 Constraint (T0288)T8.CB (T0288)K65.CB 11.8606 19.7677 25.6980 83.2993 Constraint (T0288)T8.CB (T0288)I62.CB 9.4690 15.7816 20.5161 83.2993 Constraint (T0288)T8.CB (T0288)E53.CB 9.9271 16.5452 21.5087 83.2993 Constraint (T0288)T8.CB (T0288)D52.CB 8.2725 13.7874 17.9236 83.2993 Constraint (T0288)T8.CB (T0288)D45.CB 4.7026 7.8377 10.1890 83.2993 Constraint (T0288)T8.CB (T0288)T40.CB 8.5430 14.2383 18.5098 83.2993 Constraint (T0288)T8.CB (T0288)N39.CB 10.8143 18.0238 23.4310 83.2993 Constraint (T0288)T8.CB (T0288)Q35.CB 11.7222 19.5370 25.3981 83.2993 Constraint (T0288)T8.CB (T0288)V34.CB 12.1076 20.1794 26.2332 83.2993 Constraint (T0288)T8.CB (T0288)I21.CB 10.1676 16.9460 22.0298 83.2993 Constraint (T0288)T8.CB (T0288)S20.CB 11.1965 18.6609 24.2592 83.2993 Constraint (T0288)T8.CB (T0288)I19.CB 8.0688 13.4480 17.4824 83.2993 Constraint (T0288)T8.CB (T0288)I17.CB 6.6761 11.1269 14.4650 83.2993 Constraint (T0288)V7.CB (T0288)T82.CB 4.3451 7.2418 9.4143 83.2993 Constraint (T0288)V7.CB (T0288)V81.CB 5.4671 9.1118 11.8453 83.2993 Constraint (T0288)V7.CB (T0288)V77.CB 8.0832 13.4719 17.5135 83.2993 Constraint (T0288)V7.CB (T0288)E76.CB 11.0801 18.4668 24.0068 83.2993 Constraint (T0288)V7.CB (T0288)I74.CB 8.1293 13.5488 17.6134 83.2993 Constraint (T0288)V7.CB (T0288)M73.CB 9.3887 15.6479 20.3423 83.2993 Constraint (T0288)V7.CB (T0288)A71.CB 11.0301 18.3835 23.8986 83.2993 Constraint (T0288)V7.CB (T0288)V70.CB 9.4919 15.8198 20.5657 83.2993 Constraint (T0288)V7.CB (T0288)E69.CB 12.1639 20.2732 26.3551 83.2993 Constraint (T0288)V7.CB (T0288)K65.CB 10.8486 18.0810 23.5053 83.2993 Constraint (T0288)V7.CB (T0288)I62.CB 8.3051 13.8419 17.9944 83.2993 Constraint (T0288)V7.CB (T0288)S61.CB 9.3114 15.5191 20.1748 83.2993 Constraint (T0288)V7.CB (T0288)R60.CB 8.9293 14.8822 19.3469 83.2993 Constraint (T0288)V7.CB (T0288)N58.CB 6.9718 11.6196 15.1055 83.2993 Constraint (T0288)V7.CB (T0288)V57.CB 6.4270 10.7117 13.9252 83.2993 Constraint (T0288)V7.CB (T0288)T55.CB 6.6668 11.1113 14.4447 83.2993 Constraint (T0288)V7.CB (T0288)I54.CB 6.0015 10.0026 13.0033 83.2993 Constraint (T0288)V7.CB (T0288)E53.CB 7.4872 12.4787 16.2223 83.2993 Constraint (T0288)V7.CB (T0288)D52.CB 5.7174 9.5290 12.3877 83.2993 Constraint (T0288)V7.CB (T0288)A50.CB 8.8040 14.6734 19.0754 83.2993 Constraint (T0288)V7.CB (T0288)A49.CB 6.5604 10.9340 14.2142 83.2993 Constraint (T0288)V7.CB (T0288)V48.CB 4.2438 7.0730 9.1949 83.2993 Constraint (T0288)V7.CB (T0288)D45.CB 4.2418 7.0697 9.1907 83.2993 Constraint (T0288)V7.CB (T0288)A42.CB 5.6642 9.4403 12.2724 83.2993 Constraint (T0288)V7.CB (T0288)P41.CB 6.6429 11.0714 14.3929 83.2993 Constraint (T0288)V7.CB (T0288)T40.CB 8.3779 13.9632 18.1522 83.2993 Constraint (T0288)V7.CB (T0288)F37.CB 9.7546 16.2576 21.1349 83.2993 Constraint (T0288)V7.CB (T0288)V36.CB 7.6823 12.8038 16.6449 83.2993 Constraint (T0288)V7.CB (T0288)Q35.CB 10.1826 16.9710 22.0623 83.2993 Constraint (T0288)V7.CB (T0288)V34.CB 10.2493 17.0821 22.2067 83.2993 Constraint (T0288)V7.CB (T0288)I33.CB 6.7961 11.3268 14.7248 83.2993 Constraint (T0288)V7.CB (T0288)Y32.CB 9.0305 15.0509 19.5661 83.2993 Constraint (T0288)V7.CB (T0288)I21.CB 8.7437 14.5729 18.9447 83.2993 Constraint (T0288)V7.CB (T0288)S20.CB 9.9249 16.5414 21.5038 83.2993 Constraint (T0288)V7.CB (T0288)I19.CB 6.9157 11.5261 14.9840 83.2993 Constraint (T0288)V7.CB (T0288)I17.CB 6.7609 11.2681 14.6486 83.2993 Constraint (T0288)L9.CB (T0288)Y32.CB 10.0867 16.8111 21.8545 83.2932 Constraint (T0288)T8.CB (T0288)D38.CB 11.6260 19.3767 25.1897 83.2932 Constraint (T0288)V36.CB (T0288)K63.CB 12.6280 21.0467 27.3608 83.2247 Constraint (T0288)I17.CB (T0288)C30.CB 10.7191 17.8652 23.2247 82.6204 Constraint (T0288)Q10.CB (T0288)V34.CB 12.3870 20.6450 26.8385 82.2994 Constraint (T0288)V7.CB (T0288)Q75.CB 10.8777 18.1296 23.5684 82.2993 Constraint (T0288)K6.CB (T0288)T82.CB 4.3573 7.2622 9.4409 82.2993 Constraint (T0288)K6.CB (T0288)V81.CB 6.9983 11.6638 15.1630 82.2993 Constraint (T0288)K6.CB (T0288)V77.CB 9.2806 15.4676 20.1079 82.2993 Constraint (T0288)K6.CB (T0288)I74.CB 9.6429 16.0715 20.8930 82.2993 Constraint (T0288)K6.CB (T0288)M73.CB 10.0840 16.8066 21.8486 82.2993 Constraint (T0288)K6.CB (T0288)A71.CB 12.4513 20.7521 26.9778 82.2993 Constraint (T0288)K6.CB (T0288)V70.CB 10.3728 17.2880 22.4745 82.2993 Constraint (T0288)K6.CB (T0288)K65.CB 11.0239 18.3732 23.8852 82.2993 Constraint (T0288)K6.CB (T0288)I62.CB 8.4175 14.0292 18.2380 82.2993 Constraint (T0288)K6.CB (T0288)S61.CB 8.4097 14.0162 18.2211 82.2993 Constraint (T0288)K6.CB (T0288)R60.CB 8.5985 14.3308 18.6301 82.2993 Constraint (T0288)K6.CB (T0288)N58.CB 7.0724 11.7873 15.3235 82.2993 Constraint (T0288)K6.CB (T0288)V57.CB 6.9752 11.6254 15.1130 82.2993 Constraint (T0288)K6.CB (T0288)T55.CB 6.0300 10.0500 13.0650 82.2993 Constraint (T0288)K6.CB (T0288)I54.CB 6.8711 11.4519 14.8875 82.2993 Constraint (T0288)K6.CB (T0288)E53.CB 7.7915 12.9859 16.8817 82.2993 Constraint (T0288)K6.CB (T0288)D52.CB 6.9522 11.5869 15.0630 82.2993 Constraint (T0288)K6.CB (T0288)A50.CB 10.6871 17.8118 23.1554 82.2993 Constraint (T0288)K6.CB (T0288)A49.CB 8.2783 13.7971 17.9363 82.2993 Constraint (T0288)K6.CB (T0288)V48.CB 6.7234 11.2057 14.5674 82.2993 Constraint (T0288)K6.CB (T0288)D45.CB 6.7924 11.3206 14.7168 82.2993 Constraint (T0288)K6.CB (T0288)A42.CB 8.4154 14.0257 18.2334 82.2993 Constraint (T0288)K6.CB (T0288)P41.CB 9.2654 15.4423 20.0749 82.2993 Constraint (T0288)K6.CB (T0288)T40.CB 11.1277 18.5461 24.1100 82.2993 Constraint (T0288)K6.CB (T0288)V36.CB 10.2110 17.0184 22.1239 82.2993 Constraint (T0288)K6.CB (T0288)V34.CB 12.1158 20.1929 26.2508 82.2993 Constraint (T0288)K6.CB (T0288)I33.CB 8.6582 14.4304 18.7595 82.2993 Constraint (T0288)K6.CB (T0288)Y32.CB 10.1508 16.9180 21.9935 82.2993 Constraint (T0288)K6.CB (T0288)I21.CB 10.3877 17.3129 22.5067 82.2993 Constraint (T0288)K6.CB (T0288)S20.CB 12.1365 20.2275 26.2958 82.2993 Constraint (T0288)K6.CB (T0288)I19.CB 9.3540 15.5901 20.2671 82.2993 Constraint (T0288)K6.CB (T0288)I17.CB 9.1533 15.2556 19.8323 82.2993 Constraint (T0288)Q10.CB (T0288)K72.CB 11.5780 19.2967 25.0857 82.2932 Constraint (T0288)Q10.CB (T0288)S61.CB 12.6986 21.1644 27.5137 82.2932 Constraint (T0288)Q14.CB (T0288)V48.CB 10.3791 17.2985 22.4881 82.2922 Constraint (T0288)Q14.CB (T0288)D45.CB 9.8165 16.3609 21.2691 82.2922 Constraint (T0288)Q14.CB (T0288)A42.CB 8.1805 13.6341 17.7243 82.2922 Constraint (T0288)Q14.CB (T0288)F37.CB 7.3551 12.2586 15.9361 82.2922 Constraint (T0288)Q14.CB (T0288)V36.CB 9.7008 16.1680 21.0184 82.2922 Constraint (T0288)Q14.CB (T0288)Q35.CB 10.5117 17.5194 22.7753 82.2922 Constraint (T0288)Q14.CB (T0288)I33.CB 11.2944 18.8240 24.4711 82.2922 Constraint (T0288)A13.CB (T0288)V36.CB 10.5688 17.6146 22.8990 82.2922 Constraint (T0288)Q35.CB (T0288)E80.CB 12.9325 21.5541 28.0204 81.9842 Constraint (T0288)I21.CB (T0288)H84.CB 8.4194 14.0323 18.2420 81.9205 Constraint (T0288)S20.CB (T0288)H84.CB 10.8546 18.0910 23.5183 81.9205 Constraint (T0288)I19.CB (T0288)H84.CB 8.5949 14.3249 18.6224 81.9205 Constraint (T0288)I17.CB (T0288)H84.CB 8.6105 14.3508 18.6560 81.9205 Constraint (T0288)I21.CB (T0288)C30.CB 5.9905 9.9841 12.9793 81.9203 Constraint (T0288)S20.CB (T0288)C30.CB 8.7858 14.6431 19.0360 81.9203 Constraint (T0288)I19.CB (T0288)C30.CB 8.9968 14.9947 19.4931 81.9203 Constraint (T0288)T66.CB (T0288)H84.CB 10.8909 18.1515 23.5970 81.6245 Constraint (T0288)V48.CB (T0288)T66.CB 12.5721 20.9535 27.2396 81.6244 Constraint (T0288)P41.CB (T0288)S61.CB 13.1337 21.8895 28.4563 81.5917 Constraint (T0288)V7.CB (T0288)K72.CB 12.0066 20.0110 26.0143 81.2993 Constraint (T0288)Q14.CB (T0288)D38.CB 9.3463 15.5771 20.2503 81.2957 Constraint (T0288)N15.CB (T0288)V81.CB 6.9136 11.5227 14.9795 81.2957 Constraint (T0288)N15.CB (T0288)A71.CB 8.2246 13.7076 17.8199 81.2957 Constraint (T0288)N15.CB (T0288)V70.CB 9.9759 16.6266 21.6145 81.2957 Constraint (T0288)N15.CB (T0288)V57.CB 9.4638 15.7731 20.5050 81.2957 Constraint (T0288)N15.CB (T0288)I54.CB 10.4514 17.4190 22.6447 81.2957 Constraint (T0288)N15.CB (T0288)D52.CB 11.5388 19.2314 25.0008 81.2957 Constraint (T0288)N15.CB (T0288)A50.CB 11.2689 18.7816 24.4160 81.2957 Constraint (T0288)N15.CB (T0288)A49.CB 11.6432 19.4054 25.2270 81.2957 Constraint (T0288)N15.CB (T0288)V48.CB 8.9552 14.9253 19.4028 81.2957 Constraint (T0288)N15.CB (T0288)D45.CB 8.8439 14.7398 19.1618 81.2957 Constraint (T0288)N15.CB (T0288)A42.CB 6.7686 11.2810 14.6652 81.2957 Constraint (T0288)N15.CB (T0288)F37.CB 6.0238 10.0397 13.0516 81.2957 Constraint (T0288)N15.CB (T0288)V36.CB 8.1990 13.6650 17.7644 81.2957 Constraint (T0288)N15.CB (T0288)Q35.CB 8.8496 14.7493 19.1740 81.2957 Constraint (T0288)N15.CB (T0288)V34.CB 10.2111 17.0185 22.1241 81.2957 Constraint (T0288)N15.CB (T0288)I33.CB 9.5109 15.8515 20.6070 81.2957 Constraint (T0288)N15.CB (T0288)Y32.CB 11.9975 19.9958 25.9946 81.2957 Constraint (T0288)T8.CB (T0288)K78.CB 7.9570 13.2617 17.2402 81.2932 Constraint (T0288)L9.CB (T0288)E80.CB 4.4164 7.3606 9.5688 81.2932 Constraint (T0288)T8.CB (T0288)E80.CB 4.3993 7.3321 9.5317 81.2932 Constraint (T0288)A13.CB (T0288)V48.CB 10.6400 17.7333 23.0533 81.2922 Constraint (T0288)A13.CB (T0288)I33.CB 12.0466 20.0777 26.1011 81.2922 Constraint (T0288)C30.CB (T0288)T66.CB 6.6431 11.0719 14.3935 81.2872 Constraint (T0288)D38.CB (T0288)V70.CB 13.0018 21.6697 28.1706 81.2128 Constraint (T0288)F37.CB (T0288)E69.CB 12.9534 21.5890 28.0657 81.2128 Constraint (T0288)C30.CB (T0288)V77.CB 11.3370 18.8949 24.5634 81.1048 Constraint (T0288)A43.CB (T0288)K67.CB 12.6151 21.0252 27.3328 81.0214 Constraint (T0288)D45.CB (T0288)S61.CB 12.4607 20.7678 26.9981 80.6037 Constraint (T0288)K65.CB (T0288)H84.CB 7.9752 13.2920 17.2797 80.5030 Constraint (T0288)C30.CB (T0288)K65.CB 5.5031 9.1719 11.9235 80.5028 Constraint (T0288)C30.CB (T0288)H84.CB 7.5235 12.5392 16.3010 80.5017 Constraint (T0288)K6.CB (T0288)F37.CB 12.4198 20.6997 26.9096 80.2994 Constraint (T0288)Q10.CB (T0288)K78.CB 6.0546 10.0910 13.1182 80.2993 Constraint (T0288)L9.CB (T0288)K78.CB 6.9709 11.6182 15.1036 80.2993 Constraint (T0288)T8.CB (T0288)K63.CB 11.6222 19.3704 25.1815 80.2993 Constraint (T0288)V7.CB (T0288)K63.CB 10.0397 16.7329 21.7528 80.2993 Constraint (T0288)V7.CB (T0288)K67.CB 12.0417 20.0695 26.0904 80.2993 Constraint (T0288)Q10.CB (T0288)E80.CB 3.5631 5.9385 7.7201 80.2993 Constraint (T0288)Q10.CB (T0288)L44.CB 5.6753 9.4588 12.2965 80.2993 Constraint (T0288)Q10.CB (T0288)A43.CB 7.4697 12.4495 16.1844 80.2993 Constraint (T0288)L9.CB (T0288)L44.CB 5.5365 9.2276 11.9958 80.2993 Constraint (T0288)L9.CB (T0288)A43.CB 6.4897 10.8162 14.0611 80.2993 Constraint (T0288)T8.CB (T0288)L44.CB 6.9531 11.5884 15.0649 80.2993 Constraint (T0288)T8.CB (T0288)A43.CB 8.3207 13.8679 18.0283 80.2993 Constraint (T0288)V7.CB (T0288)E80.CB 6.8175 11.3624 14.7711 80.2993 Constraint (T0288)V7.CB (T0288)L44.CB 7.0816 11.8027 15.3435 80.2993 Constraint (T0288)V7.CB (T0288)A43.CB 7.5526 12.5877 16.3641 80.2993 Constraint (T0288)Q14.CB (T0288)T82.CB 11.0945 18.4908 24.0380 80.2993 Constraint (T0288)Q14.CB (T0288)V81.CB 7.9394 13.2324 17.2021 80.2993 Constraint (T0288)Q14.CB (T0288)V77.CB 7.7682 12.9470 16.8310 80.2993 Constraint (T0288)Q14.CB (T0288)I74.CB 8.2700 13.7833 17.9183 80.2993 Constraint (T0288)Q14.CB (T0288)M73.CB 10.7382 17.8970 23.2661 80.2993 Constraint (T0288)Q14.CB (T0288)K72.CB 10.7169 17.8615 23.2199 80.2993 Constraint (T0288)Q14.CB (T0288)A71.CB 9.9657 16.6095 21.5923 80.2993 Constraint (T0288)Q14.CB (T0288)N58.CB 10.9246 18.2077 23.6700 80.2993 Constraint (T0288)Q14.CB (T0288)V57.CB 10.9293 18.2156 23.6803 80.2993 Constraint (T0288)Q14.CB (T0288)P41.CB 5.9823 9.9705 12.9617 80.2993 Constraint (T0288)Q14.CB (T0288)T40.CB 6.3685 10.6142 13.7985 80.2993 Constraint (T0288)Q14.CB (T0288)N39.CB 7.9157 13.1929 17.1507 80.2993 Constraint (T0288)A13.CB (T0288)T82.CB 10.3943 17.3238 22.5210 80.2993 Constraint (T0288)A13.CB (T0288)V81.CB 7.5130 12.5216 16.2781 80.2993 Constraint (T0288)A13.CB (T0288)V77.CB 7.5183 12.5306 16.2897 80.2993 Constraint (T0288)A13.CB (T0288)I74.CB 8.8094 14.6824 19.0871 80.2993 Constraint (T0288)A13.CB (T0288)M73.CB 11.0340 18.3899 23.9069 80.2993 Constraint (T0288)A13.CB (T0288)K72.CB 11.4072 19.0121 24.7157 80.2993 Constraint (T0288)A13.CB (T0288)A71.CB 11.0037 18.3395 23.8413 80.2993 Constraint (T0288)A13.CB (T0288)N58.CB 10.4339 17.3898 22.6068 80.2993 Constraint (T0288)A13.CB (T0288)V57.CB 10.9212 18.2021 23.6627 80.2993 Constraint (T0288)A13.CB (T0288)D45.CB 9.3707 15.6178 20.3031 80.2993 Constraint (T0288)A13.CB (T0288)A42.CB 8.4090 14.0151 18.2196 80.2993 Constraint (T0288)A13.CB (T0288)P41.CB 5.8718 9.7864 12.7223 80.2993 Constraint (T0288)A13.CB (T0288)T40.CB 7.0238 11.7063 15.2181 80.2993 Constraint (T0288)A13.CB (T0288)N39.CB 8.4714 14.1190 18.3547 80.2993 Constraint (T0288)A13.CB (T0288)D38.CB 10.2242 17.0404 22.1525 80.2993 Constraint (T0288)A13.CB (T0288)F37.CB 8.4190 14.0316 18.2411 80.2993 Constraint (T0288)N15.CB (T0288)T82.CB 10.1283 16.8805 21.9446 80.2993 Constraint (T0288)N15.CB (T0288)V77.CB 6.6115 11.0192 14.3249 80.2993 Constraint (T0288)N15.CB (T0288)I74.CB 6.5443 10.9072 14.1794 80.2993 Constraint (T0288)N15.CB (T0288)M73.CB 9.2216 15.3693 19.9801 80.2993 Constraint (T0288)N15.CB (T0288)K72.CB 9.2560 15.4267 20.0547 80.2993 Constraint (T0288)N15.CB (T0288)N58.CB 9.8412 16.4019 21.3225 80.2993 Constraint (T0288)N15.CB (T0288)P41.CB 5.1443 8.5738 11.1460 80.2993 Constraint (T0288)N15.CB (T0288)T40.CB 5.3466 8.9110 11.5843 80.2993 Constraint (T0288)N15.CB (T0288)N39.CB 7.4862 12.4771 16.2202 80.2993 Constraint (T0288)N15.CB (T0288)D38.CB 8.4521 14.0868 18.3128 80.2993 Constraint (T0288)N15.CB (T0288)A43.CB 8.0698 13.4497 17.4846 80.2957 Constraint (T0288)D12.CB (T0288)I33.CB 10.8796 18.1327 23.5725 80.2837 Constraint (T0288)V7.CB (T0288)N39.CB 10.5507 17.5844 22.8598 80.1993 Constraint (T0288)T55.CB (T0288)K87.CB 6.8457 11.4096 14.8324 80.0947 Constraint (T0288)I54.CB (T0288)K87.CB 7.0876 11.8126 15.3564 80.0947 Constraint (T0288)A49.CB (T0288)K87.CB 5.1959 8.6598 11.2578 80.0947 Constraint (T0288)I33.CB (T0288)K87.CB 6.7302 11.2170 14.5821 80.0947 Constraint (T0288)Y32.CB (T0288)K87.CB 6.9031 11.5051 14.9567 80.0947 Constraint (T0288)Y32.CB (T0288)E80.CB 13.1653 21.9422 28.5249 80.0363 Constraint (T0288)A43.CB (T0288)E76.CB 13.2194 22.0323 28.6420 79.9209 Constraint (T0288)K11.CB (T0288)I21.CB 9.4067 15.6779 20.3813 79.7376 Constraint (T0288)K11.CB (T0288)S20.CB 9.2808 15.4680 20.1084 79.7376 Constraint (T0288)N15.CB (T0288)E80.CB 8.0841 13.4735 17.5156 79.7004 Constraint (T0288)P41.CB (T0288)K65.CB 12.8075 21.3459 27.7497 79.5030 Constraint (T0288)Q26.CB (T0288)V70.CB 8.4555 14.0925 18.3203 79.3901 Constraint (T0288)Q26.CB (T0288)E69.CB 8.7134 14.5223 18.8789 79.3901 Constraint (T0288)Q26.CB (T0288)K63.CB 7.5753 12.6255 16.4131 79.3901 Constraint (T0288)Q26.CB (T0288)I62.CB 8.4590 14.0984 18.3279 79.3901 Constraint (T0288)Q26.CB (T0288)S61.CB 9.8718 16.4530 21.3890 79.3901 Constraint (T0288)Q26.CB (T0288)V57.CB 11.5012 19.1687 24.9193 79.3901 Constraint (T0288)Q26.CB (T0288)T55.CB 9.5211 15.8685 20.6290 79.3901 Constraint (T0288)Q26.CB (T0288)I54.CB 9.3751 15.6251 20.3126 79.3901 Constraint (T0288)Q26.CB (T0288)E53.CB 8.3209 13.8682 18.0287 79.3901 Constraint (T0288)Q26.CB (T0288)D52.CB 10.8856 18.1427 23.5855 79.3901 Constraint (T0288)A25.CB (T0288)A71.CB 9.0402 15.0669 19.5870 79.3901 Constraint (T0288)A25.CB (T0288)V70.CB 7.5157 12.5261 16.2839 79.3901 Constraint (T0288)A25.CB (T0288)E69.CB 7.9222 13.2036 17.1647 79.3901 Constraint (T0288)A25.CB (T0288)V68.CB 7.8110 13.0184 16.9239 79.3901 Constraint (T0288)A25.CB (T0288)K63.CB 7.4753 12.4588 16.1964 79.3901 Constraint (T0288)A25.CB (T0288)I62.CB 7.8245 13.0408 16.9530 79.3901 Constraint (T0288)A25.CB (T0288)S61.CB 9.6471 16.0784 20.9020 79.3901 Constraint (T0288)A25.CB (T0288)V57.CB 10.7440 17.9067 23.2787 79.3901 Constraint (T0288)A25.CB (T0288)T55.CB 9.2588 15.4313 20.0607 79.3901 Constraint (T0288)A25.CB (T0288)I54.CB 8.6258 14.3764 18.6893 79.3901 Constraint (T0288)A25.CB (T0288)E53.CB 7.8591 13.0986 17.0281 79.3901 Constraint (T0288)A25.CB (T0288)D52.CB 10.1788 16.9646 22.0540 79.3901 Constraint (T0288)A25.CB (T0288)V34.CB 8.7025 14.5042 18.8555 79.3901 Constraint (T0288)K6.CB (T0288)Q35.CB 12.4406 20.7344 26.9547 79.2994 Constraint (T0288)K6.CB (T0288)E76.CB 11.9977 19.9961 25.9950 79.2993 Constraint (T0288)V7.CB (T0288)K78.CB 9.8247 16.3746 21.2870 79.2993 Constraint (T0288)L9.CB (T0288)K63.CB 11.7692 19.6154 25.5000 79.2993 Constraint (T0288)K6.CB (T0288)K63.CB 9.3874 15.6457 20.3394 79.2993 Constraint (T0288)K6.CB (T0288)Q75.CB 12.4113 20.6854 26.8911 79.2993 Constraint (T0288)K6.CB (T0288)E80.CB 7.8543 13.0905 17.0177 79.2993 Constraint (T0288)K6.CB (T0288)L44.CB 9.6031 16.0052 20.8068 79.2993 Constraint (T0288)K6.CB (T0288)A43.CB 10.2242 17.0403 22.1524 79.2993 Constraint (T0288)Q14.CB (T0288)E76.CB 9.0942 15.1569 19.7040 79.2993 Constraint (T0288)Q14.CB (T0288)Q75.CB 7.4850 12.4750 16.2175 79.2993 Constraint (T0288)A13.CB (T0288)E76.CB 9.2416 15.4026 20.0234 79.2993 Constraint (T0288)A13.CB (T0288)Q75.CB 8.2392 13.7321 17.8517 79.2993 Constraint (T0288)N15.CB (T0288)L44.CB 8.0407 13.4012 17.4216 79.2993 Constraint (T0288)K11.CB (T0288)T82.CB 6.9566 11.5943 15.0726 79.2932 Constraint (T0288)K11.CB (T0288)V81.CB 4.1690 6.9484 9.0329 79.2932 Constraint (T0288)K11.CB (T0288)V77.CB 4.9341 8.2235 10.6906 79.2932 Constraint (T0288)K11.CB (T0288)E76.CB 7.5749 12.6248 16.4123 79.2932 Constraint (T0288)K11.CB (T0288)Q75.CB 6.9030 11.5049 14.9564 79.2932 Constraint (T0288)K11.CB (T0288)I74.CB 6.3169 10.5282 13.6867 79.2932 Constraint (T0288)K11.CB (T0288)M73.CB 8.4600 14.0999 18.3299 79.2932 Constraint (T0288)K11.CB (T0288)K72.CB 9.6880 16.1466 20.9906 79.2932 Constraint (T0288)K11.CB (T0288)A71.CB 9.2185 15.3642 19.9734 79.2932 Constraint (T0288)K11.CB (T0288)N58.CB 7.2879 12.1465 15.7904 79.2932 Constraint (T0288)K11.CB (T0288)V57.CB 7.6477 12.7462 16.5701 79.2932 Constraint (T0288)K11.CB (T0288)I54.CB 9.3929 15.6549 20.3513 79.2932 Constraint (T0288)K11.CB (T0288)A49.CB 11.0415 18.4025 23.9232 79.2932 Constraint (T0288)K11.CB (T0288)V48.CB 7.8536 13.0894 17.0162 79.2932 Constraint (T0288)K11.CB (T0288)A42.CB 6.0760 10.1267 13.1647 79.2932 Constraint (T0288)K11.CB (T0288)P41.CB 3.9485 6.5809 8.5552 79.2932 Constraint (T0288)K11.CB (T0288)F37.CB 7.7852 12.9754 16.8680 79.2932 Constraint (T0288)K11.CB (T0288)V36.CB 8.7152 14.5253 18.8829 79.2932 Constraint (T0288)K11.CB (T0288)I33.CB 9.4744 15.7907 20.5278 79.2932 Constraint (T0288)Q14.CB (T0288)A43.CB 9.2152 15.3586 19.9662 79.2922 Constraint (T0288)D12.CB (T0288)M73.CB 10.5592 17.5987 22.8784 79.2872 Constraint (T0288)D12.CB (T0288)K72.CB 11.3343 18.8904 24.5575 79.2872 Constraint (T0288)D12.CB (T0288)A71.CB 10.7506 17.9177 23.2930 79.2872 Constraint (T0288)D12.CB (T0288)V70.CB 11.7824 19.6373 25.5284 79.2872 Constraint (T0288)D12.CB (T0288)V57.CB 9.9122 16.5203 21.4764 79.2872 Constraint (T0288)V48.CB (T0288)K87.CB 6.7398 11.2329 14.6028 79.2210 Constraint (T0288)C30.CB (T0288)A43.CB 12.8278 21.3797 27.7937 79.2137 Constraint (T0288)L9.CB (T0288)K67.CB 11.5982 19.3303 25.1294 79.1932 Constraint (T0288)C30.CB (T0288)E76.CB 11.7396 19.5660 25.4357 79.1013 Constraint (T0288)A50.CB (T0288)K87.CB 6.8367 11.3945 14.8129 79.0947 Constraint (T0288)V36.CB (T0288)K87.CB 8.7061 14.5101 18.8632 79.0947 Constraint (T0288)Q26.CB (T0288)K67.CB 6.8192 11.3653 14.7749 78.9890 Constraint (T0288)A25.CB (T0288)K67.CB 5.7813 9.6356 12.5262 78.9890 Constraint (T0288)V57.CB (T0288)N86.CB 8.4994 14.1657 18.4154 78.9684 Constraint (T0288)T55.CB (T0288)N86.CB 4.2098 7.0164 9.1213 78.9684 Constraint (T0288)I54.CB (T0288)N86.CB 5.5418 9.2363 12.0072 78.9684 Constraint (T0288)A50.CB (T0288)N86.CB 8.1573 13.5956 17.6742 78.9684 Constraint (T0288)A49.CB (T0288)N86.CB 6.8484 11.4140 14.8383 78.9684 Constraint (T0288)I33.CB (T0288)N86.CB 6.8230 11.3717 14.7832 78.9684 Constraint (T0288)Y32.CB (T0288)N86.CB 6.3284 10.5473 13.7115 78.9684 Constraint (T0288)V57.CB (T0288)Y85.CB 6.7746 11.2910 14.6783 78.8686 Constraint (T0288)T55.CB (T0288)Y85.CB 4.5736 7.6227 9.9094 78.8686 Constraint (T0288)I54.CB (T0288)Y85.CB 4.1034 6.8390 8.8907 78.8686 Constraint (T0288)A50.CB (T0288)Y85.CB 6.8338 11.3897 14.8066 78.8686 Constraint (T0288)A49.CB (T0288)Y85.CB 5.2329 8.7215 11.3380 78.8686 Constraint (T0288)V36.CB (T0288)Y85.CB 7.4945 12.4909 16.2382 78.8686 Constraint (T0288)I33.CB (T0288)Y85.CB 5.0283 8.3805 10.8946 78.8686 Constraint (T0288)Y32.CB (T0288)Y85.CB 5.9725 9.9542 12.9405 78.8686 Constraint (T0288)D12.CB (T0288)I21.CB 10.8751 18.1252 23.5627 78.7376 Constraint (T0288)C30.CB (T0288)P41.CB 12.9570 21.5951 28.0736 78.5806 Constraint (T0288)K6.CB (T0288)E69.CB 12.6177 21.0295 27.3384 78.2994 Constraint (T0288)K11.CB (T0288)D52.CB 10.7177 17.8628 23.2216 78.2993 Constraint (T0288)K11.CB (T0288)D45.CB 6.7026 11.1710 14.5223 78.2993 Constraint (T0288)K11.CB (T0288)T40.CB 5.9941 9.9902 12.9873 78.2993 Constraint (T0288)K11.CB (T0288)N39.CB 8.4255 14.0425 18.2553 78.2993 Constraint (T0288)K11.CB (T0288)D38.CB 9.8150 16.3583 21.2658 78.2993 Constraint (T0288)K11.CB (T0288)Q35.CB 10.4110 17.3517 22.5573 78.2993 Constraint (T0288)D12.CB (T0288)V48.CB 9.0497 15.0828 19.6076 78.2957 Constraint (T0288)D12.CB (T0288)V36.CB 9.2381 15.3968 20.0158 78.2957 Constraint (T0288)N15.CB (T0288)K67.CB 11.1830 18.6384 24.2299 78.2957 Constraint (T0288)Q10.CB (T0288)L31.CB 11.7618 19.6030 25.4839 78.2932 Constraint (T0288)L9.CB (T0288)L31.CB 9.4307 15.7179 20.4332 78.2932 Constraint (T0288)T8.CB (T0288)L31.CB 10.3999 17.3332 22.5331 78.2932 Constraint (T0288)K11.CB (T0288)V70.CB 9.8211 16.3685 21.2790 78.2932 Constraint (T0288)K11.CB (T0288)S61.CB 12.4907 20.8178 27.0631 78.2932 Constraint (T0288)K11.CB (T0288)R60.CB 10.0689 16.7814 21.8158 78.2932 Constraint (T0288)K11.CB (T0288)T55.CB 11.6907 19.4845 25.3298 78.2932 Constraint (T0288)K11.CB (T0288)A50.CB 11.6953 19.4922 25.3398 78.2932 Constraint (T0288)Q10.CB (T0288)I83.CB 6.7170 11.1950 14.5534 78.2932 Constraint (T0288)L9.CB (T0288)I83.CB 4.2742 7.1237 9.2608 78.2932 Constraint (T0288)T8.CB (T0288)I83.CB 4.4701 7.4501 9.6851 78.2932 Constraint (T0288)A13.CB (T0288)Q35.CB 11.7377 19.5629 25.4318 78.2923 Constraint (T0288)A25.CB (T0288)I74.CB 10.7976 17.9959 23.3947 78.2888 Constraint (T0288)D38.CB (T0288)V57.CB 13.0333 21.7222 28.2388 78.2128 Constraint (T0288)E53.CB (T0288)K87.CB 4.9866 8.3111 10.8044 78.1068 Constraint (T0288)D52.CB (T0288)K87.CB 4.1653 6.9421 9.0247 78.1068 Constraint (T0288)S61.CB (T0288)K78.CB 11.3534 18.9224 24.5991 78.0340 Constraint (T0288)V36.CB (T0288)N86.CB 9.7430 16.2383 21.1098 77.9684 Constraint (T0288)A42.CB (T0288)N86.CB 9.6757 16.1262 20.9640 77.9684 Constraint (T0288)A42.CB (T0288)Y85.CB 6.9268 11.5446 15.0080 77.8686 Constraint (T0288)F37.CB (T0288)Y85.CB 10.2645 17.1074 22.2397 77.8686 Constraint (T0288)I74.CB (T0288)Y85.CB 8.4863 14.1438 18.3870 77.8686 Constraint (T0288)V70.CB (T0288)Y85.CB 8.0988 13.4979 17.5473 77.8686 Constraint (T0288)N58.CB (T0288)Y85.CB 8.5445 14.2408 18.5130 77.8686 Constraint (T0288)N15.CB (T0288)K78.CB 7.1277 11.8796 15.4434 77.7004 Constraint (T0288)L44.CB (T0288)V70.CB 12.5837 20.9728 27.2647 77.6039 Constraint (T0288)Q26.CB (T0288)A50.CB 11.8983 19.8305 25.7797 77.3901 Constraint (T0288)A25.CB (T0288)A50.CB 10.8844 18.1406 23.5828 77.3901 Constraint (T0288)A25.CB (T0288)Q35.CB 11.1798 18.6329 24.2228 77.3901 Constraint (T0288)V7.CB (T0288)L31.CB 8.8110 14.6850 19.0905 77.2993 Constraint (T0288)Q14.CB (T0288)K78.CB 7.2143 12.0238 15.6309 77.2993 Constraint (T0288)A13.CB (T0288)K78.CB 6.3273 10.5455 13.7091 77.2993 Constraint (T0288)K11.CB (T0288)I62.CB 10.6989 17.8315 23.1810 77.2993 Constraint (T0288)K11.CB (T0288)E53.CB 12.4443 20.7405 26.9626 77.2993 Constraint (T0288)K11.CB (T0288)V34.CB 11.4714 19.1191 24.8548 77.2993 Constraint (T0288)D12.CB (T0288)T82.CB 8.9632 14.9386 19.4202 77.2993 Constraint (T0288)D12.CB (T0288)V81.CB 6.2515 10.4191 13.5449 77.2993 Constraint (T0288)D12.CB (T0288)V77.CB 6.9435 11.5725 15.0443 77.2993 Constraint (T0288)D12.CB (T0288)E76.CB 9.2052 15.3421 19.9447 77.2993 Constraint (T0288)D12.CB (T0288)Q75.CB 8.2139 13.6898 17.7967 77.2993 Constraint (T0288)D12.CB (T0288)I74.CB 8.1451 13.5751 17.6477 77.2993 Constraint (T0288)D12.CB (T0288)N58.CB 9.4432 15.7386 20.4602 77.2993 Constraint (T0288)D12.CB (T0288)D45.CB 7.5936 12.6560 16.4528 77.2993 Constraint (T0288)D12.CB (T0288)A42.CB 6.8496 11.4159 14.8407 77.2993 Constraint (T0288)D12.CB (T0288)P41.CB 4.2256 7.0427 9.1555 77.2993 Constraint (T0288)D12.CB (T0288)T40.CB 5.7307 9.5512 12.4165 77.2993 Constraint (T0288)D12.CB (T0288)N39.CB 7.4480 12.4134 16.1374 77.2993 Constraint (T0288)D12.CB (T0288)D38.CB 9.2292 15.3819 19.9965 77.2993 Constraint (T0288)D12.CB (T0288)F37.CB 7.5206 12.5344 16.2947 77.2993 Constraint (T0288)V7.CB (T0288)I83.CB 3.2503 5.4171 7.0422 77.2993 Constraint (T0288)N15.CB (T0288)E76.CB 8.0893 13.4822 17.5268 77.2993 Constraint (T0288)N15.CB (T0288)Q75.CB 6.0908 10.1513 13.1967 77.2993 Constraint (T0288)Q14.CB (T0288)E80.CB 8.3782 13.9637 18.1528 77.2993 Constraint (T0288)Q14.CB (T0288)L44.CB 8.6971 14.4952 18.8438 77.2993 Constraint (T0288)A13.CB (T0288)E80.CB 7.1452 11.9086 15.4812 77.2993 Constraint (T0288)A13.CB (T0288)L44.CB 8.3737 13.9561 18.1429 77.2993 Constraint (T0288)A13.CB (T0288)A43.CB 9.4387 15.7311 20.4505 77.2993 Constraint (T0288)D12.CB (T0288)Q35.CB 10.8755 18.1258 23.5636 77.2959 Constraint (T0288)N15.CB (T0288)I62.CB 11.6952 19.4919 25.3395 77.2957 Constraint (T0288)N15.CB (T0288)I83.CB 9.2339 15.3898 20.0068 77.2957 Constraint (T0288)K11.CB (T0288)Y32.CB 12.0855 20.1424 26.1852 77.2932 Constraint (T0288)A13.CB (T0288)V70.CB 12.3898 20.6497 26.8446 77.2872 Constraint (T0288)D12.CB (T0288)I54.CB 11.2743 18.7905 24.4276 77.2837 Constraint (T0288)N39.CB (T0288)A71.CB 12.6911 21.1519 27.4974 77.2247 Constraint (T0288)S61.CB (T0288)N86.CB 8.0902 13.4837 17.5288 77.2210 Constraint (T0288)V48.CB (T0288)N86.CB 7.3689 12.2815 15.9660 77.2210 Constraint (T0288)S61.CB (T0288)Y85.CB 8.2260 13.7100 17.8231 77.1212 Constraint (T0288)V48.CB (T0288)Y85.CB 4.7343 7.8906 10.2577 77.1212 Constraint (T0288)V34.CB (T0288)K87.CB 9.0934 15.1556 19.7023 77.1068 Constraint (T0288)I62.CB (T0288)K87.CB 9.5231 15.8719 20.6334 77.1068 Constraint (T0288)I62.CB (T0288)N86.CB 7.2916 12.1526 15.7984 76.9804 Constraint (T0288)E53.CB (T0288)N86.CB 3.3535 5.5891 7.2658 76.9804 Constraint (T0288)D52.CB (T0288)N86.CB 4.5129 7.5215 9.7780 76.9804 Constraint (T0288)V34.CB (T0288)N86.CB 9.4003 15.6672 20.3673 76.9804 Constraint (T0288)I62.CB (T0288)Y85.CB 6.7394 11.2323 14.6019 76.8806 Constraint (T0288)E53.CB (T0288)Y85.CB 4.0029 6.6716 8.6730 76.8806 Constraint (T0288)D52.CB (T0288)Y85.CB 3.0717 5.1195 6.6553 76.8806 Constraint (T0288)Q35.CB (T0288)Y85.CB 9.0314 15.0523 19.5680 76.8806 Constraint (T0288)V34.CB (T0288)Y85.CB 8.1862 13.6436 17.7367 76.8806 Constraint (T0288)D38.CB (T0288)Y85.CB 11.4769 19.1281 24.8665 76.8686 Constraint (T0288)M73.CB (T0288)Y85.CB 9.3082 15.5137 20.1678 76.8686 Constraint (T0288)K65.CB (T0288)K78.CB 11.3773 18.9622 24.6509 76.7005 Constraint (T0288)T55.CB (T0288)K78.CB 11.9939 19.9899 25.9869 76.6329 Constraint (T0288)C30.CB (T0288)T40.CB 13.0511 21.7519 28.2774 76.5927 Constraint (T0288)P41.CB (T0288)V68.CB 12.8906 21.4843 27.9297 76.5917 Constraint (T0288)K6.CB (T0288)L31.CB 9.6211 16.0351 20.8457 76.2993 Constraint (T0288)K6.CB (T0288)K78.CB 10.8544 18.0907 23.5179 76.2993 Constraint (T0288)K6.CB (T0288)I83.CB 4.5084 7.5139 9.7681 76.2993 Constraint (T0288)Q10.CB (T0288)Y32.CB 12.4976 20.8293 27.0781 76.2934 Constraint (T0288)T8.CB (T0288)E69.CB 12.5584 20.9306 27.2098 76.2933 Constraint (T0288)Q14.CB (T0288)I83.CB 10.8404 18.0673 23.4875 76.2922 Constraint (T0288)A13.CB (T0288)I83.CB 10.7101 17.8501 23.2052 76.2922 Constraint (T0288)R60.CB (T0288)Y85.CB 9.0402 15.0670 19.5872 76.1212 Constraint (T0288)S61.CB (T0288)K87.CB 10.6072 17.6786 22.9822 76.1210 Constraint (T0288)Q35.CB (T0288)K87.CB 9.9480 16.5800 21.5540 76.1068 Constraint (T0288)A42.CB (T0288)K87.CB 9.0297 15.0495 19.5643 76.0947 Constraint (T0288)L31.CB (T0288)K87.CB 8.6345 14.3908 18.7080 76.0947 Constraint (T0288)A50.CB (T0288)R60.CB 13.3255 22.2091 28.8718 76.0879 Constraint (T0288)V57.CB (T0288)K87.CB 10.0479 16.7465 21.7705 75.9947 Constraint (T0288)A25.CB (T0288)M73.CB 10.2214 17.0356 22.1463 75.9890 Constraint (T0288)V70.CB (T0288)N86.CB 9.1506 15.2509 19.8262 75.9684 Constraint (T0288)E69.CB (T0288)Y85.CB 10.7075 17.8458 23.1996 75.8687 Constraint (T0288)A71.CB (T0288)Y85.CB 10.1418 16.9029 21.9738 75.8686 Constraint (T0288)Q26.CB (T0288)K65.CB 7.3385 12.2309 15.9002 75.7006 Constraint (T0288)A25.CB (T0288)K65.CB 6.7095 11.1825 14.5373 75.7006 Constraint (T0288)K11.CB (T0288)K78.CB 5.0357 8.3928 10.9107 75.7004 Constraint (T0288)K11.CB (T0288)E80.CB 4.4475 7.4126 9.6363 75.7004 Constraint (T0288)K67.CB (T0288)Y85.CB 9.9166 16.5276 21.4859 75.6651 Constraint (T0288)A42.CB (T0288)T66.CB 12.6664 21.1107 27.4439 75.6244 Constraint (T0288)V36.CB (T0288)S61.CB 13.2244 22.0406 28.6528 75.5918 Constraint (T0288)Q26.CB (T0288)Q35.CB 12.3849 20.6415 26.8339 75.3901 Constraint (T0288)Q26.CB (T0288)T66.CB 6.2478 10.4130 13.5368 75.2994 Constraint (T0288)A25.CB (T0288)T66.CB 5.5685 9.2808 12.0650 75.2994 Constraint (T0288)K11.CB (T0288)L44.CB 6.7669 11.2781 14.6615 75.2993 Constraint (T0288)K11.CB (T0288)A43.CB 7.8051 13.0086 16.9111 75.2993 Constraint (T0288)N15.CB (T0288)L31.CB 11.1772 18.6286 24.2172 75.2957 Constraint (T0288)Q10.CB (T0288)H84.CB 9.4087 15.6811 20.3855 75.2935 Constraint (T0288)L9.CB (T0288)H84.CB 7.0836 11.8061 15.3479 75.2935 Constraint (T0288)T8.CB (T0288)H84.CB 6.0464 10.0773 13.1005 75.2935 Constraint (T0288)T8.CB (T0288)C30.CB 12.2194 20.3656 26.4753 75.2932 Constraint (T0288)Q14.CB (T0288)V70.CB 11.6033 19.3388 25.1404 75.2923 Constraint (T0288)D45.CB (T0288)N86.CB 9.8320 16.3866 21.3026 75.2331 Constraint (T0288)V7.CB (T0288)D38.CB 10.6075 17.6791 22.9828 75.1993 Constraint (T0288)L31.CB (T0288)K78.CB 11.8255 19.7092 25.6219 75.1817 Constraint (T0288)D45.CB (T0288)Y85.CB 7.1823 11.9706 15.5617 75.1333 Constraint (T0288)V68.CB (T0288)K78.CB 11.6304 19.3840 25.1992 75.0340 Constraint (T0288)K63.CB (T0288)K87.CB 9.6279 16.0465 20.8605 75.0068 Constraint (T0288)V70.CB (T0288)K87.CB 10.8087 18.0145 23.4189 74.9947 Constraint (T0288)K63.CB (T0288)N86.CB 6.9851 11.6418 15.1343 74.9804 Constraint (T0288)L31.CB (T0288)N86.CB 7.0424 11.7373 15.2584 74.9684 Constraint (T0288)K63.CB (T0288)Y85.CB 7.7911 12.9852 16.8807 74.8806 Constraint (T0288)L31.CB (T0288)Y85.CB 6.4489 10.7481 13.9725 74.8686 Constraint (T0288)L44.CB (T0288)A71.CB 12.5385 20.8975 27.1668 74.6038 Constraint (T0288)V7.CB (T0288)H84.CB 4.4785 7.4642 9.7035 74.2995 Constraint (T0288)V7.CB (T0288)C30.CB 10.2401 17.0669 22.1869 74.2993 Constraint (T0288)D12.CB (T0288)K78.CB 6.2381 10.3968 13.5158 74.2993 Constraint (T0288)D12.CB (T0288)E80.CB 5.9759 9.9599 12.9478 74.2993 Constraint (T0288)D12.CB (T0288)L44.CB 6.7433 11.2388 14.6105 74.2993 Constraint (T0288)D12.CB (T0288)A43.CB 7.8913 13.1522 17.0979 74.2993 Constraint (T0288)L9.CB (T0288)C30.CB 11.6903 19.4839 25.3290 74.2932 Constraint (T0288)Q14.CB (T0288)I54.CB 11.9862 19.9770 25.9702 74.2922 Constraint (T0288)D45.CB (T0288)K87.CB 8.9129 14.8548 19.3113 74.2331 Constraint (T0288)K11.CB (T0288)E69.CB 11.6239 19.3732 25.1851 74.1932 Constraint (T0288)P41.CB (T0288)Y85.CB 9.0004 15.0006 19.5008 74.1212 Constraint (T0288)C28.CB (T0288)A71.CB 10.3157 17.1929 22.3508 74.0784 Constraint (T0288)C28.CB (T0288)V68.CB 9.3953 15.6588 20.3565 74.0784 Constraint (T0288)D52.CB (T0288)K78.CB 12.8468 21.4114 27.8348 74.0433 Constraint (T0288)Q26.CB (T0288)A71.CB 9.7802 16.3003 21.1904 73.9995 Constraint (T0288)Q26.CB (T0288)V68.CB 8.3394 13.8990 18.0687 73.9995 Constraint (T0288)Q35.CB (T0288)N86.CB 10.6782 17.7971 23.1362 73.9805 Constraint (T0288)A43.CB (T0288)N86.CB 11.4012 19.0021 24.7027 73.9805 Constraint (T0288)F37.CB (T0288)N86.CB 12.6504 21.0840 27.4092 73.9684 Constraint (T0288)A43.CB (T0288)Y85.CB 8.8777 14.7962 19.2350 73.8806 Constraint (T0288)T40.CB (T0288)V68.CB 12.8711 21.4518 27.8873 73.6040 Constraint (T0288)C30.CB (T0288)D45.CB 12.2018 20.3364 26.4373 73.5927 Constraint (T0288)A25.CB (T0288)R60.CB 10.8247 18.0412 23.4536 73.3901 Constraint (T0288)C28.CB (T0288)V70.CB 8.0901 13.4835 17.5285 73.3783 Constraint (T0288)C28.CB (T0288)E69.CB 8.6810 14.4683 18.8088 73.3783 Constraint (T0288)C28.CB (T0288)S61.CB 8.4456 14.0760 18.2988 73.3783 Constraint (T0288)C28.CB (T0288)T55.CB 7.7903 12.9838 16.8789 73.3783 Constraint (T0288)C28.CB (T0288)I54.CB 8.2080 13.6800 17.7840 73.3783 Constraint (T0288)I74.CB (T0288)K87.CB 11.5704 19.2840 25.0692 73.3006 Constraint (T0288)K6.CB (T0288)H84.CB 3.4547 5.7578 7.4851 73.2995 Constraint (T0288)K6.CB (T0288)C30.CB 10.4185 17.3642 22.5735 73.2993 Constraint (T0288)D12.CB (T0288)D52.CB 12.0122 20.0204 26.0265 73.2957 Constraint (T0288)K11.CB (T0288)I83.CB 7.1517 11.9194 15.4953 73.2932 Constraint (T0288)Q14.CB (T0288)V34.CB 11.7757 19.6261 25.5139 73.2922 Constraint (T0288)N39.CB (T0288)V57.CB 12.9186 21.5310 27.9903 73.2250 Constraint (T0288)K11.CB (T0288)K65.CB 12.0817 20.1361 26.1770 73.1993 Constraint (T0288)T40.CB (T0288)Y85.CB 9.8031 16.3385 21.2401 73.1333 Constraint (T0288)A25.CB (T0288)K72.CB 10.1531 16.9218 21.9984 72.9890 Constraint (T0288)C28.CB (T0288)K67.CB 7.2103 12.0171 15.6223 72.9771 Constraint (T0288)F37.CB (T0288)K87.CB 11.7186 19.5310 25.3903 72.8995 Constraint (T0288)N58.CB (T0288)N86.CB 10.0367 16.7278 21.7461 72.8745 Constraint (T0288)K67.CB (T0288)N86.CB 10.4997 17.4995 22.7494 72.7649 Constraint (T0288)D12.CB (T0288)A49.CB 11.8603 19.7672 25.6973 72.2959 Constraint (T0288)K11.CB (T0288)L31.CB 10.9318 18.2197 23.6856 72.2932 Constraint (T0288)I21.CB (T0288)K87.CB 9.4459 15.7432 20.4662 72.1730 Constraint (T0288)P41.CB (T0288)K87.CB 11.3902 18.9837 24.6788 72.1272 Constraint (T0288)R60.CB (T0288)K87.CB 12.0355 20.0592 26.0770 72.1212 Constraint (T0288)A43.CB (T0288)K87.CB 10.0070 16.6784 21.6819 72.1068 Constraint (T0288)K6.CB (T0288)K67.CB 13.0569 21.7615 28.2899 72.0993 Constraint (T0288)I19.CB (T0288)N86.CB 9.3800 15.6333 20.3233 72.0467 Constraint (T0288)I21.CB (T0288)Y85.CB 7.2284 12.0474 15.6616 71.9469 Constraint (T0288)S20.CB (T0288)Y85.CB 8.9192 14.8653 19.3249 71.9469 Constraint (T0288)I19.CB (T0288)Y85.CB 6.8977 11.4962 14.9451 71.9469 Constraint (T0288)I17.CB (T0288)Y85.CB 8.2460 13.7433 17.8662 71.9469 Constraint (T0288)C30.CB (T0288)K87.CB 7.8334 13.0557 16.9724 71.7577 Constraint (T0288)V36.CB (T0288)T66.CB 12.9400 21.5667 28.0367 71.6245 Constraint (T0288)C30.CB (T0288)Y85.CB 6.7777 11.2961 14.6850 71.5315 Constraint (T0288)D38.CB (T0288)T82.CB 13.1067 21.8444 28.3978 71.5127 Constraint (T0288)C28.CB (T0288)I62.CB 7.4125 12.3541 16.0603 71.3904 Constraint (T0288)C28.CB (T0288)E53.CB 6.9304 11.5506 15.0158 71.3904 Constraint (T0288)A25.CB (T0288)V48.CB 12.4818 20.8030 27.0439 71.3901 Constraint (T0288)C28.CB (T0288)M73.CB 10.6822 17.8036 23.1447 71.3783 Constraint (T0288)C28.CB (T0288)V57.CB 10.4036 17.3393 22.5411 71.3783 Constraint (T0288)P4.CB (T0288)T82.CB 8.0311 13.3852 17.4007 71.2996 Constraint (T0288)P4.CB (T0288)V70.CB 10.7055 17.8426 23.1953 71.2996 Constraint (T0288)P4.CB (T0288)K65.CB 10.6653 17.7754 23.1081 71.2996 Constraint (T0288)P4.CB (T0288)I62.CB 8.2833 13.8055 17.9471 71.2996 Constraint (T0288)P4.CB (T0288)S61.CB 8.0088 13.3480 17.3524 71.2996 Constraint (T0288)P4.CB (T0288)R60.CB 9.8018 16.3363 21.2372 71.2996 Constraint (T0288)P4.CB (T0288)N58.CB 9.7751 16.2918 21.1793 71.2996 Constraint (T0288)P4.CB (T0288)V57.CB 8.6901 14.4834 18.8285 71.2996 Constraint (T0288)P4.CB (T0288)T55.CB 4.6778 7.7964 10.1353 71.2996 Constraint (T0288)P4.CB (T0288)I54.CB 6.9371 11.5619 15.0305 71.2996 Constraint (T0288)P4.CB (T0288)E53.CB 5.9034 9.8391 12.7908 71.2996 Constraint (T0288)P4.CB (T0288)D52.CB 6.2797 10.4661 13.6059 71.2996 Constraint (T0288)P4.CB (T0288)A50.CB 10.2583 17.0972 22.2264 71.2996 Constraint (T0288)P4.CB (T0288)A49.CB 8.1167 13.5279 17.5862 71.2996 Constraint (T0288)P4.CB (T0288)V48.CB 8.1631 13.6052 17.6867 71.2996 Constraint (T0288)P4.CB (T0288)D45.CB 9.7429 16.2381 21.1095 71.2996 Constraint (T0288)P4.CB (T0288)A42.CB 10.6096 17.6827 22.9876 71.2996 Constraint (T0288)P4.CB (T0288)V36.CB 11.3618 18.9363 24.6172 71.2996 Constraint (T0288)P4.CB (T0288)I33.CB 8.7614 14.6023 18.9830 71.2996 Constraint (T0288)P4.CB (T0288)Y32.CB 8.9717 14.9528 19.4386 71.2996 Constraint (T0288)P4.CB (T0288)I21.CB 10.7017 17.8361 23.1870 71.2996 Constraint (T0288)P4.CB (T0288)I19.CB 10.7784 17.9640 23.3532 71.2996 Constraint (T0288)D12.CB (T0288)I83.CB 9.1472 15.2453 19.8189 71.2993 Constraint (T0288)D12.CB (T0288)R60.CB 12.1032 20.1720 26.2237 71.2872 Constraint (T0288)C28.CB (T0288)R60.CB 10.5374 17.5623 22.8310 71.2783 Constraint (T0288)P41.CB (T0288)N86.CB 11.8627 19.7711 25.7025 71.2211 Constraint (T0288)S20.CB (T0288)K87.CB 10.5736 17.6226 22.9094 71.1730 Constraint (T0288)I19.CB (T0288)K87.CB 9.0873 15.1455 19.6891 71.1730 Constraint (T0288)L44.CB (T0288)Y85.CB 9.6400 16.0667 20.8867 71.1333 Constraint (T0288)R60.CB (T0288)N86.CB 9.6438 16.0731 20.8950 71.1271 Constraint (T0288)C28.CB (T0288)K72.CB 11.3613 18.9354 24.6161 71.0784 Constraint (T0288)I21.CB (T0288)N86.CB 8.6944 14.4907 18.8379 71.0467 Constraint (T0288)N58.CB (T0288)K87.CB 11.7259 19.5432 25.4061 71.0010 Constraint (T0288)I74.CB (T0288)N86.CB 10.2818 17.1363 22.2772 70.9744 Constraint (T0288)V68.CB (T0288)Y85.CB 11.9427 19.9046 25.8759 70.8747 Constraint (T0288)K67.CB (T0288)K87.CB 11.8843 19.8072 25.7494 70.7912 Constraint (T0288)K67.CB (T0288)K78.CB 12.3062 20.5103 26.6633 70.6330 Constraint (T0288)C30.CB (T0288)N86.CB 5.9701 9.9502 12.9353 70.6314 Constraint (T0288)M73.CB (T0288)N86.CB 10.4805 17.4675 22.7078 70.5733 Constraint (T0288)A71.CB (T0288)N86.CB 11.5014 19.1690 24.9197 70.4733 Constraint (T0288)M73.CB (T0288)K87.CB 12.4443 20.7405 26.9626 70.3007 Constraint (T0288)P4.CB (T0288)V81.CB 10.1712 16.9521 22.0377 70.2996 Constraint (T0288)P4.CB (T0288)V34.CB 11.7969 19.6616 25.5600 70.2996 Constraint (T0288)P4.CB (T0288)I74.CB 11.3892 18.9819 24.6765 70.2996 Constraint (T0288)P4.CB (T0288)I17.CB 11.6581 19.4301 25.2592 70.2996 Constraint (T0288)N15.CB (T0288)E69.CB 11.3791 18.9651 24.6546 70.2958 Constraint (T0288)K11.CB (T0288)H84.CB 10.1395 16.8992 21.9690 70.2935 Constraint (T0288)A25.CB (T0288)I83.CB 11.7368 19.5614 25.4298 70.2888 Constraint (T0288)E69.CB (T0288)N86.CB 11.1297 18.5495 24.1144 69.8745 Constraint (T0288)L16.CB (T0288)K72.CB 8.6360 14.3933 18.7112 69.7575 Constraint (T0288)L16.CB (T0288)M73.CB 8.4264 14.0440 18.2572 69.4205 Constraint (T0288)L16.CB (T0288)A71.CB 7.0896 11.8161 15.3609 69.4205 Constraint (T0288)L16.CB (T0288)V70.CB 8.7111 14.5186 18.8741 69.4205 Constraint (T0288)L16.CB (T0288)E69.CB 10.8257 18.0429 23.4557 69.4205 Constraint (T0288)L16.CB (T0288)V68.CB 10.3435 17.2392 22.4109 69.4205 Constraint (T0288)L16.CB (T0288)K67.CB 9.9756 16.6261 21.6139 69.4205 Constraint (T0288)L16.CB (T0288)I62.CB 10.6337 17.7229 23.0397 69.4205 Constraint (T0288)L16.CB (T0288)N58.CB 9.3501 15.5834 20.2585 69.4205 Constraint (T0288)L16.CB (T0288)V57.CB 8.4539 14.0899 18.3168 69.4205 Constraint (T0288)L16.CB (T0288)T55.CB 12.3012 20.5020 26.6526 69.4205 Constraint (T0288)L16.CB (T0288)I54.CB 9.0949 15.1582 19.7057 69.4205 Constraint (T0288)L16.CB (T0288)E53.CB 11.9473 19.9121 25.8858 69.4205 Constraint (T0288)L16.CB (T0288)D52.CB 10.2692 17.1154 22.2500 69.4205 Constraint (T0288)L16.CB (T0288)A50.CB 9.9160 16.5267 21.4848 69.4205 Constraint (T0288)L16.CB (T0288)A49.CB 10.4818 17.4697 22.7106 69.4205 Constraint (T0288)L16.CB (T0288)A42.CB 5.4944 9.1573 11.9045 69.4205 Constraint (T0288)L16.CB (T0288)N39.CB 7.2091 12.0152 15.6197 69.4205 Constraint (T0288)L16.CB (T0288)D38.CB 7.6799 12.7998 16.6397 69.4205 Constraint (T0288)L16.CB (T0288)F37.CB 4.8479 8.0798 10.5038 69.4205 Constraint (T0288)L16.CB (T0288)V36.CB 6.9018 11.5030 14.9538 69.4205 Constraint (T0288)L16.CB (T0288)Q35.CB 7.3951 12.3252 16.0227 69.4205 Constraint (T0288)L16.CB (T0288)V34.CB 8.7635 14.6058 18.9875 69.4205 Constraint (T0288)L16.CB (T0288)I33.CB 8.0657 13.4429 17.4757 69.4205 Constraint (T0288)L16.CB (T0288)Y32.CB 10.6164 17.6940 23.0022 69.4205 Constraint (T0288)K65.CB (T0288)Y85.CB 9.1090 15.1816 19.7361 69.4030 Constraint (T0288)K65.CB (T0288)K87.CB 11.5676 19.2793 25.0631 69.4028 Constraint (T0288)C28.CB (T0288)K63.CB 5.9899 9.9832 12.9782 69.3904 Constraint (T0288)C28.CB (T0288)A50.CB 11.2087 18.6812 24.2856 69.3783 Constraint (T0288)P29.CB (T0288)V70.CB 7.1039 11.8399 15.3918 69.3783 Constraint (T0288)P29.CB (T0288)S61.CB 7.9212 13.2020 17.1626 69.3783 Constraint (T0288)P29.CB (T0288)T55.CB 7.2176 12.0293 15.6381 69.3783 Constraint (T0288)P29.CB (T0288)I54.CB 7.2485 12.0809 15.7051 69.3783 Constraint (T0288)P4.CB (T0288)M73.CB 11.3750 18.9583 24.6458 69.2996 Constraint (T0288)P4.CB (T0288)K63.CB 7.6391 12.7318 16.5514 69.2996 Constraint (T0288)T66.CB (T0288)K78.CB 12.9210 21.5349 27.9954 69.2995 Constraint (T0288)K6.CB (T0288)K72.CB 12.8799 21.4665 27.9064 69.2994 Constraint (T0288)N15.CB (T0288)V68.CB 10.8596 18.0993 23.5291 69.2958 Constraint (T0288)N15.CB (T0288)R60.CB 11.6107 19.3512 25.1566 69.2957 Constraint (T0288)C28.CB (T0288)T66.CB 6.8550 11.4250 14.8525 69.2876 Constraint (T0288)P29.CB (T0288)R60.CB 9.9133 16.5222 21.4788 69.2783 Constraint (T0288)L44.CB (T0288)K87.CB 11.1225 18.5375 24.0987 69.2332 Constraint (T0288)K11.CB (T0288)K67.CB 11.8080 19.6799 25.5839 69.1932 Constraint (T0288)Q26.CB (T0288)R60.CB 11.2598 18.7664 24.3963 69.1888 Constraint (T0288)T66.CB (T0288)Y85.CB 11.3584 18.9307 24.6099 69.1876 Constraint (T0288)N39.CB (T0288)Y85.CB 11.9692 19.9486 25.9332 69.1805 Constraint (T0288)L16.CB (T0288)V77.CB 6.3682 10.6137 13.7978 69.1215 Constraint (T0288)I17.CB (T0288)K87.CB 11.0195 18.3659 23.8756 69.0730 Constraint (T0288)S20.CB (T0288)N86.CB 10.6417 17.7362 23.0571 69.0467 Constraint (T0288)T40.CB (T0288)K87.CB 11.5762 19.2937 25.0819 69.0319 Constraint (T0288)D38.CB (T0288)K87.CB 12.1362 20.2271 26.2952 68.8995 Constraint (T0288)L16.CB (T0288)T82.CB 9.5366 15.8944 20.6627 68.7203 Constraint (T0288)L16.CB (T0288)V81.CB 6.1964 10.3273 13.4256 68.7203 Constraint (T0288)L16.CB (T0288)I74.CB 5.5054 9.1757 11.9284 68.7203 Constraint (T0288)D45.CB (T0288)K72.CB 12.7410 21.2350 27.6055 68.6039 Constraint (T0288)L44.CB (T0288)I62.CB 12.9801 21.6334 28.1234 68.6038 Constraint (T0288)K65.CB (T0288)N86.CB 9.3085 15.5142 20.1685 68.5029 Constraint (T0288)L16.CB (T0288)A43.CB 7.1021 11.8369 15.3880 68.4205 Constraint (T0288)P4.CB (T0288)A43.CB 12.3252 20.5420 26.7047 68.2996 Constraint (T0288)L44.CB (T0288)N86.CB 12.3085 20.5142 26.6685 68.2331 Constraint (T0288)D45.CB (T0288)K63.CB 12.7989 21.3315 27.7310 68.2034 Constraint (T0288)K11.CB (T0288)V68.CB 11.9443 19.9071 25.8793 68.1932 Constraint (T0288)L16.CB (T0288)E80.CB 8.0900 13.4833 17.5283 68.1215 Constraint (T0288)T55.CB (T0288)L88.CB 7.5126 12.5210 16.2772 68.0947 Constraint (T0288)I54.CB (T0288)L88.CB 7.7137 12.8561 16.7130 68.0947 Constraint (T0288)P29.CB (T0288)A71.CB 9.1744 15.2907 19.8780 68.0784 Constraint (T0288)P29.CB (T0288)V68.CB 8.3870 13.9783 18.1718 68.0784 Constraint (T0288)Q26.CB (T0288)M73.CB 10.7114 17.8524 23.2081 67.9995 Constraint (T0288)K72.CB (T0288)Y85.CB 11.3041 18.8401 24.4922 67.8748 Constraint (T0288)T40.CB (T0288)N86.CB 12.4431 20.7385 26.9601 67.8320 Constraint (T0288)C28.CB (T0288)K65.CB 6.8515 11.4191 14.8449 67.7008 Constraint (T0288)C28.CB (T0288)I74.CB 11.2708 18.7846 24.4200 67.6888 Constraint (T0288)T40.CB (T0288)R60.CB 12.9222 21.5370 27.9981 67.6145 Constraint (T0288)T40.CB (T0288)E69.CB 13.1119 21.8532 28.4092 67.6040 Constraint (T0288)L9.CB (T0288)V68.CB 12.3465 20.5775 26.7507 67.5304 Constraint (T0288)F37.CB (T0288)K65.CB 13.0964 21.8274 28.3756 67.5029 Constraint (T0288)V68.CB (T0288)N86.CB 12.7303 21.2171 27.5823 67.4733 Constraint (T0288)C28.CB (T0288)D52.CB 9.5334 15.8890 20.6558 67.3904 Constraint (T0288)P29.CB (T0288)I62.CB 6.5368 10.8946 14.1630 67.3903 Constraint (T0288)P29.CB (T0288)E53.CB 6.2898 10.4829 13.6278 67.3903 Constraint (T0288)P29.CB (T0288)M73.CB 9.7405 16.2341 21.1044 67.3783 Constraint (T0288)P29.CB (T0288)K72.CB 10.4077 17.3462 22.5501 67.3783 Constraint (T0288)P29.CB (T0288)E69.CB 7.6933 12.8222 16.6689 67.3783 Constraint (T0288)P4.CB (T0288)P41.CB 12.2353 20.3922 26.5099 67.2996 Constraint (T0288)Q26.CB (T0288)I74.CB 11.3592 18.9319 24.6115 67.2994 Constraint (T0288)V7.CB (T0288)K87.CB 7.3554 12.2590 15.9367 67.2993 Constraint (T0288)A13.CB (T0288)I54.CB 12.2431 20.4051 26.5267 67.2925 Constraint (T0288)L16.CB (T0288)K78.CB 7.4581 12.4301 16.1592 67.2478 Constraint (T0288)A50.CB (T0288)L88.CB 6.9643 11.6072 15.0893 67.0948 Constraint (T0288)A49.CB (T0288)L88.CB 6.1433 10.2388 13.3104 67.0948 Constraint (T0288)I33.CB (T0288)L88.CB 7.1266 11.8777 15.4410 67.0948 Constraint (T0288)Y32.CB (T0288)L88.CB 6.3805 10.6341 13.8244 67.0947 Constraint (T0288)P29.CB (T0288)K67.CB 6.0594 10.0990 13.1287 66.9771 Constraint (T0288)L16.CB (T0288)R60.CB 11.2449 18.7415 24.3640 66.7994 Constraint (T0288)L16.CB (T0288)V48.CB 7.8121 13.0201 16.9262 66.7994 Constraint (T0288)L16.CB (T0288)D45.CB 8.1238 13.5396 17.6015 66.7994 Constraint (T0288)L16.CB (T0288)P41.CB 4.5848 7.6414 9.9338 66.7994 Constraint (T0288)L16.CB (T0288)T40.CB 4.4855 7.4758 9.7185 66.7994 Constraint (T0288)L16.CB (T0288)Q75.CB 5.7928 9.6547 12.5511 66.7575 Constraint (T0288)L16.CB (T0288)I83.CB 8.1804 13.6341 17.7243 66.7203 Constraint (T0288)L44.CB (T0288)E76.CB 12.9698 21.6163 28.1012 66.5035 Constraint (T0288)K6.CB (T0288)K87.CB 7.4065 12.3442 16.0475 66.2993 Constraint (T0288)L9.CB (T0288)Y85.CB 7.3565 12.2608 15.9391 66.1935 Constraint (T0288)T8.CB (T0288)Y85.CB 7.0739 11.7899 15.3269 66.1935 Constraint (T0288)C28.CB (T0288)A49.CB 12.1066 20.1777 26.2310 66.1783 Constraint (T0288)E53.CB (T0288)L88.CB 4.9528 8.2547 10.7311 66.1068 Constraint (T0288)D52.CB (T0288)L88.CB 5.1539 8.5898 11.1667 66.1068 Constraint (T0288)Q10.CB (T0288)K65.CB 12.9873 21.6456 28.1393 66.0994 Constraint (T0288)L16.CB (T0288)T66.CB 12.2793 20.4655 26.6051 66.0993 Constraint (T0288)L16.CB (T0288)K65.CB 11.6611 19.4352 25.2658 66.0993 Constraint (T0288)L16.CB (T0288)E76.CB 7.9108 13.1847 17.1401 66.0574 Constraint (T0288)I17.CB (T0288)N86.CB 10.7105 17.8508 23.2060 66.0467 Constraint (T0288)L16.CB (T0288)L44.CB 7.6320 12.7200 16.5359 65.7994 Constraint (T0288)C28.CB (T0288)H84.CB 10.2952 17.1587 22.3063 65.5782 Constraint (T0288)P29.CB (T0288)V57.CB 9.2817 15.4696 20.1104 65.3783 Constraint (T0288)P4.CB (T0288)S20.CB 12.7063 21.1771 27.5303 65.2996 Constraint (T0288)P4.CB (T0288)L31.CB 9.0846 15.1410 19.6833 65.2996 Constraint (T0288)P4.CB (T0288)H84.CB 4.1573 6.9289 9.0075 65.2996 Constraint (T0288)P4.CB (T0288)I83.CB 6.7401 11.2336 14.6037 65.2996 Constraint (T0288)V7.CB (T0288)N86.CB 7.0560 11.7600 15.2881 65.2993 Constraint (T0288)N15.CB (T0288)H84.CB 12.2490 20.4150 26.5395 65.2960 Constraint (T0288)L9.CB (T0288)N86.CB 10.0915 16.8191 21.8649 65.2933 Constraint (T0288)V48.CB (T0288)L88.CB 7.9918 13.3197 17.3156 65.2211 Constraint (T0288)V7.CB (T0288)Y85.CB 4.6627 7.7711 10.1025 65.1995 Constraint (T0288)A25.CB (T0288)V36.CB 12.6167 21.0279 27.3362 65.0901 Constraint (T0288)Q26.CB (T0288)K72.CB 10.5839 17.6398 22.9317 64.9995 Constraint (T0288)Q75.CB (T0288)Y85.CB 11.0397 18.3994 23.9193 64.8748 Constraint (T0288)P29.CB (T0288)I74.CB 10.1670 16.9449 22.0284 64.6782 Constraint (T0288)T40.CB (T0288)K65.CB 13.2376 22.0627 28.6815 64.5030 Constraint (T0288)P29.CB (T0288)K63.CB 5.6714 9.4523 12.2880 64.3903 Constraint (T0288)P4.CB (T0288)L44.CB 12.4675 20.7791 27.0129 64.2996 Constraint (T0288)K6.CB (T0288)N86.CB 6.5933 10.9889 14.2855 64.2993 Constraint (T0288)D12.CB (T0288)I62.CB 12.5486 20.9143 27.1885 64.2993 Constraint (T0288)L9.CB (T0288)K87.CB 10.1258 16.8764 21.9393 64.2933 Constraint (T0288)T8.CB (T0288)N86.CB 9.4652 15.7753 20.5079 64.2933 Constraint (T0288)A25.CB (T0288)H84.CB 11.5184 19.1973 24.9565 64.2891 Constraint (T0288)P4.CB (T0288)V77.CB 11.7989 19.6648 25.5642 64.1996 Constraint (T0288)K6.CB (T0288)Y85.CB 5.1633 8.6055 11.1872 64.1995 Constraint (T0288)T66.CB (T0288)N86.CB 11.3602 18.9337 24.6138 64.1934 Constraint (T0288)V34.CB (T0288)L88.CB 8.7238 14.5397 18.9016 64.1068 Constraint (T0288)V36.CB (T0288)L88.CB 9.2844 15.4741 20.1163 64.0948 Constraint (T0288)V77.CB (T0288)N86.CB 11.6838 19.4729 25.3148 64.0766 Constraint (T0288)A71.CB (T0288)K87.CB 12.7109 21.1848 27.5402 63.8995 Constraint (T0288)K72.CB (T0288)N86.CB 12.7058 21.1763 27.5291 63.7734 Constraint (T0288)L16.CB (T0288)H84.CB 11.4691 19.1152 24.8498 63.7206 Constraint (T0288)P29.CB (T0288)K65.CB 6.2570 10.4283 13.5568 63.7008 Constraint (T0288)L16.CB (T0288)L31.CB 9.8238 16.3731 21.2850 63.4205 Constraint (T0288)P29.CB (T0288)D52.CB 8.6890 14.4817 18.8262 63.3904 Constraint (T0288)P29.CB (T0288)A50.CB 10.2309 17.0515 22.1670 63.3783 Constraint (T0288)P29.CB (T0288)A49.CB 11.3044 18.8407 24.4929 63.3783 Constraint (T0288)P29.CB (T0288)V48.CB 11.3081 18.8468 24.5008 63.3783 Constraint (T0288)P4.CB (T0288)Q35.CB 12.8122 21.3537 27.7598 63.2996 Constraint (T0288)K6.CB (T0288)N15.CB 12.5772 20.9621 27.2507 63.2994 Constraint (T0288)T8.CB (T0288)K87.CB 9.5848 15.9746 20.7670 63.2994 Constraint (T0288)Q26.CB (T0288)I83.CB 12.2861 20.4769 26.6200 63.2889 Constraint (T0288)P29.CB (T0288)T66.CB 6.0212 10.0354 13.0460 63.2875 Constraint (T0288)A49.CB (T0288)E69.CB 13.2319 22.0532 28.6691 63.2129 Constraint (T0288)Q35.CB (T0288)L88.CB 9.9953 16.6588 21.6564 63.1069 Constraint (T0288)A42.CB (T0288)L88.CB 10.1348 16.8913 21.9586 63.0948 Constraint (T0288)V57.CB (T0288)L88.CB 10.8881 18.1468 23.5908 62.9948 Constraint (T0288)C28.CB (T0288)I83.CB 11.1486 18.5810 24.1553 62.5782 Constraint (T0288)I19.CB (T0288)C28.CB 11.7714 19.6190 25.5047 62.4010 Constraint (T0288)P29.CB (T0288)A42.CB 12.4567 20.7611 26.9895 62.3783 Constraint (T0288)P4.CB (T0288)E80.CB 11.5337 19.2228 24.9897 62.2996 Constraint (T0288)P4.CB (T0288)C30.CB 8.5109 14.1848 18.4402 62.2996 Constraint (T0288)D12.CB (T0288)H84.CB 12.0690 20.1150 26.1495 62.2995 Constraint (T0288)D12.CB (T0288)A50.CB 12.0203 20.0338 26.0439 62.2959 Constraint (T0288)D45.CB (T0288)L88.CB 10.6094 17.6824 22.9871 62.2332 Constraint (T0288)P4.CB (T0288)K67.CB 12.6053 21.0088 27.3114 62.1996 Constraint (T0288)S61.CB (T0288)L88.CB 10.9227 18.2045 23.6658 62.1213 Constraint (T0288)I62.CB (T0288)L88.CB 9.5941 15.9902 20.7873 62.1068 Constraint (T0288)L31.CB (T0288)L88.CB 8.5205 14.2008 18.4610 62.0947 Constraint (T0288)A25.CB (T0288)A49.CB 11.9333 19.8888 25.8555 62.0902 Constraint (T0288)P29.CB (T0288)Q75.CB 12.1969 20.3282 26.4267 61.6782 Constraint (T0288)Q26.CB (T0288)Y85.CB 11.4200 19.0334 24.7434 61.5938 Constraint (T0288)A25.CB (T0288)Y85.CB 10.8389 18.0648 23.4842 61.5938 Constraint (T0288)A50.CB (T0288)E80.CB 13.1503 21.9172 28.4923 61.4104 Constraint (T0288)P29.CB (T0288)N58.CB 11.7138 19.5230 25.3798 61.2783 Constraint (T0288)K6.CB (T0288)N39.CB 13.0799 21.7998 28.3397 61.0994 Constraint (T0288)Q10.CB (T0288)E69.CB 12.9540 21.5900 28.0669 61.0933 Constraint (T0288)E76.CB (T0288)Y85.CB 11.3267 18.8778 24.5411 61.0734 Constraint (T0288)V70.CB (T0288)L88.CB 10.8320 18.0533 23.4692 60.9950 Constraint (T0288)Q26.CB (T0288)N86.CB 10.3095 17.1824 22.3372 60.6936 Constraint (T0288)A25.CB (T0288)N86.CB 10.0093 16.6821 21.6868 60.6936 Constraint (T0288)S20.CB (T0288)P29.CB 9.8132 16.3553 21.2619 60.4009 Constraint (T0288)D12.CB (T0288)V34.CB 11.7821 19.6368 25.5278 60.2959 Constraint (T0288)Q10.CB (T0288)Y85.CB 9.3238 15.5397 20.2017 60.1935 Constraint (T0288)D45.CB (T0288)K67.CB 12.6488 21.0813 27.4057 60.1005 Constraint (T0288)V7.CB (T0288)L16.CB 9.7845 16.3075 21.1998 60.0993 Constraint (T0288)K63.CB (T0288)L88.CB 9.3933 15.6555 20.3522 60.0068 Constraint (T0288)C30.CB (T0288)L88.CB 7.2658 12.1097 15.7427 59.7577 Constraint (T0288)P29.CB (T0288)H84.CB 9.5140 15.8567 20.6138 59.6782 Constraint (T0288)C28.CB (T0288)Y85.CB 9.8722 16.4536 21.3897 59.5818 Constraint (T0288)Q14.CB (T0288)A50.CB 12.1250 20.2083 26.2708 59.2925 Constraint (T0288)Q26.CB (T0288)H84.CB 11.7022 19.5036 25.3547 59.2891 Constraint (T0288)I17.CB (T0288)P29.CB 12.3412 20.5687 26.7393 59.1011 Constraint (T0288)K6.CB (T0288)L16.CB 12.0921 20.1536 26.1996 59.0993 Constraint (T0288)F37.CB (T0288)L88.CB 12.2869 20.4782 26.6217 58.7006 Constraint (T0288)I19.CB (T0288)P29.CB 10.5896 17.6493 22.9441 58.4009 Constraint (T0288)Q14.CB (T0288)V68.CB 12.2307 20.3844 26.4998 58.2993 Constraint (T0288)D45.CB (T0288)K65.CB 12.6644 21.1073 27.4395 58.2031 Constraint (T0288)V7.CB (T0288)T66.CB 13.1053 21.8421 28.3948 58.1994 Constraint (T0288)Q10.CB (T0288)N86.CB 12.2324 20.3873 26.5035 58.1936 Constraint (T0288)P29.CB (T0288)V81.CB 12.3652 20.6086 26.7912 58.1770 Constraint (T0288)I21.CB (T0288)L88.CB 9.2733 15.4554 20.0921 58.1731 Constraint (T0288)I19.CB (T0288)L88.CB 9.6998 16.1663 21.0162 58.1731 Constraint (T0288)A43.CB (T0288)L88.CB 11.0176 18.3627 23.8716 58.1069 Constraint (T0288)T8.CB (T0288)K67.CB 12.7661 21.2768 27.6599 58.0934 Constraint (T0288)Q35.CB (T0288)R60.CB 13.0631 21.7718 28.3034 58.0106 Constraint (T0288)K67.CB (T0288)E80.CB 12.8320 21.3867 27.8028 57.7987 Constraint (T0288)K67.CB (T0288)L88.CB 11.3676 18.9460 24.6298 57.7914 Constraint (T0288)P29.CB (T0288)I83.CB 10.0298 16.7163 21.7312 57.6782 Constraint (T0288)A25.CB (T0288)K87.CB 11.2368 18.7280 24.3464 57.5936 Constraint (T0288)P4.CB (T0288)A71.CB 12.9590 21.5984 28.0779 57.1996 Constraint (T0288)C28.CB (T0288)V48.CB 12.0008 20.0014 26.0018 57.1783 Constraint (T0288)P4.CB (T0288)E69.CB 12.4254 20.7090 26.9217 56.1998 Constraint (T0288)P4.CB (T0288)Y85.CB 4.8966 8.1609 10.6092 56.1996 Constraint (T0288)K11.CB (T0288)Y85.CB 10.0151 16.6918 21.6993 56.1936 Constraint (T0288)L9.CB (T0288)T66.CB 12.7885 21.3142 27.7085 56.1934 Constraint (T0288)C28.CB (T0288)N86.CB 8.4825 14.1375 18.3787 55.6818 Constraint (T0288)C28.CB (T0288)K87.CB 10.2762 17.1270 22.2651 55.4818 Constraint (T0288)T47.CB (T0288)T82.CB 7.1023 11.8372 15.3883 55.2996 Constraint (T0288)T47.CB (T0288)V81.CB 7.3426 12.2377 15.9090 55.2996 Constraint (T0288)T47.CB (T0288)V77.CB 10.0336 16.7227 21.7396 55.2996 Constraint (T0288)T47.CB (T0288)I74.CB 9.7944 16.3240 21.2212 55.2996 Constraint (T0288)T47.CB (T0288)A71.CB 12.4850 20.8083 27.0508 55.2996 Constraint (T0288)T47.CB (T0288)V70.CB 11.4272 19.0453 24.7588 55.2996 Constraint (T0288)T47.CB (T0288)K63.CB 12.1716 20.2859 26.3717 55.2996 Constraint (T0288)T47.CB (T0288)I62.CB 10.5045 17.5076 22.7598 55.2996 Constraint (T0288)T47.CB (T0288)S61.CB 11.9640 19.9400 25.9221 55.2996 Constraint (T0288)T47.CB (T0288)R60.CB 11.6165 19.3608 25.1690 55.2996 Constraint (T0288)T47.CB (T0288)N58.CB 9.6315 16.0525 20.8683 55.2996 Constraint (T0288)T47.CB (T0288)V57.CB 8.7241 14.5402 18.9023 55.2996 Constraint (T0288)D38.CB (T0288)T47.CB 9.1657 15.2762 19.8591 55.2996 Constraint (T0288)F37.CB (T0288)T47.CB 8.7655 14.6091 18.9919 55.2996 Constraint (T0288)V36.CB (T0288)T47.CB 6.3272 10.5454 13.7090 55.2996 Constraint (T0288)Q35.CB (T0288)T47.CB 9.2954 15.4923 20.1400 55.2996 Constraint (T0288)V34.CB (T0288)T47.CB 9.9521 16.5869 21.5629 55.2996 Constraint (T0288)I33.CB (T0288)T47.CB 6.6779 11.1298 14.4687 55.2996 Constraint (T0288)Y32.CB (T0288)T47.CB 9.4142 15.6903 20.3974 55.2996 Constraint (T0288)L31.CB (T0288)T47.CB 10.1315 16.8858 21.9516 55.2996 Constraint (T0288)I21.CB (T0288)T47.CB 9.4858 15.8096 20.5525 55.2996 Constraint (T0288)S20.CB (T0288)T47.CB 9.7857 16.3095 21.2023 55.2996 Constraint (T0288)I19.CB (T0288)T47.CB 6.7533 11.2555 14.6322 55.2996 Constraint (T0288)I17.CB (T0288)T47.CB 7.3003 12.1672 15.8174 55.2996 Constraint (T0288)P4.CB (T0288)K87.CB 5.3450 8.9084 11.5809 55.2996 Constraint (T0288)A25.CB (T0288)Q75.CB 11.3307 18.8846 24.5499 55.2996 Constraint (T0288)N15.CB (T0288)Y85.CB 11.7836 19.6394 25.5312 55.1997 Constraint (T0288)Q14.CB (T0288)K67.CB 12.3557 20.5929 26.7707 55.1923 Constraint (T0288)P29.CB (T0288)V77.CB 12.6819 21.1365 27.4774 55.1805 Constraint (T0288)I17.CB (T0288)L88.CB 11.9548 19.9246 25.9020 55.1732 Constraint (T0288)S20.CB (T0288)L88.CB 10.2826 17.1376 22.2789 55.1731 Constraint (T0288)V68.CB (T0288)E80.CB 13.0364 21.7273 28.2455 54.9391 Constraint (T0288)Q75.CB (T0288)N86.CB 13.0751 21.7919 28.3295 54.7866 Constraint (T0288)Y27.CB (T0288)K67.CB 6.8810 11.4683 14.9087 54.6775 Constraint (T0288)L16.CB (T0288)C30.CB 12.6161 21.0268 27.3348 54.4208 Constraint (T0288)K65.CB (T0288)L88.CB 11.2808 18.8013 24.4417 54.4031 Constraint (T0288)Y27.CB (T0288)V70.CB 8.0629 13.4382 17.4697 54.3785 Constraint (T0288)Y27.CB (T0288)E69.CB 8.3641 13.9402 18.1222 54.3785 Constraint (T0288)Y27.CB (T0288)S61.CB 8.8313 14.7189 19.1345 54.3785 Constraint (T0288)Y27.CB (T0288)T55.CB 8.4811 14.1351 18.3757 54.3785 Constraint (T0288)Y27.CB (T0288)I54.CB 8.6302 14.3837 18.6988 54.3785 Constraint (T0288)I74.CB (T0288)L88.CB 11.9150 19.8584 25.8159 54.3139 Constraint (T0288)Q10.CB (T0288)T47.CB 6.9512 11.5853 15.0608 54.2996 Constraint (T0288)L9.CB (T0288)T47.CB 5.0743 8.4572 10.9943 54.2996 Constraint (T0288)T8.CB (T0288)T47.CB 4.9993 8.3322 10.8318 54.2996 Constraint (T0288)V7.CB (T0288)T47.CB 3.4711 5.7851 7.5207 54.2996 Constraint (T0288)K6.CB (T0288)T47.CB 5.5399 9.2332 12.0032 54.2996 Constraint (T0288)P29.CB (T0288)T82.CB 12.4907 20.8178 27.0631 54.1771 Constraint (T0288)V77.CB (T0288)K87.CB 12.7223 21.2039 27.5650 53.8080 Constraint (T0288)Q35.CB (T0288)K78.CB 13.2553 22.0921 28.7197 53.7436 Constraint (T0288)P29.CB (T0288)Y85.CB 9.2959 15.4931 20.1410 53.5818 Constraint (T0288)P29.CB (T0288)E76.CB 12.6697 21.1161 27.4510 53.5782 Constraint (T0288)Y27.CB (T0288)V57.CB 10.6482 17.7470 23.0711 53.3785 Constraint (T0288)P4.CB (T0288)N86.CB 3.8655 6.4425 8.3753 53.2997 Constraint (T0288)V7.CB (T0288)L88.CB 9.1440 15.2400 19.8120 53.2994 Constraint (T0288)P41.CB (T0288)L88.CB 12.6078 21.0129 27.3168 53.1283 Constraint (T0288)Y27.CB (T0288)V68.CB 8.6911 14.4852 18.8308 53.0786 Constraint (T0288)P29.CB (T0288)K87.CB 10.1113 16.8521 21.9077 52.6818 Constraint (T0288)Y27.CB (T0288)K63.CB 6.7008 11.1680 14.5185 52.3906 Constraint (T0288)Y27.CB (T0288)I62.CB 7.5756 12.6260 16.4138 52.3906 Constraint (T0288)Y27.CB (T0288)E53.CB 7.5997 12.6662 16.4661 52.3906 Constraint (T0288)T47.CB (T0288)K78.CB 11.3458 18.9096 24.5825 52.2997 Constraint (T0288)T47.CB (T0288)Q75.CB 12.3169 20.5281 26.6866 52.2997 Constraint (T0288)T47.CB (T0288)M73.CB 11.5579 19.2632 25.0421 52.2997 Constraint (T0288)T47.CB (T0288)K65.CB 12.9730 21.6217 28.1082 52.2997 Constraint (T0288)V3.CB (T0288)V70.CB 12.5402 20.9003 27.1704 52.2997 Constraint (T0288)V3.CB (T0288)K65.CB 12.6234 21.0390 27.3507 52.2997 Constraint (T0288)V3.CB (T0288)K63.CB 9.5251 15.8751 20.6377 52.2997 Constraint (T0288)V3.CB (T0288)I62.CB 10.4330 17.3882 22.6047 52.2997 Constraint (T0288)V3.CB (T0288)S61.CB 10.4579 17.4298 22.6587 52.2997 Constraint (T0288)V3.CB (T0288)V57.CB 10.9980 18.3300 23.8290 52.2997 Constraint (T0288)V3.CB (T0288)T55.CB 6.9171 11.5285 14.9870 52.2997 Constraint (T0288)V3.CB (T0288)I54.CB 8.6918 14.4863 18.8322 52.2997 Constraint (T0288)V3.CB (T0288)E53.CB 6.8681 11.4468 14.8809 52.2997 Constraint (T0288)V3.CB (T0288)D52.CB 6.8411 11.4018 14.8223 52.2997 Constraint (T0288)V3.CB (T0288)A50.CB 10.1787 16.9645 22.0539 52.2997 Constraint (T0288)V3.CB (T0288)A49.CB 7.9046 13.1744 17.1267 52.2997 Constraint (T0288)V3.CB (T0288)V48.CB 8.8894 14.8157 19.2604 52.2997 Constraint (T0288)V3.CB (T0288)D45.CB 10.4336 17.3893 22.6061 52.2997 Constraint (T0288)V3.CB (T0288)V36.CB 11.7989 19.6648 25.5642 52.2997 Constraint (T0288)V3.CB (T0288)I33.CB 9.5557 15.9262 20.7040 52.2997 Constraint (T0288)V3.CB (T0288)Y32.CB 9.6881 16.1468 20.9909 52.2997 Constraint (T0288)V3.CB (T0288)I21.CB 11.9853 19.9754 25.9681 52.2997 Constraint (T0288)V3.CB (T0288)I19.CB 11.8087 19.6812 25.5855 52.2997 Constraint (T0288)K11.CB (T0288)T47.CB 8.3419 13.9032 18.0741 52.2996 Constraint (T0288)C30.CB (T0288)T47.CB 11.4548 19.0913 24.8187 52.2996 Constraint (T0288)K6.CB (T0288)L88.CB 9.2813 15.4688 20.1094 52.2994 Constraint (T0288)D12.CB (T0288)L31.CB 12.1754 20.2924 26.3801 52.2838 Constraint (T0288)Y27.CB (T0288)R60.CB 10.6548 17.7581 23.0855 52.1785 Constraint (T0288)T40.CB (T0288)L88.CB 12.4342 20.7237 26.9408 52.1320 Constraint (T0288)Y27.CB (T0288)A71.CB 9.8510 16.4184 21.3439 52.0786 Constraint (T0288)C28.CB (T0288)N58.CB 12.3231 20.5385 26.7001 52.0783 Constraint (T0288)P4.CB (T0288)T66.CB 12.9664 21.6107 28.0938 51.9997 Constraint (T0288)V34.CB (T0288)E80.CB 13.1918 21.9863 28.5822 51.9995 Constraint (T0288)P29.CB (T0288)N86.CB 8.3510 13.9184 18.0939 51.6818 Constraint (T0288)V3.CB (T0288)T82.CB 10.1972 16.9954 22.0940 51.2997 Constraint (T0288)V3.CB (T0288)A42.CB 11.4662 19.1104 24.8435 51.2997 Constraint (T0288)P4.CB (T0288)T47.CB 7.7122 12.8537 16.7098 51.2997 Constraint (T0288)T47.CB (T0288)E80.CB 8.5769 14.2948 18.5832 51.2997 Constraint (T0288)Q26.CB (T0288)Q75.CB 12.2900 20.4833 26.6283 51.2995 Constraint (T0288)L9.CB (T0288)L88.CB 11.7162 19.5271 25.3852 51.2934 Constraint (T0288)P4.CB (T0288)T40.CB 13.2017 22.0028 28.6036 51.1997 Constraint (T0288)V7.CB (T0288)P29.CB 12.3006 20.5010 26.6513 51.1996 Constraint (T0288)K6.CB (T0288)P29.CB 12.3878 20.6463 26.8401 51.1996 Constraint (T0288)V7.CB (T0288)V68.CB 13.2455 22.0758 28.6985 51.1995 Constraint (T0288)Q14.CB (T0288)E69.CB 12.5263 20.8772 27.1404 51.1993 Constraint (T0288)Q10.CB (T0288)K87.CB 11.8277 19.7129 25.6268 51.1936 Constraint (T0288)K11.CB (T0288)N86.CB 12.8658 21.4430 27.8759 51.1936 Constraint (T0288)L16.CB (T0288)Y85.CB 10.4462 17.4103 22.6334 50.8470 Constraint (T0288)Q26.CB (T0288)K87.CB 11.3770 18.9616 24.6501 50.3936 Constraint (T0288)Y27.CB (T0288)D52.CB 10.1077 16.8462 21.9000 50.3906 Constraint (T0288)V3.CB (T0288)V81.CB 12.1261 20.2101 26.2731 50.2998 Constraint (T0288)V3.CB (T0288)R60.CB 12.2564 20.4273 26.5555 50.2997 Constraint (T0288)D12.CB (T0288)T47.CB 9.7369 16.2282 21.0966 50.2996 Constraint (T0288)T8.CB (T0288)L88.CB 11.6069 19.3449 25.1484 50.2995 Constraint (T0288)N15.CB (T0288)K65.CB 11.6182 19.3637 25.1728 50.2994 Constraint (T0288)Q14.CB (T0288)A49.CB 12.1555 20.2592 26.3370 50.2925 Constraint (T0288)Y27.CB (T0288)T66.CB 6.3273 10.5455 13.7091 50.2878 Constraint (T0288)D12.CB (T0288)Y85.CB 11.4119 19.0199 24.7259 50.1998 Constraint (T0288)A13.CB (T0288)R60.CB 12.1566 20.2611 26.3394 50.0995 Constraint (T0288)E69.CB (T0288)K87.CB 13.0424 21.7373 28.2585 49.6640 Constraint (T0288)Y27.CB (T0288)M73.CB 10.3691 17.2818 22.4664 49.3785 Constraint (T0288)V3.CB (T0288)N58.CB 12.1041 20.1735 26.2256 49.2997 Constraint (T0288)V3.CB (T0288)L31.CB 10.5114 17.5190 22.7747 49.2997 Constraint (T0288)Q14.CB (T0288)T47.CB 11.2789 18.7982 24.4376 49.2996 Constraint (T0288)A13.CB (T0288)T47.CB 11.2750 18.7917 24.4292 49.2996 Constraint (T0288)T47.CB (T0288)H84.CB 7.1217 11.8695 15.4303 49.2996 Constraint (T0288)T47.CB (T0288)I83.CB 5.3988 8.9980 11.6974 49.2996 Constraint (T0288)Q14.CB (T0288)L31.CB 12.3106 20.5177 26.6729 49.1924 Constraint (T0288)T55.CB (T0288)Q89.CB 8.5443 14.2405 18.5126 49.0948 Constraint (T0288)A49.CB (T0288)Q89.CB 7.4245 12.3741 16.0863 49.0948 Constraint (T0288)I33.CB (T0288)Q89.CB 8.8403 14.7339 19.1540 49.0948 Constraint (T0288)R60.CB (T0288)L88.CB 12.3588 20.5980 26.7774 48.9345 Constraint (T0288)Y27.CB (T0288)K65.CB 6.7239 11.2065 14.5684 48.7010 Constraint (T0288)L44.CB (T0288)L88.CB 12.3348 20.5580 26.7254 48.2332 Constraint (T0288)V48.CB (T0288)Q89.CB 9.2792 15.4653 20.1049 48.2211 Constraint (T0288)K11.CB (T0288)K87.CB 12.8582 21.4304 27.8595 48.1936 Constraint (T0288)K11.CB (T0288)T66.CB 13.0082 21.6803 28.1844 48.1933 Constraint (T0288)I54.CB (T0288)Q89.CB 8.9908 14.9846 19.4800 48.0948 Constraint (T0288)Y32.CB (T0288)Q89.CB 8.0614 13.4357 17.4665 48.0948 Constraint (T0288)L31.CB (T0288)Q89.CB 9.9782 16.6303 21.6194 48.0948 Constraint (T0288)N39.CB (T0288)K87.CB 12.8645 21.4408 27.8731 47.9057 Constraint (T0288)A25.CB (T0288)L88.CB 9.9221 16.5369 21.4980 47.5937 Constraint (T0288)V3.CB (T0288)I17.CB 13.0696 21.7827 28.3175 47.2997 Constraint (T0288)V3.CB (T0288)H84.CB 6.7415 11.2358 14.6066 47.2997 Constraint (T0288)V3.CB (T0288)I83.CB 8.8012 14.6686 19.0692 47.2997 Constraint (T0288)V3.CB (T0288)C30.CB 9.4437 15.7395 20.4614 47.2997 Constraint (T0288)N15.CB (T0288)T47.CB 10.2111 17.0186 22.1241 47.2996 Constraint (T0288)K63.CB (T0288)K78.CB 12.8041 21.3402 27.7423 47.2962 Constraint (T0288)P4.CB (T0288)P29.CB 10.7401 17.9002 23.2702 47.1997 Constraint (T0288)D52.CB (T0288)Q89.CB 6.6915 11.1525 14.4983 47.1069 Constraint (T0288)P4.CB (T0288)C28.CB 10.7099 17.8498 23.2047 47.0997 Constraint (T0288)V36.CB (T0288)Q89.CB 10.6220 17.7033 23.0143 47.0949 Constraint (T0288)N58.CB (T0288)L88.CB 12.5996 20.9994 27.2992 46.8011 Constraint (T0288)D38.CB (T0288)K67.CB 12.9351 21.5584 28.0260 46.7094 Constraint (T0288)Y27.CB (T0288)H84.CB 10.9543 18.2572 23.7344 46.6784 Constraint (T0288)C28.CB (T0288)L88.CB 9.1819 15.3032 19.8941 46.5819 Constraint (T0288)D38.CB (T0288)L88.CB 12.5310 20.8851 27.1506 46.4258 Constraint (T0288)V3.CB (T0288)V34.CB 12.1493 20.2488 26.3235 46.2997 Constraint (T0288)A13.CB (T0288)A49.CB 12.5134 20.8556 27.1123 46.2928 Constraint (T0288)D12.CB (T0288)Y32.CB 12.5771 20.9618 27.2503 46.2840 Constraint (T0288)A43.CB (T0288)K72.CB 13.3034 22.1723 28.8239 46.2250 Constraint (T0288)N15.CB (T0288)T66.CB 12.0011 20.0018 26.0023 46.1994 Constraint (T0288)E53.CB (T0288)Q89.CB 6.3303 10.5505 13.7156 46.1069 Constraint (T0288)A50.CB (T0288)Q89.CB 8.1850 13.6416 17.7341 46.0949 Constraint (T0288)Y27.CB (T0288)I74.CB 10.9128 18.1879 23.6443 45.6904 Constraint (T0288)Y27.CB (T0288)K72.CB 10.4160 17.3600 22.5681 45.6895 Constraint (T0288)Y27.CB (T0288)I83.CB 11.6571 19.4285 25.2571 45.6784 Constraint (T0288)Y27.CB (T0288)V48.CB 12.5597 20.9329 27.2127 45.3785 Constraint (T0288)V3.CB (T0288)A43.CB 12.6175 21.0291 27.3379 45.2997 Constraint (T0288)T47.CB (T0288)K87.CB 6.8253 11.3755 14.7882 45.2997 Constraint (T0288)Q14.CB (T0288)D52.CB 12.1016 20.1694 26.2202 45.2926 Constraint (T0288)T47.CB (T0288)Y85.CB 5.4160 9.0266 11.7346 45.1997 Constraint (T0288)I62.CB (T0288)Q89.CB 11.0106 18.3510 23.8563 45.1069 Constraint (T0288)C28.CB (T0288)Q75.CB 12.5902 20.9836 27.2787 44.9998 Constraint (T0288)C30.CB (T0288)Q89.CB 8.6358 14.3930 18.7109 44.7578 Constraint (T0288)D52.CB (T0288)Y90.CB 7.7667 12.9446 16.8279 44.6058 Constraint (T0288)A49.CB (T0288)Y90.CB 8.0025 13.3376 17.3388 44.5998 Constraint (T0288)I54.CB (T0288)Y90.CB 10.1448 16.9080 21.9804 44.5998 Constraint (T0288)F37.CB (T0288)T66.CB 13.3144 22.1907 28.8479 44.3244 Constraint (T0288)P4.CB (T0288)L88.CB 7.0394 11.7324 15.2521 44.2997 Constraint (T0288)E53.CB (T0288)K78.CB 13.1399 21.8998 28.4698 44.2963 Constraint (T0288)N15.CB (T0288)E53.CB 12.3718 20.6196 26.8055 44.2961 Constraint (T0288)D45.CB (T0288)Q89.CB 11.4173 19.0289 24.7375 44.2333 Constraint (T0288)Q14.CB (T0288)I62.CB 12.5478 20.9130 27.1869 44.1926 Constraint (T0288)Q35.CB (T0288)Q89.CB 11.4284 19.0473 24.7615 44.1069 Constraint (T0288)V34.CB (T0288)Q89.CB 10.2504 17.0840 22.2092 44.1069 Constraint (T0288)A42.CB (T0288)Q89.CB 11.2787 18.7978 24.4371 44.0950 Constraint (T0288)A25.CB (T0288)A42.CB 13.0269 21.7114 28.2248 44.0903 Constraint (T0288)E76.CB (T0288)N86.CB 13.1297 21.8829 28.4477 44.0865 Constraint (T0288)M73.CB (T0288)L88.CB 12.4393 20.7321 26.9517 43.9129 Constraint (T0288)K63.CB (T0288)Q89.CB 10.8802 18.1336 23.5737 43.8071 Constraint (T0288)V48.CB (T0288)Y90.CB 9.9633 16.6055 21.5872 43.7262 Constraint (T0288)E53.CB (T0288)Y90.CB 7.5937 12.6562 16.4531 43.6058 Constraint (T0288)T55.CB (T0288)Y90.CB 9.4874 15.8123 20.5560 43.5999 Constraint (T0288)L31.CB (T0288)Y90.CB 11.1190 18.5316 24.0911 43.5999 Constraint (T0288)A50.CB (T0288)Y90.CB 9.0523 15.0871 19.6132 43.5999 Constraint (T0288)I33.CB (T0288)Y90.CB 9.6619 16.1032 20.9342 43.5998 Constraint (T0288)Y32.CB (T0288)Y90.CB 9.1185 15.1974 19.7567 43.5998 Constraint (T0288)Y27.CB (T0288)A50.CB 11.0494 18.4156 23.9403 43.3785 Constraint (T0288)A25.CB (T0288)V77.CB 12.3554 20.5923 26.7700 43.2998 Constraint (T0288)A25.CB (T0288)E76.CB 11.5939 19.3232 25.1202 43.2998 Constraint (T0288)T47.CB (T0288)N86.CB 7.8292 13.0487 16.9632 43.2997 Constraint (T0288)A25.CB (T0288)N58.CB 11.9705 19.9509 25.9361 43.2890 Constraint (T0288)T66.CB (T0288)K87.CB 13.0944 21.8240 28.3712 43.1937 Constraint (T0288)V57.CB (T0288)Q89.CB 12.0146 20.0243 26.0315 42.8950 Constraint (T0288)L16.CB (T0288)S61.CB 12.9372 21.5621 28.0307 42.7998 Constraint (T0288)V36.CB (T0288)Y90.CB 11.2524 18.7540 24.3802 42.5999 Constraint (T0288)Y27.CB (T0288)K87.CB 11.4129 19.0214 24.7279 42.5819 Constraint (T0288)Q26.CB (T0288)L88.CB 10.1281 16.8801 21.9441 42.4937 Constraint (T0288)T47.CB (T0288)K67.CB 13.3765 22.2942 28.9825 42.2998 Constraint (T0288)M2.CB (T0288)T82.CB 11.4578 19.0964 24.8253 42.1998 Constraint (T0288)M2.CB (T0288)K63.CB 9.4598 15.7664 20.4963 42.1998 Constraint (T0288)M2.CB (T0288)I62.CB 10.7801 17.9669 23.3569 42.1998 Constraint (T0288)M2.CB (T0288)S61.CB 10.9490 18.2483 23.7228 42.1998 Constraint (T0288)M2.CB (T0288)V57.CB 11.7279 19.5464 25.4103 42.1998 Constraint (T0288)M2.CB (T0288)T55.CB 7.3237 12.2062 15.8680 42.1998 Constraint (T0288)M2.CB (T0288)I54.CB 9.0434 15.0723 19.5940 42.1998 Constraint (T0288)M2.CB (T0288)E53.CB 6.6480 11.0800 14.4040 42.1998 Constraint (T0288)M2.CB (T0288)D52.CB 6.9443 11.5739 15.0461 42.1998 Constraint (T0288)M2.CB (T0288)A49.CB 7.9926 13.3211 17.3174 42.1998 Constraint (T0288)M2.CB (T0288)V48.CB 9.4677 15.7795 20.5133 42.1998 Constraint (T0288)M2.CB (T0288)D45.CB 11.3836 18.9726 24.6644 42.1998 Constraint (T0288)M2.CB (T0288)I33.CB 9.5913 15.9856 20.7812 42.1998 Constraint (T0288)M2.CB (T0288)Y32.CB 9.2803 15.4671 20.1073 42.1998 Constraint (T0288)A71.CB (T0288)L88.CB 12.2763 20.4605 26.5987 42.0127 Constraint (T0288)C28.CB (T0288)T82.CB 12.7837 21.3061 27.6979 41.9772 Constraint (T0288)L16.CB (T0288)N86.CB 13.1524 21.9207 28.4969 41.8471 Constraint (T0288)P29.CB (T0288)L88.CB 9.3134 15.5223 20.1790 41.6818 Constraint (T0288)Y27.CB (T0288)Y85.CB 10.5453 17.5755 22.8482 41.5819 Constraint (T0288)A49.CB (T0288)T66.CB 13.3221 22.2034 28.8645 41.3245 Constraint (T0288)C30.CB (T0288)Y90.CB 9.8895 16.4825 21.4273 41.2628 Constraint (T0288)V3.CB (T0288)Y85.CB 6.0716 10.1193 13.1551 41.1998 Constraint (T0288)P4.CB (T0288)A25.CB 12.4631 20.7719 27.0034 41.1997 Constraint (T0288)K6.CB (T0288)C28.CB 12.4043 20.6739 26.8761 40.9997 Constraint (T0288)Y27.CB (T0288)A49.CB 12.2319 20.3865 26.5024 40.3785 Constraint (T0288)D45.CB (T0288)E69.CB 12.9331 21.5551 28.0217 40.3040 Constraint (T0288)V3.CB (T0288)T47.CB 8.1853 13.6422 17.7349 40.2998 Constraint (T0288)T47.CB (T0288)E76.CB 12.6913 21.1522 27.4979 40.2998 Constraint (T0288)V3.CB (T0288)K87.CB 4.7981 7.9969 10.3960 40.2998 Constraint (T0288)V3.CB (T0288)I74.CB 13.0854 21.8089 28.3516 40.2998 Constraint (T0288)A13.CB (T0288)V34.CB 12.2577 20.4294 26.5583 40.2928 Constraint (T0288)M2.CB (T0288)A50.CB 9.7211 16.2019 21.0624 40.1998 Constraint (T0288)M2.CB (T0288)I19.CB 11.9944 19.9906 25.9878 40.1998 Constraint (T0288)Q14.CB (T0288)R60.CB 11.9167 19.8611 25.8194 40.1997 Constraint (T0288)Q14.CB (T0288)Y32.CB 12.5653 20.9421 27.2248 40.1928 Constraint (T0288)Y27.CB (T0288)N58.CB 12.3677 20.6128 26.7966 40.1785 Constraint (T0288)K6.CB (T0288)D38.CB 12.9651 21.6085 28.0910 40.0997 Constraint (T0288)S61.CB (T0288)Q89.CB 11.6253 19.3755 25.1881 39.9214 Constraint (T0288)Y27.CB (T0288)N86.CB 9.3582 15.5970 20.2761 39.6819 Constraint (T0288)V34.CB (T0288)Y90.CB 11.1192 18.5320 24.0916 39.6059 Constraint (T0288)V3.CB (T0288)N86.CB 4.6679 7.7799 10.1138 39.2998 Constraint (T0288)M2.CB (T0288)R60.CB 12.9504 21.5840 28.0591 39.1998 Constraint (T0288)I21.CB (T0288)Q89.CB 11.1262 18.5436 24.1067 39.1732 Constraint (T0288)A43.CB (T0288)Q89.CB 11.8769 19.7949 25.7333 39.1070 Constraint (T0288)L16.CB (T0288)T47.CB 9.8293 16.3821 21.2968 39.0997 Constraint (T0288)L16.CB (T0288)K87.CB 13.0361 21.7269 28.2450 38.9733 Constraint (T0288)M2.CB (T0288)V81.CB 13.0237 21.7061 28.2180 38.1998 Constraint (T0288)M2.CB (T0288)A42.CB 11.8402 19.7337 25.6538 38.1998 Constraint (T0288)M2.CB (T0288)V36.CB 11.7383 19.5638 25.4329 38.1998 Constraint (T0288)M2.CB (T0288)V34.CB 11.7420 19.5699 25.4409 38.1998 Constraint (T0288)N15.CB (T0288)T55.CB 12.3790 20.6316 26.8211 38.1963 Constraint (T0288)I19.CB (T0288)Q89.CB 11.2333 18.7222 24.3389 38.1733 Constraint (T0288)V7.CB (T0288)C28.CB 12.4141 20.6901 26.8971 37.9997 Constraint (T0288)P41.CB (T0288)K63.CB 13.4762 22.4603 29.1984 37.3041 Constraint (T0288)A13.CB (T0288)A50.CB 12.4755 20.7924 27.0302 37.2928 Constraint (T0288)M2.CB (T0288)I21.CB 11.7039 19.5065 25.3585 37.1998 Constraint (T0288)M2.CB (T0288)L31.CB 10.3468 17.2447 22.4181 37.1998 Constraint (T0288)M2.CB (T0288)H84.CB 7.6766 12.7944 16.6327 37.1998 Constraint (T0288)M2.CB (T0288)I83.CB 9.6430 16.0717 20.8933 37.1998 Constraint (T0288)M2.CB (T0288)C30.CB 9.1795 15.2992 19.8890 37.1998 Constraint (T0288)V3.CB (T0288)L44.CB 12.7550 21.2583 27.6358 37.1998 Constraint (T0288)S20.CB (T0288)Q89.CB 11.9989 19.9981 25.9975 37.1733 Constraint (T0288)Q10.CB (T0288)K67.CB 12.5337 20.8895 27.1563 37.0937 Constraint (T0288)C28.CB (T0288)A42.CB 12.7762 21.2936 27.6817 37.0889 Constraint (T0288)A13.CB (T0288)L31.CB 12.6102 21.0171 27.3222 37.0807 Constraint (T0288)V7.CB (T0288)Q89.CB 10.2006 17.0010 22.1014 36.2995 Constraint (T0288)A13.CB (T0288)D52.CB 12.2416 20.4026 26.5234 36.2929 Constraint (T0288)A25.CB (T0288)V81.CB 12.6994 21.1657 27.5154 36.2893 Constraint (T0288)D12.CB (T0288)K67.CB 12.3862 20.6437 26.8368 36.2874 Constraint (T0288)Q26.CB (T0288)A49.CB 11.6848 19.4746 25.3170 36.1903 Constraint (T0288)D12.CB (T0288)E69.CB 12.5898 20.9830 27.2779 36.0873 Constraint (T0288)P4.CB (T0288)Q26.CB 11.6367 19.3945 25.2129 35.9997 Constraint (T0288)I17.CB (T0288)C28.CB 12.6803 21.1339 27.4740 35.9011 Constraint (T0288)Y27.CB (T0288)L88.CB 9.9708 16.6180 21.6034 35.6819 Constraint (T0288)I62.CB (T0288)Y90.CB 11.7212 19.5354 25.3960 35.6059 Constraint (T0288)K6.CB (T0288)Q89.CB 10.2148 17.0247 22.1321 35.2995 Constraint (T0288)V3.CB (T0288)E80.CB 13.2827 22.1379 28.7792 35.1998 Constraint (T0288)V3.CB (T0288)P41.CB 13.0343 21.7238 28.2409 35.1997 Constraint (T0288)V7.CB (T0288)Y90.CB 11.4005 19.0009 24.7011 35.1996 Constraint (T0288)Q26.CB (T0288)V48.CB 12.3266 20.5444 26.7077 35.1903 Constraint (T0288)E69.CB (T0288)L88.CB 12.3681 20.6135 26.7976 34.8072 Constraint (T0288)D45.CB (T0288)Y90.CB 11.3864 18.9773 24.6705 34.7322 Constraint (T0288)A42.CB (T0288)Y90.CB 11.7227 19.5378 25.3992 34.5999 Constraint (T0288)K63.CB (T0288)Y90.CB 11.4963 19.1605 24.9087 34.4059 Constraint (T0288)T66.CB (T0288)L88.CB 12.0242 20.0403 26.0523 34.3368 Constraint (T0288)V3.CB (T0288)M73.CB 13.1911 21.9852 28.5808 34.2998 Constraint (T0288)T47.CB (T0288)L88.CB 8.6912 14.4853 18.8309 34.2997 Constraint (T0288)D12.CB (T0288)V68.CB 12.5523 20.9206 27.1968 34.2874 Constraint (T0288)M2.CB (T0288)V70.CB 12.3206 20.5343 26.6946 34.1998 Constraint (T0288)M2.CB (T0288)N58.CB 13.0685 21.7808 28.3151 34.1998 Constraint (T0288)F37.CB (T0288)R60.CB 12.9805 21.6341 28.1244 34.0882 Constraint (T0288)N39.CB (T0288)V70.CB 12.9552 21.5920 28.0696 33.9250 Constraint (T0288)V70.CB (T0288)Q89.CB 11.9300 19.8834 25.8484 33.8951 Constraint (T0288)Q35.CB (T0288)Y90.CB 11.8592 19.7654 25.6950 33.6059 Constraint (T0288)V3.CB (T0288)Q35.CB 12.9184 21.5307 27.9898 33.2998 Constraint (T0288)D12.CB (T0288)T55.CB 12.6004 21.0007 27.3010 33.2842 Constraint (T0288)K6.CB (T0288)Y90.CB 11.2410 18.7349 24.3554 33.1997 Constraint (T0288)A13.CB (T0288)I62.CB 12.6105 21.0174 27.3227 33.0928 Constraint (T0288)P29.CB (T0288)Q89.CB 10.5459 17.5765 22.8494 32.5818 Constraint (T0288)Q35.CB (T0288)S61.CB 13.3425 22.2374 28.9087 32.2036 Constraint (T0288)M2.CB (T0288)K65.CB 12.0755 20.1258 26.1636 32.1998 Constraint (T0288)V3.CB (T0288)P29.CB 11.2092 18.6820 24.2866 32.1998 Constraint (T0288)M2.CB (T0288)Y85.CB 6.4672 10.7786 14.0122 32.0998 Constraint (T0288)V3.CB (T0288)C28.CB 11.1859 18.6431 24.2361 32.0997 Constraint (T0288)I21.CB (T0288)Y90.CB 12.0855 20.1425 26.1853 32.0734 Constraint (T0288)C28.CB (T0288)V81.CB 12.6177 21.0294 27.3383 31.9771 Constraint (T0288)E53.CB (T0288)Y91.CB 7.9468 13.2447 17.2181 31.4116 Constraint (T0288)D52.CB (T0288)Y91.CB 7.9098 13.1830 17.1379 31.4116 Constraint (T0288)A49.CB (T0288)Y91.CB 8.0532 13.4220 17.4486 31.4116 Constraint (T0288)I33.CB (T0288)Y91.CB 9.8410 16.4016 21.3221 31.4116 Constraint (T0288)Y32.CB (T0288)Y91.CB 9.3004 15.5007 20.1509 31.4116 Constraint (T0288)M2.CB (T0288)K87.CB 4.5781 7.6302 9.9192 31.1998 Constraint (T0288)M2.CB (T0288)N86.CB 4.6501 7.7502 10.0752 31.1998 Constraint (T0288)N15.CB (T0288)S61.CB 12.7796 21.2993 27.6891 31.1963 Constraint (T0288)N15.CB (T0288)C30.CB 12.6989 21.1648 27.5142 31.1963 Constraint (T0288)K11.CB (T0288)C30.CB 12.7420 21.2367 27.6077 31.1936 Constraint (T0288)Y27.CB (T0288)V77.CB 12.8868 21.4779 27.9213 31.0929 Constraint (T0288)I19.CB (T0288)Y90.CB 12.1642 20.2736 26.3557 31.0734 Constraint (T0288)A13.CB (T0288)V68.CB 12.4860 20.8100 27.0530 30.9879 Constraint (T0288)Y27.CB (T0288)Q75.CB 11.7858 19.6431 25.5360 30.8000 Constraint (T0288)T55.CB (T0288)Y91.CB 10.0515 16.7524 21.7782 30.4117 Constraint (T0288)I54.CB (T0288)Y91.CB 10.2835 17.1392 22.2809 30.4117 Constraint (T0288)V3.CB (T0288)L88.CB 6.5386 10.8977 14.1670 30.2998 Constraint (T0288)M2.CB (T0288)T47.CB 9.0868 15.1447 19.6880 30.1999 Constraint (T0288)Q26.CB (T0288)E76.CB 12.2560 20.4266 26.5546 30.1997 Constraint (T0288)Q14.CB (T0288)Y85.CB 12.3400 20.5666 26.7366 30.0964 Constraint (T0288)Q26.CB (T0288)N58.CB 12.4826 20.8044 27.0457 29.9997 Constraint (T0288)K11.CB (T0288)K63.CB 12.9866 21.6444 28.1377 29.9995 Constraint (T0288)A49.CB (T0288)V68.CB 13.2946 22.1577 28.8050 29.9131 Constraint (T0288)A49.CB (T0288)K72.CB 13.4959 22.4932 29.2412 29.6100 Constraint (T0288)V48.CB (T0288)Y91.CB 10.1245 16.8741 21.9363 29.5380 Constraint (T0288)Y27.CB (T0288)E76.CB 12.3497 20.5828 26.7577 29.5011 Constraint (T0288)A50.CB (T0288)Y91.CB 8.7059 14.5098 18.8627 29.4117 Constraint (T0288)A25.CB (T0288)Q89.CB 10.0916 16.8193 21.8651 29.3938 Constraint (T0288)M2.CB (T0288)Q35.CB 12.5402 20.9003 27.1704 29.1998 Constraint (T0288)A13.CB (T0288)Y85.CB 12.0896 20.1494 26.1942 29.0964 Constraint (T0288)A13.CB (T0288)H84.CB 12.2202 20.3670 26.4771 29.0928 Constraint (T0288)K6.CB (T0288)T66.CB 13.4430 22.4050 29.1265 28.9998 Constraint (T0288)I17.CB (T0288)Y27.CB 12.8313 21.3855 27.8011 28.8000 Constraint (T0288)D38.CB (T0288)N86.CB 13.2324 22.0540 28.6702 28.6201 Constraint (T0288)K67.CB (T0288)Q89.CB 12.3462 20.5770 26.7501 28.5986 Constraint (T0288)V34.CB (T0288)Y91.CB 11.0578 18.4296 23.9585 28.4117 Constraint (T0288)C28.CB (T0288)Q89.CB 9.3512 15.5853 20.2608 28.3819 Constraint (T0288)V3.CB (T0288)S20.CB 13.2183 22.0304 28.6396 28.2997 Constraint (T0288)L44.CB (T0288)R60.CB 13.4192 22.3654 29.0750 28.2030 Constraint (T0288)M2.CB (T0288)A43.CB 12.6799 21.1331 27.4731 28.1998 Constraint (T0288)Q14.CB (T0288)H84.CB 12.5878 20.9796 27.2735 28.1929 Constraint (T0288)Y27.CB (T0288)V81.CB 12.9078 21.5130 27.9669 28.0893 Constraint (T0288)P4.CB (T0288)K72.CB 13.4230 22.3717 29.0832 27.9998 Constraint (T0288)C30.CB (T0288)E80.CB 13.0397 21.7328 28.2526 27.9272 Constraint (T0288)C28.CB (T0288)E76.CB 12.6196 21.0326 27.3424 27.7010 Constraint (T0288)Q26.CB (T0288)Q89.CB 10.1032 16.8387 21.8903 27.4938 Constraint (T0288)Q35.CB (T0288)Y91.CB 12.0888 20.1480 26.1924 27.4118 Constraint (T0288)V36.CB (T0288)Y91.CB 11.0668 18.4447 23.9781 27.4117 Constraint (T0288)P4.CB (T0288)Q89.CB 7.6024 12.6707 16.4719 27.2998 Constraint (T0288)P4.CB (T0288)Y27.CB 11.3815 18.9692 24.6599 27.0999 Constraint (T0288)C30.CB (T0288)Y91.CB 10.0593 16.7655 21.7951 27.0746 Constraint (T0288)P4.CB (T0288)K78.CB 12.9497 21.5828 28.0577 27.0000 Constraint (T0288)A13.CB (T0288)E69.CB 12.3234 20.5391 26.7008 26.9878 Constraint (T0288)L31.CB (T0288)Y91.CB 10.7916 17.9860 23.3818 26.4117 Constraint (T0288)D38.CB (T0288)K78.CB 11.9756 19.9592 25.9470 26.3500 Constraint (T0288)M2.CB (T0288)S20.CB 13.0080 21.6800 28.1840 26.1998 Constraint (T0288)Q14.CB (T0288)K65.CB 12.6857 21.1428 27.4857 26.1998 Constraint (T0288)Q26.CB (T0288)V36.CB 12.6683 21.1138 27.4480 26.1903 Constraint (T0288)P4.CB (T0288)E76.CB 13.2397 22.0661 28.6859 25.9998 Constraint (T0288)Y32.CB (T0288)K78.CB 13.2169 22.0282 28.6366 25.9963 Constraint (T0288)N39.CB (T0288)H84.CB 13.3161 22.1935 28.8516 25.8353 Constraint (T0288)A43.CB (T0288)Y90.CB 11.6745 19.4574 25.2947 25.7323 Constraint (T0288)C28.CB (T0288)Y90.CB 10.6588 17.7647 23.0941 25.3880 Constraint (T0288)A25.CB (T0288)T82.CB 12.6446 21.0744 27.3967 25.2894 Constraint (T0288)D38.CB (T0288)H84.CB 13.2737 22.1228 28.7596 25.2024 Constraint (T0288)P4.CB (T0288)Y90.CB 8.5935 14.3225 18.6193 25.1999 Constraint (T0288)V7.CB (T0288)Y91.CB 10.7950 17.9916 23.3891 25.0997 Constraint (T0288)C28.CB (T0288)V77.CB 12.6086 21.0144 27.3187 24.9878 Constraint (T0288)I74.CB (T0288)Q89.CB 12.8441 21.4068 27.8289 24.9081 Constraint (T0288)L16.CB (T0288)K63.CB 12.8738 21.4564 27.8933 24.4209 Constraint (T0288)Y27.CB (T0288)V36.CB 12.1128 20.1881 26.2445 24.3907 Constraint (T0288)K63.CB (T0288)Y91.CB 11.5714 19.2857 25.0714 24.3117 Constraint (T0288)T47.CB (T0288)Q89.CB 9.9805 16.6341 21.6243 24.2997 Constraint (T0288)D12.CB (T0288)E53.CB 12.6033 21.0056 27.3072 24.2963 Constraint (T0288)K65.CB (T0288)Q89.CB 12.2013 20.3354 26.4360 24.2032 Constraint (T0288)M2.CB (T0288)L88.CB 5.7256 9.5426 12.4054 24.1999 Constraint (T0288)M2.CB (T0288)P29.CB 10.8851 18.1418 23.5843 24.1999 Constraint (T0288)S1.CB (T0288)T55.CB 8.9865 14.9775 19.4708 23.9999 Constraint (T0288)S1.CB (T0288)I54.CB 10.5976 17.6627 22.9615 23.9999 Constraint (T0288)S1.CB (T0288)E53.CB 8.4537 14.0895 18.3163 23.9999 Constraint (T0288)S1.CB (T0288)D52.CB 8.0739 13.4565 17.4935 23.9999 Constraint (T0288)S1.CB (T0288)A50.CB 10.6876 17.8127 23.1565 23.9999 Constraint (T0288)S1.CB (T0288)A49.CB 8.5079 14.1799 18.4339 23.9999 Constraint (T0288)S1.CB (T0288)V48.CB 10.2064 17.0107 22.1139 23.9999 Constraint (T0288)S1.CB (T0288)I33.CB 10.7109 17.8516 23.2070 23.9999 Constraint (T0288)S1.CB (T0288)Y32.CB 10.7703 17.9506 23.3357 23.9999 Constraint (T0288)V68.CB (T0288)L88.CB 12.8595 21.4325 27.8622 23.6758 Constraint (T0288)P29.CB (T0288)Y90.CB 11.0678 18.4463 23.9802 23.5880 Constraint (T0288)I62.CB (T0288)Y91.CB 11.5381 19.2302 24.9993 23.4117 Constraint (T0288)T8.CB (T0288)Q89.CB 11.8923 19.8205 25.7667 23.2937 Constraint (T0288)M2.CB (T0288)C28.CB 10.5034 17.5057 22.7575 23.0998 Constraint (T0288)L9.CB (T0288)P29.CB 12.4322 20.7203 26.9364 23.0939 Constraint (T0288)S1.CB (T0288)K63.CB 11.0606 18.4343 23.9646 22.9999 Constraint (T0288)I21.CB (T0288)Y91.CB 11.8777 19.7962 25.7351 22.9734 Constraint (T0288)N39.CB (T0288)E53.CB 12.9496 21.5826 28.0574 22.8248 Constraint (T0288)S61.CB (T0288)Y90.CB 11.3457 18.9094 24.5823 22.5263 Constraint (T0288)V57.CB (T0288)Y90.CB 11.6009 19.3348 25.1352 22.4000 Constraint (T0288)A25.CB (T0288)Y90.CB 10.1551 16.9252 22.0028 22.3938 Constraint (T0288)T47.CB (T0288)Y90.CB 10.8874 18.1456 23.5893 22.1998 Constraint (T0288)Y27.CB (T0288)A42.CB 12.6151 21.0251 27.3327 22.1906 Constraint (T0288)S20.CB (T0288)Y90.CB 12.4843 20.8072 27.0493 22.0735 Constraint (T0288)S1.CB (T0288)I62.CB 12.3169 20.5281 26.6865 21.9999 Constraint (T0288)I19.CB (T0288)Y91.CB 11.8194 19.6990 25.6088 21.9734 Constraint (T0288)N39.CB (T0288)M73.CB 13.2175 22.0292 28.6380 21.9254 Constraint (T0288)Y27.CB (T0288)Q89.CB 10.4325 17.3874 22.6037 21.3820 Constraint (T0288)L9.CB (T0288)Q89.CB 12.1411 20.2351 26.3056 21.2936 Constraint (T0288)Q26.CB (T0288)V77.CB 12.6851 21.1419 27.4845 21.1998 Constraint (T0288)P4.CB (T0288)Y91.CB 8.9793 14.9654 19.4551 21.0999 Constraint (T0288)D12.CB (T0288)K65.CB 12.7764 21.2940 27.6822 21.0998 Constraint (T0288)K6.CB (T0288)Y91.CB 10.3917 17.3195 22.5154 21.0997 Constraint (T0288)T8.CB (T0288)P29.CB 12.5358 20.8930 27.1609 21.0938 Constraint (T0288)D12.CB (T0288)S61.CB 12.5359 20.8932 27.1612 21.0878 Constraint (T0288)A13.CB (T0288)Y32.CB 12.2553 20.4255 26.5531 21.0808 Constraint (T0288)T47.CB (T0288)K72.CB 13.2907 22.1511 28.7964 21.0000 Constraint (T0288)S1.CB (T0288)S61.CB 12.2611 20.4352 26.5657 20.9999 Constraint (T0288)T66.CB (T0288)E80.CB 13.5945 22.6575 29.4547 20.9999 Constraint (T0288)P4.CB (T0288)Q75.CB 13.4393 22.3989 29.1185 20.9998 Constraint (T0288)D45.CB (T0288)Y91.CB 10.7089 17.8482 23.2027 20.5380 Constraint (T0288)A42.CB (T0288)Y91.CB 11.3223 18.8704 24.5315 20.4118 Constraint (T0288)V7.CB (T0288)A25.CB 12.9944 21.6574 28.1546 20.1998 Constraint (T0288)V7.CB (T0288)Y27.CB 13.1986 21.9976 28.5969 20.0999 Constraint (T0288)S1.CB (T0288)L31.CB 12.1572 20.2620 26.3406 19.9999 Constraint (T0288)S1.CB (T0288)H84.CB 8.9077 14.8461 19.3000 19.9999 Constraint (T0288)S1.CB (T0288)I83.CB 10.7441 17.9069 23.2789 19.9999 Constraint (T0288)S1.CB (T0288)A42.CB 12.3147 20.5246 26.6819 19.9999 Constraint (T0288)S1.CB (T0288)V36.CB 12.0214 20.0356 26.0463 19.9999 Constraint (T0288)V34.CB (T0288)K78.CB 13.0780 21.7966 28.3356 19.9963 Constraint (T0288)A13.CB (T0288)K67.CB 12.4174 20.6957 26.9044 19.9879 Constraint (T0288)Q26.CB (T0288)A42.CB 13.1046 21.8411 28.3934 19.7997 Constraint (T0288)L44.CB (T0288)Q89.CB 11.8901 19.8168 25.7618 19.2405 Constraint (T0288)A43.CB (T0288)K65.CB 13.5637 22.6062 29.3880 19.2031 Constraint (T0288)N15.CB (T0288)A25.CB 12.6369 21.0615 27.3800 19.1963 Constraint (T0288)M2.CB (T0288)Q26.CB 10.8518 18.0863 23.5121 19.0998 Constraint (T0288)Q10.CB (T0288)V68.CB 12.4639 20.7731 27.0051 19.0938 Constraint (T0288)Q26.CB (T0288)V81.CB 12.8234 21.3724 27.7841 18.9998 Constraint (T0288)Y27.CB (T0288)T82.CB 12.8297 21.3828 27.7977 18.9773 Constraint (T0288)I17.CB (T0288)Q26.CB 12.8288 21.3814 27.7958 18.8001 Constraint (T0288)V57.CB (T0288)Y91.CB 12.1089 20.1815 26.2360 18.4117 Constraint (T0288)D12.CB (T0288)K87.CB 13.0458 21.7430 28.2659 18.1999 Constraint (T0288)M2.CB (T0288)Y27.CB 11.8064 19.6773 25.5805 18.1999 Constraint (T0288)P29.CB (T0288)T47.CB 12.7661 21.2769 27.6600 18.1999 Constraint (T0288)T47.CB (T0288)Y91.CB 10.9387 18.2311 23.7005 18.0998 Constraint (T0288)V77.CB (T0288)L88.CB 13.1273 21.8789 28.4425 18.0130 Constraint (T0288)S1.CB (T0288)T82.CB 11.7764 19.6273 25.5155 18.0000 Constraint (T0288)S1.CB (T0288)C30.CB 10.6738 17.7897 23.1266 17.9999 Constraint (T0288)S1.CB (T0288)D45.CB 10.8740 18.1233 23.5603 17.9999 Constraint (T0288)S1.CB (T0288)I19.CB 12.6622 21.1036 27.4347 17.9999 Constraint (T0288)S20.CB (T0288)Y91.CB 12.3640 20.6067 26.7887 17.9735 Constraint (T0288)A49.CB (T0288)K78.CB 13.2161 22.0268 28.6348 17.7438 Constraint (T0288)L44.CB (T0288)Y90.CB 12.0661 20.1102 26.1432 17.7326 Constraint (T0288)A43.CB (T0288)Y91.CB 11.2544 18.7574 24.3846 17.4118 Constraint (T0288)Q26.CB (T0288)Y90.CB 9.9057 16.5096 21.4624 17.3939 Constraint (T0288)F37.CB (T0288)Q89.CB 12.3649 20.6081 26.7906 17.3404 Constraint (T0288)V3.CB (T0288)Q89.CB 5.9069 9.8448 12.7983 17.2999 Constraint (T0288)L16.CB (T0288)P29.CB 12.9514 21.5857 28.0614 17.2012 Constraint (T0288)M2.CB (T0288)I17.CB 13.1100 21.8500 28.4050 17.1999 Constraint (T0288)P41.CB (T0288)Q89.CB 12.1629 20.2715 26.3530 17.0344 Constraint (T0288)K6.CB (T0288)Y27.CB 13.0275 21.7126 28.2263 16.9999 Constraint (T0288)S1.CB (T0288)V57.CB 12.6336 21.0560 27.3728 16.9999 Constraint (T0288)V3.CB (T0288)V77.CB 13.2258 22.0430 28.6559 16.9998 Constraint (T0288)I17.CB (T0288)Q89.CB 12.5447 20.9078 27.1801 16.9733 Constraint (T0288)V70.CB (T0288)Y90.CB 11.7885 19.6474 25.5416 16.6000 Constraint (T0288)L44.CB (T0288)Y91.CB 12.2850 20.4750 26.6176 16.5381 Constraint (T0288)S61.CB (T0288)Y91.CB 12.0182 20.0303 26.0394 16.4380 Constraint (T0288)V3.CB (T0288)Y90.CB 7.1107 11.8511 15.4064 16.1999 Constraint (T0288)V3.CB (T0288)Y27.CB 11.7397 19.5661 25.4360 16.0999 Constraint (T0288)Q10.CB (T0288)K63.CB 12.2321 20.3868 26.5028 16.0999 Constraint (T0288)T8.CB (T0288)Y91.CB 12.1423 20.2372 26.3084 16.0999 Constraint (T0288)V3.CB (T0288)A25.CB 12.1916 20.3193 26.4151 16.0998 Constraint (T0288)V3.CB (T0288)K67.CB 13.3704 22.2840 28.9692 16.0998 Constraint (T0288)L16.CB (T0288)A25.CB 13.0375 21.7291 28.2479 16.0997 Constraint (T0288)L9.CB (T0288)Y91.CB 12.4302 20.7169 26.9320 16.0997 Constraint (T0288)A13.CB (T0288)K65.CB 12.6555 21.0925 27.4203 16.0000 Constraint (T0288)S1.CB (T0288)Y85.CB 7.4026 12.3377 16.0390 16.0000 Constraint (T0288)V7.CB (T0288)Q26.CB 12.6584 21.0974 27.4266 15.9996 Constraint (T0288)A43.CB (T0288)V68.CB 13.3879 22.3132 29.0071 15.9254 Constraint (T0288)D38.CB (T0288)M73.CB 13.0131 21.6885 28.1950 15.9253 Constraint (T0288)Q75.CB (T0288)K87.CB 13.2673 22.1122 28.7459 15.8759 Constraint (T0288)A25.CB (T0288)F37.CB 12.9105 21.5174 27.9726 15.6895 Constraint (T0288)C28.CB (T0288)Y91.CB 10.7789 17.9648 23.3543 15.4011 Constraint (T0288)Q26.CB (T0288)Y91.CB 11.6862 19.4770 25.3201 15.4010 Constraint (T0288)A25.CB (T0288)Y91.CB 11.6602 19.4337 25.2639 15.4010 Constraint (T0288)I54.CB (T0288)K92.CB 11.8457 19.7428 25.6656 15.3106 Constraint (T0288)E53.CB (T0288)K92.CB 9.1047 15.1745 19.7268 15.3106 Constraint (T0288)D52.CB (T0288)K92.CB 9.7466 16.2443 21.1176 15.3106 Constraint (T0288)L31.CB (T0288)K92.CB 12.3275 20.5458 26.7095 15.3106 Constraint (T0288)T8.CB (T0288)Y90.CB 12.0915 20.1525 26.1982 15.1999 Constraint (T0288)M2.CB (T0288)I74.CB 12.8764 21.4607 27.8990 15.1998 Constraint (T0288)N39.CB (T0288)L88.CB 12.9157 21.5262 27.9840 15.1390 Constraint (T0288)L44.CB (T0288)K67.CB 13.1040 21.8399 28.3919 15.1005 Constraint (T0288)Q10.CB (T0288)C30.CB 11.4406 19.0677 24.7880 15.0939 Constraint (T0288)Q10.CB (T0288)L88.CB 12.2050 20.3417 26.4442 15.0938 Constraint (T0288)S1.CB (T0288)K87.CB 5.8095 9.6825 12.5872 15.0000 Constraint (T0288)S1.CB (T0288)N86.CB 6.2050 10.3416 13.4441 15.0000 Constraint (T0288)S1.CB (T0288)V34.CB 12.3642 20.6070 26.7891 14.9999 Constraint (T0288)P4.CB (T0288)F37.CB 13.4949 22.4915 29.2390 14.9999 Constraint (T0288)A43.CB (T0288)R60.CB 13.1176 21.8627 28.4215 14.9999 Constraint (T0288)Q26.CB (T0288)T82.CB 12.8692 21.4486 27.8832 14.9892 Constraint (T0288)T40.CB (T0288)Q89.CB 12.2319 20.3865 26.5025 14.9392 Constraint (T0288)R60.CB (T0288)Q89.CB 12.0835 20.1391 26.1808 14.9285 Constraint (T0288)L16.CB (T0288)L88.CB 13.0998 21.8331 28.3830 14.8735 Constraint (T0288)N39.CB (T0288)K67.CB 13.2233 22.0388 28.6505 14.7219 Constraint (T0288)Y27.CB (T0288)Y90.CB 10.7024 17.8373 23.1885 14.5881 Constraint (T0288)P29.CB (T0288)Y91.CB 10.4749 17.4581 22.6955 14.5011 Constraint (T0288)P29.CB (T0288)D45.CB 12.8620 21.4367 27.8677 14.3906 Constraint (T0288)P41.CB (T0288)T66.CB 13.4241 22.3736 29.0856 14.3246 Constraint (T0288)A50.CB (T0288)K92.CB 10.2519 17.0864 22.2124 14.3106 Constraint (T0288)A49.CB (T0288)K92.CB 10.0469 16.7448 21.7683 14.3106 Constraint (T0288)I33.CB (T0288)K92.CB 11.1853 18.6422 24.2349 14.3106 Constraint (T0288)N39.CB (T0288)E76.CB 13.1137 21.8562 28.4130 14.2145 Constraint (T0288)L44.CB (T0288)K72.CB 13.1967 21.9945 28.5929 14.2039 Constraint (T0288)M2.CB (T0288)A25.CB 11.4466 19.0777 24.8010 14.1999 Constraint (T0288)M2.CB (T0288)K67.CB 12.7254 21.2090 27.5718 14.1998 Constraint (T0288)V3.CB (T0288)Y91.CB 7.9785 13.2975 17.2868 14.0999 Constraint (T0288)N15.CB (T0288)N86.CB 13.3021 22.1702 28.8213 14.0999 Constraint (T0288)K6.CB (T0288)A25.CB 13.1179 21.8631 28.4221 14.0998 Constraint (T0288)T8.CB (T0288)V68.CB 12.8970 21.4950 27.9435 14.0940 Constraint (T0288)D12.CB (T0288)N86.CB 12.9849 21.6416 28.1340 14.0939 Constraint (T0288)S1.CB (T0288)T47.CB 9.4147 15.6911 20.3984 14.0000 Constraint (T0288)V3.CB (T0288)Q26.CB 9.9809 16.6349 21.6253 13.9998 Constraint (T0288)A13.CB (T0288)S61.CB 12.6092 21.0153 27.3198 13.9808 Constraint (T0288)A13.CB (T0288)T55.CB 12.2305 20.3841 26.4994 13.9808 Constraint (T0288)Y32.CB (T0288)K92.CB 9.9042 16.5071 21.4592 13.9736 Constraint (T0288)D38.CB (T0288)Q89.CB 11.8200 19.7000 25.6100 13.9394 Constraint (T0288)K65.CB (T0288)Y90.CB 12.6273 21.0456 27.3592 13.8021 Constraint (T0288)T82.CB (T0288)Y91.CB 11.4068 19.0113 24.7147 13.4119 Constraint (T0288)V70.CB (T0288)Y91.CB 12.0545 20.0908 26.1180 13.4118 Constraint (T0288)D38.CB (T0288)Y90.CB 12.6763 21.1271 27.4652 13.3384 Constraint (T0288)T66.CB (T0288)Q89.CB 13.1583 21.9304 28.5096 13.3308 Constraint (T0288)T55.CB (T0288)K92.CB 10.8936 18.1560 23.6028 13.3106 Constraint (T0288)M2.CB (T0288)Q89.CB 5.8940 9.8234 12.7704 13.1999 Constraint (T0288)N15.CB (T0288)K63.CB 12.8357 21.3928 27.8106 13.1963 Constraint (T0288)P4.CB (T0288)K92.CB 10.1805 16.9675 22.0578 13.0999 Constraint (T0288)K72.CB (T0288)L88.CB 13.1092 21.8487 28.4033 13.0130 Constraint (T0288)S1.CB (T0288)L88.CB 7.0746 11.7910 15.3283 13.0000 Constraint (T0288)S1.CB (T0288)I21.CB 12.6202 21.0337 27.3438 12.9999 Constraint (T0288)P41.CB (T0288)Y90.CB 11.9057 19.8429 25.7958 12.5265 Constraint (T0288)R60.CB (T0288)Y90.CB 12.0826 20.1376 26.1789 12.5265 Constraint (T0288)L9.CB (T0288)Y90.CB 12.5534 20.9224 27.1991 12.1999 Constraint (T0288)M2.CB (T0288)Y90.CB 6.7326 11.2209 14.5872 12.0999 Constraint (T0288)T8.CB (T0288)T66.CB 12.7857 21.3095 27.7023 12.0940 Constraint (T0288)V3.CB (T0288)T40.CB 13.4838 22.4730 29.2149 11.9998 Constraint (T0288)K6.CB (T0288)Q26.CB 12.2814 20.4690 26.6097 11.9998 Constraint (T0288)Q14.CB (T0288)S61.CB 13.1567 21.9279 28.5062 11.9929 Constraint (T0288)Q14.CB (T0288)T55.CB 12.7087 21.1812 27.5355 11.9929 Constraint (T0288)A13.CB (T0288)T66.CB 12.7722 21.2870 27.6731 11.9879 Constraint (T0288)I17.CB (T0288)Y91.CB 13.1484 21.9141 28.4883 11.9734 Constraint (T0288)N58.CB (T0288)Q89.CB 11.3039 18.8399 24.4918 11.8012 Constraint (T0288)F37.CB (T0288)Y90.CB 12.6418 21.0696 27.3905 11.7394 Constraint (T0288)A71.CB (T0288)Q89.CB 13.0126 21.6876 28.1939 11.7068 Constraint (T0288)K67.CB (T0288)Y90.CB 12.1406 20.2343 26.3045 11.6047 Constraint (T0288)N58.CB (T0288)Y90.CB 11.3799 18.9666 24.6565 11.4002 Constraint (T0288)V68.CB (T0288)K87.CB 12.9317 21.5528 28.0187 11.3689 Constraint (T0288)V34.CB (T0288)K92.CB 11.4776 19.1293 24.8681 11.3106 Constraint (T0288)N15.CB (T0288)K87.CB 13.2361 22.0602 28.6783 11.1999 Constraint (T0288)C28.CB (T0288)F37.CB 13.3574 22.2623 28.9410 11.1000 Constraint (T0288)S1.CB (T0288)L44.CB 12.1650 20.2749 26.3574 11.0000 Constraint (T0288)S1.CB (T0288)A43.CB 11.7775 19.6292 25.5179 11.0000 Constraint (T0288)S1.CB (T0288)Q35.CB 12.8418 21.4030 27.8239 10.9999 Constraint (T0288)M2.CB (T0288)L44.CB 12.5184 20.8641 27.1233 10.9998 Constraint (T0288)K11.CB (T0288)L88.CB 12.9696 21.6159 28.1007 10.9939 Constraint (T0288)T8.CB (T0288)C28.CB 12.7538 21.2563 27.6332 10.9939 Constraint (T0288)A13.CB (T0288)E53.CB 11.8419 19.7364 25.6574 10.9929 Constraint (T0288)C30.CB (T0288)K92.CB 9.9912 16.6520 21.6476 10.9735 Constraint (T0288)K67.CB (T0288)Y91.CB 12.0305 20.0508 26.0660 10.9107 Constraint (T0288)D38.CB (T0288)I62.CB 12.6061 21.0101 27.3131 10.3149 Constraint (T0288)D38.CB (T0288)N58.CB 11.8738 19.7897 25.7266 10.2024 Constraint (T0288)D38.CB (T0288)Y91.CB 12.3678 20.6130 26.7969 10.1370 Constraint (T0288)V81.CB (T0288)Y90.CB 11.0251 18.3752 23.8878 10.1253 Constraint (T0288)Y27.CB (T0288)F37.CB 13.0523 21.7538 28.2799 10.1000 Constraint (T0288)Q10.CB (T0288)T66.CB 12.3759 20.6266 26.8146 10.0939 Constraint (T0288)N39.CB (T0288)N58.CB 11.9980 19.9966 25.9956 10.0109 Constraint (T0288)P29.CB (T0288)A43.CB 13.0896 21.8159 28.3607 10.0000 Constraint (T0288)P29.CB (T0288)T40.CB 13.1334 21.8889 28.4556 10.0000 Constraint (T0288)L16.CB (T0288)Y27.CB 13.2782 22.1304 28.7695 10.0000 Constraint (T0288)M2.CB (T0288)Y91.CB 7.0930 11.8217 15.3683 10.0000 Constraint (T0288)C30.CB (T0288)K78.CB 13.0744 21.7906 28.3278 9.9965 Constraint (T0288)L9.CB (T0288)C28.CB 12.0562 20.0936 26.1217 9.9939 Constraint (T0288)A43.CB (T0288)E69.CB 12.9385 21.5641 28.0333 9.9254 Constraint (T0288)E69.CB (T0288)Y90.CB 12.6403 21.0671 27.3873 9.4061 Constraint (T0288)Y27.CB (T0288)Y91.CB 11.8895 19.8159 25.7607 9.4011 Constraint (T0288)V36.CB (T0288)K92.CB 11.9673 19.9456 25.9292 9.3106 Constraint (T0288)Q14.CB (T0288)E53.CB 11.6794 19.4657 25.3054 9.1929 Constraint (T0288)E53.CB (T0288)V93.CB 9.8071 16.3451 21.2487 9.1000 Constraint (T0288)D52.CB (T0288)V93.CB 10.4414 17.4024 22.6231 9.1000 Constraint (T0288)A50.CB (T0288)V93.CB 11.0014 18.3357 23.8365 9.1000 Constraint (T0288)A49.CB (T0288)V93.CB 10.9388 18.2314 23.7008 9.1000 Constraint (T0288)Y32.CB (T0288)V93.CB 10.4983 17.4971 22.7463 9.1000 Constraint (T0288)P29.CB (T0288)K92.CB 11.2927 18.8211 24.4674 9.0999 Constraint (T0288)V3.CB (T0288)K92.CB 9.6017 16.0029 20.8038 9.0999 Constraint (T0288)D12.CB (T0288)T66.CB 11.8621 19.7702 25.7013 9.0879 Constraint (T0288)V81.CB (T0288)Y91.CB 11.7530 19.5883 25.4647 9.0108 Constraint (T0288)M73.CB (T0288)Y90.CB 12.3246 20.5410 26.7033 9.0051 Constraint (T0288)Q26.CB (T0288)T47.CB 12.7946 21.3243 27.7215 9.0000 Constraint (T0288)T47.CB (T0288)E69.CB 13.4221 22.3701 29.0811 9.0000 Constraint (T0288)S1.CB (T0288)R60.CB 13.3131 22.1886 28.8452 9.0000 Constraint (T0288)S1.CB (T0288)V81.CB 12.6784 21.1307 27.4699 9.0000 Constraint (T0288)S1.CB (T0288)P29.CB 12.4753 20.7922 27.0299 9.0000 Constraint (T0288)C28.CB (T0288)T47.CB 12.8164 21.3607 27.7689 9.0000 Constraint (T0288)S1.CB (T0288)K65.CB 13.2936 22.1560 28.8028 8.9999 Constraint (T0288)M2.CB (T0288)P41.CB 13.0034 21.6723 28.1740 8.9998 Constraint (T0288)K11.CB (T0288)P29.CB 11.9489 19.9148 25.8892 8.9939 Constraint (T0288)P29.CB (T0288)P41.CB 13.1585 21.9309 28.5101 8.9879 Constraint (T0288)K63.CB (T0288)K92.CB 10.6695 17.7826 23.1173 8.8736 Constraint (T0288)M73.CB (T0288)Q89.CB 11.9985 19.9975 25.9967 8.8083 Constraint (T0288)K78.CB (T0288)K87.CB 13.1960 21.9933 28.5913 8.7347 Constraint (T0288)I74.CB (T0288)Y90.CB 11.9433 19.9056 25.8772 8.5395 Constraint (T0288)V48.CB (T0288)K92.CB 11.1381 18.5635 24.1326 8.4369 Constraint (T0288)K65.CB (T0288)Y91.CB 12.3542 20.5904 26.7675 8.4010 Constraint (T0288)N39.CB (T0288)Q89.CB 12.2369 20.3948 26.5133 8.3405 Constraint (T0288)T40.CB (T0288)Y90.CB 11.8810 19.8016 25.7421 8.3385 Constraint (T0288)Q35.CB (T0288)K92.CB 12.2417 20.4028 26.5237 8.3106 Constraint (T0288)N39.CB (T0288)I62.CB 13.1091 21.8485 28.4030 8.2144 Constraint (T0288)D38.CB (T0288)E76.CB 12.5660 20.9433 27.2263 8.2144 Constraint (T0288)D38.CB (T0288)K72.CB 12.5093 20.8488 27.1035 8.2144 Constraint (T0288)D45.CB (T0288)V68.CB 12.7193 21.1989 27.5585 8.2040 Constraint (T0288)N15.CB (T0288)P29.CB 12.8128 21.3546 27.7610 8.1965 Constraint (T0288)F37.CB (T0288)Y91.CB 12.1940 20.3233 26.4203 8.1370 Constraint (T0288)E80.CB (T0288)Y90.CB 11.3923 18.9872 24.6834 8.1253 Constraint (T0288)D12.CB (T0288)C30.CB 12.1393 20.2322 26.3019 8.0844 Constraint (T0288)S1.CB (T0288)N58.CB 12.9434 21.5723 28.0440 8.0000 Constraint (T0288)C28.CB (T0288)K92.CB 11.1456 18.5761 24.1489 8.0000 Constraint (T0288)L9.CB (T0288)A25.CB 13.2105 22.0175 28.6228 8.0000 Constraint (T0288)Q14.CB (T0288)T66.CB 12.2685 20.4475 26.5817 8.0000 Constraint (T0288)Q26.CB (T0288)K92.CB 12.0971 20.1619 26.2105 7.9999 Constraint (T0288)A25.CB (T0288)T40.CB 13.4228 22.3714 29.0828 7.9894 Constraint (T0288)I21.CB (T0288)K92.CB 12.5929 20.9882 27.2847 7.9736 Constraint (T0288)E69.CB (T0288)Q89.CB 12.2153 20.3589 26.4665 7.8083 Constraint (T0288)L16.CB (T0288)Q26.CB 13.1873 21.9789 28.5725 7.7001 Constraint (T0288)K72.CB (T0288)K87.CB 12.8732 21.4554 27.8920 7.6688 Constraint (T0288)M2.CB (T0288)M73.CB 12.1124 20.1873 26.2435 7.1999 Constraint (T0288)V34.CB (T0288)V93.CB 11.6683 19.4472 25.2813 7.1000 Constraint (T0288)I33.CB (T0288)V93.CB 10.9555 18.2591 23.7369 7.1000 Constraint (T0288)K6.CB (T0288)K92.CB 10.4102 17.3504 22.5555 7.0999 Constraint (T0288)N15.CB (T0288)Q26.CB 11.8754 19.7924 25.7301 7.0965 Constraint (T0288)Q10.CB (T0288)Q89.CB 12.6763 21.1272 27.4654 7.0940 Constraint (T0288)I17.CB (T0288)Y90.CB 12.4419 20.7365 26.9574 7.0737 Constraint (T0288)Q75.CB (T0288)L88.CB 13.2948 22.1581 28.8055 7.0130 Constraint (T0288)Y27.CB (T0288)T40.CB 13.6564 22.7607 29.5889 7.0000 Constraint (T0288)K6.CB (T0288)V68.CB 13.4738 22.4563 29.1932 7.0000 Constraint (T0288)C28.CB (T0288)V93.CB 11.4355 19.0592 24.7770 7.0000 Constraint (T0288)Q26.CB (T0288)V93.CB 12.1995 20.3326 26.4323 7.0000 Constraint (T0288)S1.CB (T0288)P41.CB 13.0024 21.6707 28.1719 7.0000 Constraint (T0288)M2.CB (T0288)E69.CB 12.5058 20.8430 27.0959 6.9999 Constraint (T0288)M2.CB (T0288)T66.CB 12.3850 20.6416 26.8341 6.9999 Constraint (T0288)M2.CB (T0288)T40.CB 13.2425 22.0708 28.6920 6.9999 Constraint (T0288)P4.CB (T0288)L16.CB 13.3950 22.3251 29.0226 6.9998 Constraint (T0288)A13.CB (T0288)N86.CB 12.5318 20.8864 27.1523 6.9964 Constraint (T0288)L9.CB (T0288)Y27.CB 12.9876 21.6460 28.1398 6.9940 Constraint (T0288)P29.CB (T0288)E80.CB 13.3100 22.1833 28.8383 6.9894 Constraint (T0288)P41.CB (T0288)Y91.CB 10.6933 17.8222 23.1689 6.5383 Constraint (T0288)R60.CB (T0288)Y91.CB 11.7115 19.5192 25.3749 6.4383 Constraint (T0288)E80.CB (T0288)Q89.CB 10.8427 18.0711 23.4924 6.4073 Constraint (T0288)A25.CB (T0288)D45.CB 12.5200 20.8666 27.1266 6.3906 Constraint (T0288)T40.CB (T0288)T66.CB 13.4308 22.3846 29.1000 6.3370 Constraint (T0288)T66.CB (T0288)Y91.CB 12.7804 21.3006 27.6908 6.3370 Constraint (T0288)N58.CB (T0288)Y91.CB 11.3150 18.8583 24.5158 6.3120 Constraint (T0288)I83.CB (T0288)K92.CB 11.2477 18.7461 24.3700 6.3107 Constraint (T0288)C30.CB (T0288)L44.CB 12.9784 21.6307 28.1199 6.2933 Constraint (T0288)N39.CB (T0288)Y90.CB 12.6791 21.1319 27.4714 6.1385 Constraint (T0288)A71.CB (T0288)Y90.CB 12.6704 21.1173 27.4525 6.1383 Constraint (T0288)F37.CB (T0288)K63.CB 13.0587 21.7645 28.2939 6.1114 Constraint (T0288)L16.CB (T0288)C28.CB 12.9642 21.6070 28.0891 6.1011 Constraint (T0288)V7.CB (T0288)K92.CB 11.1934 18.6557 24.2525 6.0999 Constraint (T0288)N15.CB (T0288)Y27.CB 11.5678 19.2797 25.0636 6.0965 Constraint (T0288)S1.CB (T0288)Q89.CB 6.6883 11.1471 14.4913 6.0000 Constraint (T0288)S1.CB (T0288)E80.CB 13.4669 22.4449 29.1784 6.0000 Constraint (T0288)S1.CB (T0288)S20.CB 13.5338 22.5563 29.3232 6.0000 Constraint (T0288)M2.CB (T0288)K92.CB 9.0477 15.0795 19.6033 6.0000 Constraint (T0288)T40.CB (T0288)S61.CB 13.1856 21.9760 28.5688 6.0000 Constraint (T0288)S1.CB (T0288)C28.CB 11.3785 18.9642 24.6534 5.9999 Constraint (T0288)A50.CB (T0288)E76.CB 13.5924 22.6540 29.4502 5.9999 Constraint (T0288)V3.CB (T0288)T66.CB 13.5955 22.6591 29.4569 5.9999 Constraint (T0288)M2.CB (T0288)V77.CB 13.2736 22.1227 28.7595 5.9999 Constraint (T0288)N39.CB (T0288)R60.CB 13.0426 21.7376 28.2589 5.9999 Constraint (T0288)D38.CB (T0288)R60.CB 12.9651 21.6085 28.0910 5.9999 Constraint (T0288)F37.CB (T0288)S61.CB 13.0846 21.8076 28.3499 5.9999 Constraint (T0288)A49.CB (T0288)E76.CB 13.5749 22.6248 29.4122 5.9998 Constraint (T0288)Q14.CB (T0288)C30.CB 11.8493 19.7488 25.6735 5.9929 Constraint (T0288)A25.CB (T0288)A43.CB 12.1731 20.2885 26.3750 5.9894 Constraint (T0288)I19.CB (T0288)K92.CB 12.5396 20.8994 27.1692 5.9736 Constraint (T0288)M73.CB (T0288)Y91.CB 12.0038 20.0063 26.0081 5.3120 Constraint (T0288)E69.CB (T0288)Y91.CB 12.4790 20.7984 27.0379 5.3120 Constraint (T0288)I62.CB (T0288)K92.CB 10.9151 18.1918 23.6493 5.3107 Constraint (T0288)N39.CB (T0288)K72.CB 12.7272 21.2120 27.5755 5.2145 Constraint (T0288)N39.CB (T0288)V68.CB 13.4446 22.4077 29.1300 5.2145 Constraint (T0288)N39.CB (T0288)T55.CB 13.0924 21.8207 28.3669 5.2145 Constraint (T0288)D38.CB (T0288)V68.CB 12.0854 20.1424 26.1851 5.2145 Constraint (T0288)D38.CB (T0288)T55.CB 12.5133 20.8555 27.1121 5.2145 Constraint (T0288)T40.CB (T0288)Y91.CB 10.9946 18.3243 23.8215 5.1370 Constraint (T0288)Q35.CB (T0288)V93.CB 12.1892 20.3153 26.4098 5.1000 Constraint (T0288)T8.CB (T0288)A25.CB 13.2969 22.1615 28.8099 5.1000 Constraint (T0288)V48.CB (T0288)V93.CB 11.3496 18.9159 24.5907 5.1000 Constraint (T0288)L31.CB (T0288)V93.CB 10.3645 17.2742 22.4565 5.1000 Constraint (T0288)C30.CB (T0288)V93.CB 8.7606 14.6009 18.9812 5.1000 Constraint (T0288)I21.CB (T0288)V93.CB 11.9197 19.8661 25.8260 5.1000 Constraint (T0288)S20.CB (T0288)V93.CB 13.2487 22.0811 28.7055 5.1000 Constraint (T0288)P4.CB (T0288)V93.CB 9.5940 15.9900 20.7870 5.1000 Constraint (T0288)Q14.CB (T0288)K87.CB 11.9625 19.9374 25.9187 5.0965 Constraint (T0288)N15.CB (T0288)C28.CB 11.8428 19.7380 25.6594 5.0965 Constraint (T0288)A13.CB (T0288)K87.CB 12.2572 20.4287 26.5573 5.0965 Constraint (T0288)A71.CB (T0288)Y91.CB 12.8083 21.3471 27.7512 5.0371 Constraint (T0288)S1.CB (T0288)Y90.CB 6.8668 11.4446 14.8780 5.0000 Constraint (T0288)A25.CB (T0288)K78.CB 13.3770 22.2950 28.9836 5.0000 Constraint (T0288)P29.CB (T0288)V93.CB 8.6311 14.3852 18.7008 5.0000 Constraint (T0288)A25.CB (T0288)V93.CB 12.3074 20.5123 26.6660 5.0000 Constraint (T0288)A25.CB (T0288)K92.CB 10.5806 17.6344 22.9247 4.9999 Constraint (T0288)S1.CB (T0288)V70.CB 13.0542 21.7570 28.2841 4.9999 Constraint (T0288)S1.CB (T0288)Q26.CB 8.9068 14.8446 19.2980 4.9999 Constraint (T0288)S1.CB (T0288)A25.CB 11.9330 19.8883 25.8548 4.9999 Constraint (T0288)V3.CB (T0288)D38.CB 13.4983 22.4972 29.2464 4.9999 Constraint (T0288)V3.CB (T0288)F37.CB 13.4530 22.4217 29.1483 4.9999 Constraint (T0288)A25.CB (T0288)P41.CB 13.6872 22.8119 29.6555 4.9894 Constraint (T0288)A13.CB (T0288)C30.CB 10.7756 17.9594 23.3472 4.9809 Constraint (T0288)N39.CB (T0288)N86.CB 13.2696 22.1160 28.7508 4.7131 Constraint (T0288)V68.CB (T0288)Q89.CB 13.3244 22.2074 28.8696 4.7130 Constraint (T0288)I74.CB (T0288)Y91.CB 11.3326 18.8877 24.5540 4.5383 Constraint (T0288)Q10.CB (T0288)P29.CB 11.6687 19.4479 25.2823 4.4951 Constraint (T0288)S61.CB (T0288)K92.CB 11.1488 18.5813 24.1557 4.3370 Constraint (T0288)K67.CB (T0288)K92.CB 12.3197 20.5328 26.6926 4.3107 Constraint (T0288)V57.CB (T0288)K92.CB 11.9898 19.9830 25.9779 4.3107 Constraint (T0288)A43.CB (T0288)K92.CB 12.9436 21.5726 28.0444 4.3106 Constraint (T0288)L44.CB (T0288)E69.CB 12.8246 21.3744 27.7867 4.1929 Constraint (T0288)V3.CB (T0288)V93.CB 12.1522 20.2537 26.3299 4.1000 Constraint (T0288)K6.CB (T0288)V93.CB 9.9898 16.6496 21.6445 4.1000 Constraint (T0288)T8.CB (T0288)K92.CB 12.2519 20.4198 26.5458 4.1000 Constraint (T0288)T47.CB (T0288)K92.CB 10.5304 17.5507 22.8160 4.0999 Constraint (T0288)Y27.CB (T0288)D45.CB 12.2801 20.4669 26.6070 4.0907 Constraint (T0288)S1.CB (T0288)I74.CB 13.6495 22.7492 29.5739 4.0000 Constraint (T0288)S1.CB (T0288)T40.CB 13.4764 22.4607 29.1989 4.0000 Constraint (T0288)S1.CB (T0288)I17.CB 12.9242 21.5404 28.0025 4.0000 Constraint (T0288)M2.CB (T0288)V93.CB 10.6985 17.8308 23.1801 4.0000 Constraint (T0288)S1.CB (T0288)K92.CB 11.0633 18.4389 23.9705 4.0000 Constraint (T0288)S1.CB (T0288)Y91.CB 9.3871 15.6451 20.3386 4.0000 Constraint (T0288)K67.CB (T0288)V93.CB 12.2012 20.3353 26.4358 4.0000 Constraint (T0288)S1.CB (T0288)Q10.CB 13.1374 21.8957 28.4644 4.0000 Constraint (T0288)D12.CB (T0288)K63.CB 13.1264 21.8774 28.4406 4.0000 Constraint (T0288)M2.CB (T0288)F37.CB 13.3035 22.1725 28.8243 3.9999 Constraint (T0288)K11.CB (T0288)Y27.CB 12.1431 20.2385 26.3101 3.9940 Constraint (T0288)K11.CB (T0288)C28.CB 11.2324 18.7207 24.3369 3.9940 Constraint (T0288)Q14.CB (T0288)C28.CB 11.5923 19.3204 25.1165 3.9930 Constraint (T0288)Q14.CB (T0288)Y27.CB 9.8302 16.3837 21.2989 3.9930 Constraint (T0288)Q14.CB (T0288)A25.CB 9.3841 15.6402 20.3323 3.9929 Constraint (T0288)D12.CB (T0288)P29.CB 9.7529 16.2548 21.1312 3.9844 Constraint (T0288)A13.CB (T0288)P29.CB 9.0766 15.1277 19.6660 3.9809 Constraint (T0288)A13.CB (T0288)C28.CB 9.3966 15.6611 20.3594 3.9809 Constraint (T0288)A13.CB (T0288)Y27.CB 7.5569 12.5948 16.3733 3.9809 Constraint (T0288)S20.CB (T0288)K92.CB 13.0191 21.6985 28.2081 3.9737 Constraint (T0288)D45.CB (T0288)K92.CB 9.8411 16.4018 21.3223 3.4370 Constraint (T0288)C28.CB (T0288)D45.CB 12.2858 20.4763 26.6192 3.4012 Constraint (T0288)T82.CB (T0288)K92.CB 12.5572 20.9287 27.2073 3.3370 Constraint (T0288)D45.CB (T0288)T66.CB 13.5351 22.5586 29.3262 3.3369 Constraint (T0288)T66.CB (T0288)Y90.CB 12.3814 20.6357 26.8264 3.3369 Constraint (T0288)V70.CB (T0288)K92.CB 11.1954 18.6590 24.2567 3.3107 Constraint (T0288)A42.CB (T0288)K92.CB 11.6812 19.4686 25.3092 3.3107 Constraint (T0288)E76.CB (T0288)K87.CB 12.5352 20.8920 27.1596 3.2748 Constraint (T0288)M73.CB (T0288)K92.CB 12.8553 21.4255 27.8532 3.2107 Constraint (T0288)E69.CB (T0288)K92.CB 12.5430 20.9050 27.1764 3.2107 Constraint (T0288)K72.CB (T0288)Y90.CB 12.7710 21.2849 27.6704 3.1385 Constraint (T0288)N39.CB (T0288)Y91.CB 10.6139 17.6899 22.9969 3.1372 Constraint (T0288)V36.CB (T0288)V93.CB 11.5798 19.2996 25.0895 3.1000 Constraint (T0288)I83.CB (T0288)V93.CB 9.2629 15.4381 20.0695 3.1000 Constraint (T0288)I54.CB (T0288)V93.CB 7.8515 13.0858 17.0115 3.1000 Constraint (T0288)D45.CB (T0288)V93.CB 11.7547 19.5912 25.4686 3.1000 Constraint (T0288)I19.CB (T0288)V93.CB 11.9546 19.9243 25.9016 3.1000 Constraint (T0288)T8.CB (T0288)V93.CB 11.4654 19.1091 24.8418 3.1000 Constraint (T0288)Q10.CB (T0288)Y91.CB 12.4294 20.7157 26.9304 3.1000 Constraint (T0288)K72.CB (T0288)Q89.CB 13.0306 21.7176 28.2329 3.0130 Constraint (T0288)P4.CB (T0288)V68.CB 13.3876 22.3126 29.0064 3.0000 Constraint (T0288)A25.CB (T0288)T47.CB 12.6861 21.1434 27.4865 3.0000 Constraint (T0288)V3.CB (T0288)K78.CB 13.4377 22.3962 29.1151 3.0000 Constraint (T0288)V3.CB (T0288)E69.CB 13.0166 21.6943 28.2026 3.0000 Constraint (T0288)A25.CB (T0288)D38.CB 12.9349 21.5581 28.0256 3.0000 Constraint (T0288)K11.CB (T0288)A25.CB 12.7684 21.2806 27.6648 3.0000 Constraint (T0288)L9.CB (T0288)Q26.CB 13.4194 22.3656 29.0753 3.0000 Constraint (T0288)A50.CB (T0288)K78.CB 11.8425 19.7375 25.6588 3.0000 Constraint (T0288)H84.CB (T0288)V93.CB 7.3587 12.2645 15.9438 3.0000 Constraint (T0288)T82.CB (T0288)V93.CB 10.9864 18.3107 23.8039 3.0000 Constraint (T0288)V81.CB (T0288)V93.CB 12.2744 20.4573 26.5945 3.0000 Constraint (T0288)I74.CB (T0288)V93.CB 12.2140 20.3567 26.4637 3.0000 Constraint (T0288)M73.CB (T0288)V93.CB 11.8427 19.7378 25.6591 3.0000 Constraint (T0288)V70.CB (T0288)V93.CB 10.3833 17.3055 22.4972 3.0000 Constraint (T0288)K65.CB (T0288)V93.CB 9.8130 16.3549 21.2614 3.0000 Constraint (T0288)K63.CB (T0288)V93.CB 5.9094 9.8490 12.8037 3.0000 Constraint (T0288)I62.CB (T0288)V93.CB 8.4098 14.0163 18.2212 3.0000 Constraint (T0288)S61.CB (T0288)V93.CB 7.6784 12.7973 16.6364 3.0000 Constraint (T0288)R60.CB (T0288)V93.CB 10.4444 17.4074 22.6296 3.0000 Constraint (T0288)N58.CB (T0288)V93.CB 11.8022 19.6703 25.5713 3.0000 Constraint (T0288)V57.CB (T0288)V93.CB 10.0154 16.6923 21.7000 3.0000 Constraint (T0288)T55.CB (T0288)V93.CB 5.7257 9.5429 12.4057 3.0000 Constraint (T0288)L9.CB (T0288)V93.CB 12.3969 20.6615 26.8600 3.0000 Constraint (T0288)V7.CB (T0288)V93.CB 9.3318 15.5530 20.2189 3.0000 Constraint (T0288)C28.CB (T0288)A43.CB 13.1780 21.9634 28.5524 3.0000 Constraint (T0288)P4.CB (T0288)N15.CB 13.6086 22.6809 29.4852 3.0000 Constraint (T0288)N15.CB (T0288)L88.CB 13.6328 22.7213 29.5377 3.0000 Constraint (T0288)L44.CB (T0288)S61.CB 13.6272 22.7120 29.5256 3.0000 Constraint (T0288)A43.CB (T0288)K63.CB 13.5312 22.5520 29.3177 2.9999 Constraint (T0288)A43.CB (T0288)S61.CB 13.6580 22.7633 29.5924 2.9999 Constraint (T0288)M2.CB (T0288)A71.CB 12.2562 20.4271 26.5552 2.9999 Constraint (T0288)M2.CB (T0288)V68.CB 13.2381 22.0635 28.6825 2.9999 Constraint (T0288)M2.CB (T0288)D38.CB 13.7066 22.8444 29.6977 2.9999 Constraint (T0288)M2.CB (T0288)L16.CB 13.2904 22.1506 28.7958 2.9999 Constraint (T0288)P29.CB (T0288)K78.CB 13.0927 21.8211 28.3674 2.9965 Constraint (T0288)K11.CB (T0288)Q89.CB 11.8133 19.6889 25.5955 2.9940 Constraint (T0288)A13.CB (T0288)K63.CB 13.2457 22.0762 28.6990 2.9930 Constraint (T0288)Y27.CB (T0288)A43.CB 13.3670 22.2783 28.9618 2.9894 Constraint (T0288)A25.CB (T0288)L44.CB 13.7336 22.8893 29.7561 2.9894 Constraint (T0288)D12.CB (T0288)C28.CB 10.0713 16.7854 21.8211 2.9844 Constraint (T0288)D12.CB (T0288)Y27.CB 8.6772 14.4621 18.8007 2.9844 Constraint (T0288)K78.CB (T0288)L88.CB 13.3333 22.2221 28.8887 2.7382 Constraint (T0288)V77.CB (T0288)Q89.CB 12.3226 20.5377 26.6990 2.6058 Constraint (T0288)K78.CB (T0288)Y90.CB 11.8788 19.7980 25.7374 2.4383 Constraint (T0288)L44.CB (T0288)K92.CB 11.4044 19.0073 24.7095 2.4370 Constraint (T0288)P41.CB (T0288)K92.CB 10.4105 17.3508 22.5560 2.4370 Constraint (T0288)D38.CB (T0288)K92.CB 12.1991 20.3319 26.4315 2.4370 Constraint (T0288)F37.CB (T0288)K92.CB 12.7827 21.3044 27.6957 2.4370 Constraint (T0288)Q10.CB (T0288)C28.CB 11.5526 19.2543 25.0305 2.3951 Constraint (T0288)R60.CB (T0288)K92.CB 12.1237 20.2062 26.2680 2.3370 Constraint (T0288)D38.CB (T0288)E69.CB 11.7430 19.5716 25.4431 2.2146 Constraint (T0288)Q10.CB (T0288)Y90.CB 12.9759 21.6265 28.1144 2.1000 Constraint (T0288)L9.CB (T0288)K92.CB 13.1443 21.9072 28.4793 2.1000 Constraint (T0288)V68.CB (T0288)Y91.CB 13.0156 21.6927 28.2005 2.0372 Constraint (T0288)E80.CB (T0288)Y91.CB 9.3447 15.5745 20.2469 2.0371 Constraint (T0288)P29.CB (T0288)D38.CB 13.6099 22.6832 29.4881 2.0000 Constraint (T0288)S1.CB (T0288)F37.CB 13.7767 22.9612 29.8495 2.0000 Constraint (T0288)A25.CB (T0288)E80.CB 13.5821 22.6369 29.4280 2.0000 Constraint (T0288)M2.CB (T0288)N39.CB 13.7148 22.8580 29.7154 2.0000 Constraint (T0288)T8.CB (T0288)Q26.CB 13.4518 22.4196 29.1455 2.0000 Constraint (T0288)S1.CB (T0288)V93.CB 12.0224 20.0373 26.0485 2.0000 Constraint (T0288)K72.CB (T0288)V93.CB 12.9827 21.6378 28.1291 2.0000 Constraint (T0288)A71.CB (T0288)V93.CB 12.3600 20.6000 26.7799 2.0000 Constraint (T0288)E69.CB (T0288)V93.CB 10.3350 17.2249 22.3924 2.0000 Constraint (T0288)V68.CB (T0288)V93.CB 12.5508 20.9179 27.1933 2.0000 Constraint (T0288)T66.CB (T0288)V93.CB 10.0171 16.6951 21.7036 2.0000 Constraint (T0288)T66.CB (T0288)K92.CB 12.3666 20.6110 26.7942 2.0000 Constraint (T0288)K65.CB (T0288)K92.CB 10.7152 17.8587 23.2163 2.0000 Constraint (T0288)C28.CB (T0288)E80.CB 13.3223 22.2038 28.8649 2.0000 Constraint (T0288)C28.CB (T0288)P41.CB 12.7797 21.2995 27.6894 2.0000 Constraint (T0288)C28.CB (T0288)T40.CB 13.1828 21.9714 28.5628 2.0000 Constraint (T0288)Q10.CB (T0288)A25.CB 13.5659 22.6098 29.3928 2.0000 Constraint (T0288)D12.CB (T0288)L88.CB 13.6126 22.6877 29.4941 2.0000 Constraint (T0288)S1.CB (T0288)K67.CB 13.6540 22.7566 29.5836 1.9999 Constraint (T0288)S1.CB (T0288)T66.CB 13.7460 22.9100 29.7830 1.9999 Constraint (T0288)L16.CB (T0288)Q89.CB 12.2052 20.3419 26.4445 1.9999 Constraint (T0288)Q14.CB (T0288)N86.CB 10.4047 17.3412 22.5436 1.9965 Constraint (T0288)Q14.CB (T0288)K63.CB 13.2247 22.0412 28.6535 1.9930 Constraint (T0288)Q14.CB (T0288)P29.CB 10.7761 17.9601 23.3481 1.9930 Constraint (T0288)Q14.CB (T0288)Q26.CB 6.2214 10.3691 13.4798 1.9930 Constraint (T0288)A13.CB (T0288)Q26.CB 4.0378 6.7297 8.7486 1.9930 Constraint (T0288)A13.CB (T0288)A25.CB 5.0569 8.4282 10.9567 1.9930 Constraint (T0288)V68.CB (T0288)Y90.CB 12.9193 21.5321 27.9918 1.8014 Constraint (T0288)Q26.CB (T0288)F37.CB 12.2059 20.3431 26.4461 1.8001 Constraint (T0288)K78.CB (T0288)Q89.CB 12.4900 20.8166 27.0616 1.7382 Constraint (T0288)V77.CB (T0288)Y90.CB 11.8556 19.7593 25.6870 1.7382 Constraint (T0288)E76.CB (T0288)Q89.CB 13.0717 21.7861 28.3219 1.6119 Constraint (T0288)Q75.CB (T0288)Y90.CB 12.6079 21.0132 27.3172 1.4383 Constraint (T0288)T40.CB (T0288)K92.CB 11.5691 19.2819 25.0665 1.4370 Constraint (T0288)Q26.CB (T0288)D45.CB 13.5804 22.6339 29.4241 1.4012 Constraint (T0288)A71.CB (T0288)K92.CB 12.7628 21.2713 27.6527 1.3107 Constraint (T0288)E76.CB (T0288)L88.CB 12.8820 21.4700 27.9110 1.2107 Constraint (T0288)V68.CB (T0288)K92.CB 13.2435 22.0725 28.6943 1.2107 Constraint (T0288)N58.CB (T0288)K92.CB 11.2229 18.7049 24.3163 1.2107 Constraint (T0288)L44.CB (T0288)V68.CB 13.3123 22.1872 28.8434 1.2035 Constraint (T0288)L44.CB (T0288)K65.CB 11.9805 19.9675 25.9578 1.2035 Constraint (T0288)N39.CB (T0288)K65.CB 11.8905 19.8174 25.7627 1.2035 Constraint (T0288)D38.CB (T0288)K65.CB 9.3344 15.5574 20.2246 1.2035 Constraint (T0288)Q75.CB (T0288)Q89.CB 12.6724 21.1207 27.4569 1.1394 Constraint (T0288)T47.CB (T0288)V93.CB 6.0755 10.1258 13.1635 1.1000 Constraint (T0288)L44.CB (T0288)V93.CB 11.1857 18.6428 24.2357 1.1000 Constraint (T0288)A43.CB (T0288)V93.CB 10.1360 16.8933 21.9613 1.1000 Constraint (T0288)A42.CB (T0288)V93.CB 9.2981 15.4968 20.1459 1.1000 Constraint (T0288)P41.CB (T0288)V93.CB 11.6004 19.3340 25.1341 1.1000 Constraint (T0288)T40.CB (T0288)V93.CB 12.0728 20.1213 26.1576 1.1000 Constraint (T0288)D38.CB (T0288)V93.CB 12.9785 21.6308 28.1200 1.1000 Constraint (T0288)F37.CB (T0288)V93.CB 12.6247 21.0412 27.3536 1.1000 Constraint (T0288)I17.CB (T0288)V93.CB 11.7769 19.6281 25.5165 1.1000 Constraint (T0288)Q10.CB (T0288)V93.CB 13.0891 21.8151 28.3597 1.1000 Constraint (T0288)N15.CB (T0288)Q89.CB 12.9880 21.6467 28.1408 1.1000 Constraint (T0288)Q10.CB (T0288)K92.CB 13.1519 21.9199 28.4959 1.1000 Constraint (T0288)Q14.CB (T0288)Q89.CB 7.2492 12.0820 15.7066 1.0965 Constraint (T0288)K78.CB (T0288)Y91.CB 9.0750 15.1250 19.6625 1.0372 Constraint (T0288)Q75.CB (T0288)Y91.CB 10.8698 18.1163 23.5512 1.0372 Constraint (T0288)K72.CB (T0288)Y91.CB 11.5461 19.2435 25.0166 1.0372 Constraint (T0288)D38.CB (T0288)K63.CB 13.3218 22.2030 28.8639 1.0111 Constraint (T0288)E80.CB (T0288)V93.CB 12.8899 21.4832 27.9281 1.0000 Constraint (T0288)P29.CB (T0288)L44.CB 13.2933 22.1556 28.8023 1.0000 Constraint (T0288)Q26.CB (T0288)E80.CB 13.7441 22.9069 29.7790 1.0000 Constraint (T0288)Q26.CB (T0288)K78.CB 13.6916 22.8193 29.6651 1.0000 Constraint (T0288)K11.CB (T0288)Q26.CB 12.7922 21.3204 27.7165 1.0000 Constraint (T0288)L16.CB (T0288)Y90.CB 10.9420 18.2367 23.7078 1.0000 Constraint (T0288)N15.CB (T0288)Y90.CB 12.2576 20.4293 26.5581 1.0000 Constraint (T0288)K11.CB (T0288)Y91.CB 11.8268 19.7113 25.6248 1.0000 Constraint (T0288)P4.CB (T0288)N39.CB 13.2724 22.1206 28.7568 1.0000 Constraint (T0288)P4.CB (T0288)D38.CB 12.6251 21.0418 27.3544 1.0000 Constraint (T0288)V3.CB (T0288)E76.CB 13.3181 22.1968 28.8559 1.0000 Constraint (T0288)V3.CB (T0288)A71.CB 12.8156 21.3593 27.7671 1.0000 Constraint (T0288)P4.CB (T0288)A13.CB 12.5887 20.9811 27.2754 1.0000 Constraint (T0288)M2.CB (T0288)E80.CB 13.4410 22.4017 29.1222 1.0000 Constraint (T0288)M2.CB (T0288)K11.CB 13.3715 22.2859 28.9717 1.0000 Constraint (T0288)S1.CB (T0288)Y27.CB 8.4541 14.0902 18.3172 1.0000 Constraint (T0288)Y27.CB (T0288)K78.CB 13.7982 22.9970 29.8962 0.9965 Constraint (T0288)Q14.CB (T0288)Y90.CB 8.5626 14.2711 18.5524 0.9965 Constraint (T0288)Q14.CB (T0288)L88.CB 4.2279 7.0466 9.1605 0.9965 Constraint (T0288)A13.CB (T0288)Y90.CB 8.8339 14.7232 19.1402 0.9965 Constraint (T0288)A13.CB (T0288)Q89.CB 6.0497 10.0828 13.1077 0.9965 Constraint (T0288)A13.CB (T0288)L88.CB 5.0905 8.4842 11.0294 0.9965 Constraint (T0288)D12.CB (T0288)Q26.CB 6.9730 11.6217 15.1082 0.9965 Constraint (T0288)D12.CB (T0288)A25.CB 6.8042 11.3403 14.7424 0.9965 Constraint (T0288)Q10.CB (T0288)Y27.CB 9.7085 16.1809 21.0351 0.9940 Constraint (T0288)I17.CB (T0288)K92.CB 12.7815 21.3025 27.6933 0.9737 Constraint (T0288)Q26.CB (T0288)A43.CB 12.5323 20.8871 27.1532 0.7001 Constraint (T0288)Q26.CB (T0288)T40.CB 12.3408 20.5680 26.7384 0.7001 Constraint (T0288)Q26.CB (T0288)D38.CB 12.6382 21.0637 27.3828 0.7001 Constraint (T0288)V81.CB (T0288)K92.CB 6.9384 11.5640 15.0332 0.4370 Constraint (T0288)I74.CB (T0288)K92.CB 8.4114 14.0191 18.2248 0.4370 Constraint (T0288)N39.CB (T0288)K92.CB 8.9157 14.8595 19.3174 0.4370 Constraint (T0288)E80.CB (T0288)K92.CB 2.9601 4.9334 6.4135 0.3370 Constraint (T0288)K78.CB (T0288)K92.CB 3.8313 6.3854 8.3011 0.3370 Constraint (T0288)V77.CB (T0288)K92.CB 6.0049 10.0081 13.0105 0.3370 Constraint (T0288)V77.CB (T0288)Y91.CB 6.0270 10.0450 13.0585 0.3370 Constraint (T0288)E76.CB (T0288)K92.CB 9.3077 15.5128 20.1667 0.3370 Constraint (T0288)E76.CB (T0288)Y91.CB 9.1398 15.2330 19.8029 0.3370 Constraint (T0288)E76.CB (T0288)Y90.CB 10.8346 18.0576 23.4749 0.3370 Constraint (T0288)Q75.CB (T0288)K92.CB 9.1467 15.2445 19.8179 0.3370 Constraint (T0288)K72.CB (T0288)K92.CB 11.2627 18.7712 24.4026 0.3370 Constraint (T0288)A43.CB (T0288)T66.CB 13.3638 22.2729 28.9548 0.3370 Constraint (T0288)D38.CB (T0288)T66.CB 11.6312 19.3853 25.2008 0.3370 Constraint (T0288)N39.CB (T0288)V93.CB 11.1100 18.5167 24.0717 0.1000 Constraint (T0288)Y27.CB (T0288)K92.CB 12.1289 20.2149 26.2794 0.1000 Constraint (T0288)L16.CB (T0288)K92.CB 13.2851 22.1418 28.7843 0.1000 Constraint (T0288)L16.CB (T0288)Y91.CB 13.6538 22.7563 29.5832 0.1000 Constraint (T0288)N15.CB (T0288)K92.CB 12.9926 21.6544 28.1507 0.1000 Constraint (T0288)N15.CB (T0288)Y91.CB 13.5917 22.6528 29.4486 0.1000 Constraint (T0288)D12.CB (T0288)Q89.CB 13.5113 22.5188 29.2745 0.1000 Constraint (T0288)K92.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: