parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 16.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint (T0288)N58.CB (T0288)M73.CB 4.5610 7.6017 9.8822 100.2126 Constraint (T0288)N58.CB (T0288)K72.CB 7.4492 12.4154 16.1400 100.2126 Constraint (T0288)N58.CB (T0288)V70.CB 6.9225 11.5375 14.9988 100.2126 Constraint (T0288)N58.CB (T0288)E69.CB 7.9477 13.2461 17.2199 100.2126 Constraint (T0288)V57.CB (T0288)M73.CB 3.2260 5.3766 6.9896 100.2126 Constraint (T0288)V57.CB (T0288)K72.CB 6.1907 10.3178 13.4131 100.2126 Constraint (T0288)V57.CB (T0288)A71.CB 6.2412 10.4019 13.5225 100.2126 Constraint (T0288)V57.CB (T0288)V70.CB 4.3155 7.1925 9.3503 100.2126 Constraint (T0288)V57.CB (T0288)E69.CB 6.0575 10.0958 13.1245 100.2126 Constraint (T0288)T55.CB (T0288)M73.CB 7.5868 12.6446 16.4380 100.2126 Constraint (T0288)T55.CB (T0288)V70.CB 6.5064 10.8440 14.0972 100.2126 Constraint (T0288)I54.CB (T0288)M73.CB 6.0446 10.0744 13.0967 100.2126 Constraint (T0288)I54.CB (T0288)A71.CB 6.7084 11.1807 14.5349 100.2126 Constraint (T0288)I54.CB (T0288)V70.CB 4.3257 7.2094 9.3723 100.2126 Constraint (T0288)D38.CB (T0288)A50.CB 7.3410 12.2350 15.9055 100.2126 Constraint (T0288)D38.CB (T0288)A49.CB 7.8699 13.1166 17.0515 100.2126 Constraint (T0288)F37.CB (T0288)A50.CB 6.6678 11.1129 14.4468 100.2126 Constraint (T0288)F37.CB (T0288)A49.CB 7.6200 12.6999 16.5099 100.2126 Constraint (T0288)V36.CB (T0288)I54.CB 7.4897 12.4828 16.2277 100.2126 Constraint (T0288)V36.CB (T0288)A50.CB 3.7444 6.2407 8.1129 100.2126 Constraint (T0288)V36.CB (T0288)A49.CB 4.2283 7.0472 9.1613 100.2126 Constraint (T0288)I33.CB (T0288)A71.CB 7.6473 12.7455 16.5691 100.2126 Constraint (T0288)I33.CB (T0288)V70.CB 6.6439 11.0732 14.3952 100.2126 Constraint (T0288)I33.CB (T0288)V57.CB 7.2771 12.1286 15.7671 100.2126 Constraint (T0288)I33.CB (T0288)T55.CB 7.0356 11.7260 15.2438 100.2126 Constraint (T0288)I33.CB (T0288)I54.CB 4.0383 6.7306 8.7497 100.2126 Constraint (T0288)I33.CB (T0288)A50.CB 3.4221 5.7035 7.4146 100.2126 Constraint (T0288)I33.CB (T0288)A49.CB 4.2069 7.0114 9.1148 100.2126 Constraint (T0288)Y32.CB (T0288)A71.CB 7.8882 13.1471 17.0912 100.2126 Constraint (T0288)Y32.CB (T0288)V70.CB 6.3176 10.5293 13.6880 100.2126 Constraint (T0288)Y32.CB (T0288)V57.CB 8.1669 13.6115 17.6950 100.2126 Constraint (T0288)Y32.CB (T0288)T55.CB 6.5083 10.8471 14.1013 100.2126 Constraint (T0288)Y32.CB (T0288)I54.CB 4.4106 7.3509 9.5562 100.2126 Constraint (T0288)Y32.CB (T0288)A50.CB 4.9894 8.3157 10.8104 100.2126 Constraint (T0288)Y32.CB (T0288)A49.CB 6.3715 10.6191 13.8048 100.2126 Constraint (T0288)M73.CB (T0288)T82.CB 7.1146 11.8577 15.4150 99.5125 Constraint (T0288)K72.CB (T0288)V81.CB 7.9556 13.2593 17.2371 99.5125 Constraint (T0288)A71.CB (T0288)V81.CB 7.7489 12.9149 16.7893 99.5125 Constraint (T0288)N58.CB (T0288)T82.CB 3.3554 5.5924 7.2701 99.5125 Constraint (T0288)N58.CB (T0288)V81.CB 3.7480 6.2467 8.1208 99.5125 Constraint (T0288)N58.CB (T0288)I74.CB 5.5024 9.1707 11.9219 99.5125 Constraint (T0288)V57.CB (T0288)T82.CB 4.5077 7.5129 9.7667 99.5125 Constraint (T0288)V57.CB (T0288)V81.CB 4.0361 6.7268 8.7449 99.5125 Constraint (T0288)V57.CB (T0288)I74.CB 3.8576 6.4293 8.3581 99.5125 Constraint (T0288)I54.CB (T0288)I74.CB 5.4653 9.1088 11.8415 99.5125 Constraint (T0288)A42.CB (T0288)V81.CB 5.9974 9.9956 12.9943 99.5125 Constraint (T0288)I33.CB (T0288)I74.CB 6.8792 11.4654 14.9050 99.5125 Constraint (T0288)V57.CB (T0288)K67.CB 7.6134 12.6890 16.4957 99.0091 Constraint (T0288)I54.CB (T0288)K67.CB 6.4440 10.7400 13.9620 99.0091 Constraint (T0288)I33.CB (T0288)K67.CB 7.3344 12.2240 15.8912 99.0091 Constraint (T0288)Y32.CB (T0288)K67.CB 6.0078 10.0131 13.0170 99.0091 Constraint (T0288)V70.CB (T0288)V81.CB 7.1587 11.9312 15.5106 98.5125 Constraint (T0288)I54.CB (T0288)T82.CB 6.6852 11.1420 14.4846 98.5125 Constraint (T0288)I62.CB (T0288)M73.CB 4.4048 7.3413 9.5437 98.2247 Constraint (T0288)I62.CB (T0288)K72.CB 6.5731 10.9552 14.2417 98.2247 Constraint (T0288)I62.CB (T0288)A71.CB 6.2557 10.4261 13.5539 98.2247 Constraint (T0288)E53.CB (T0288)I62.CB 5.5056 9.1760 11.9289 98.2247 Constraint (T0288)D52.CB (T0288)I62.CB 7.3117 12.1861 15.8419 98.2247 Constraint (T0288)F37.CB (T0288)D52.CB 8.7102 14.5170 18.8721 98.2247 Constraint (T0288)V36.CB (T0288)E53.CB 8.4598 14.0997 18.3296 98.2247 Constraint (T0288)V36.CB (T0288)D52.CB 5.6027 9.3379 12.1392 98.2247 Constraint (T0288)Q35.CB (T0288)I54.CB 8.0527 13.4212 17.4476 98.2247 Constraint (T0288)Q35.CB (T0288)E53.CB 8.7351 14.5586 18.9261 98.2247 Constraint (T0288)Q35.CB (T0288)D52.CB 6.8168 11.3614 14.7698 98.2247 Constraint (T0288)Q35.CB (T0288)A50.CB 3.7948 6.3247 8.2221 98.2247 Constraint (T0288)Q35.CB (T0288)A49.CB 6.2398 10.3997 13.5196 98.2247 Constraint (T0288)V34.CB (T0288)A71.CB 7.5883 12.6472 16.4414 98.2247 Constraint (T0288)V34.CB (T0288)V70.CB 7.5090 12.5151 16.2696 98.2247 Constraint (T0288)V34.CB (T0288)I54.CB 6.6560 11.0933 14.4212 98.2247 Constraint (T0288)V34.CB (T0288)E53.CB 6.8258 11.3763 14.7891 98.2247 Constraint (T0288)V34.CB (T0288)D52.CB 5.9527 9.9212 12.8975 98.2247 Constraint (T0288)V34.CB (T0288)A50.CB 3.8941 6.4902 8.4373 98.2247 Constraint (T0288)V34.CB (T0288)A49.CB 6.5602 10.9336 14.2137 98.2247 Constraint (T0288)I33.CB (T0288)I62.CB 7.1151 11.8586 15.4161 98.2247 Constraint (T0288)I33.CB (T0288)E53.CB 4.7180 7.8633 10.2223 98.2247 Constraint (T0288)I33.CB (T0288)D52.CB 2.8733 4.7888 6.2254 98.2247 Constraint (T0288)Y32.CB (T0288)I62.CB 6.4709 10.7849 14.0204 98.2247 Constraint (T0288)Y32.CB (T0288)E53.CB 3.3719 5.6199 7.3058 98.2247 Constraint (T0288)Y32.CB (T0288)D52.CB 4.1767 6.9611 9.0495 98.2247 Constraint (T0288)I54.CB (T0288)V81.CB 6.3903 10.6505 13.8456 98.1755 Constraint (T0288)S61.CB (T0288)M73.CB 6.2361 10.3935 13.5115 97.5916 Constraint (T0288)S61.CB (T0288)V70.CB 6.2832 10.4720 13.6136 97.5916 Constraint (T0288)R60.CB (T0288)M73.CB 3.8160 6.3601 8.2681 97.5916 Constraint (T0288)R60.CB (T0288)K72.CB 6.5078 10.8464 14.1003 97.5916 Constraint (T0288)R60.CB (T0288)A71.CB 7.7588 12.9313 16.8107 97.5916 Constraint (T0288)R60.CB (T0288)V70.CB 5.6060 9.3433 12.1463 97.5916 Constraint (T0288)R60.CB (T0288)E69.CB 5.6925 9.4874 12.3337 97.5916 Constraint (T0288)V48.CB (T0288)V57.CB 7.5379 12.5632 16.3321 97.5916 Constraint (T0288)D38.CB (T0288)V48.CB 7.3225 12.2041 15.8654 97.5916 Constraint (T0288)F37.CB (T0288)V48.CB 6.2273 10.3788 13.4924 97.5916 Constraint (T0288)V36.CB (T0288)V48.CB 3.5279 5.8799 7.6438 97.5916 Constraint (T0288)I33.CB (T0288)V48.CB 3.6941 6.1569 8.0039 97.5916 Constraint (T0288)Y32.CB (T0288)V48.CB 6.7829 11.3048 14.6962 97.5916 Constraint (T0288)I62.CB (T0288)I74.CB 5.6578 9.4296 12.2585 97.5246 Constraint (T0288)F37.CB (T0288)I74.CB 8.3624 13.9373 18.1185 97.2979 Constraint (T0288)I54.CB (T0288)K72.CB 8.1100 13.5166 17.5716 97.2127 Constraint (T0288)I54.CB (T0288)E69.CB 7.0090 11.6817 15.1862 97.2127 Constraint (T0288)I33.CB (T0288)M73.CB 8.7686 14.6143 18.9986 97.2127 Constraint (T0288)A42.CB (T0288)V57.CB 7.6929 12.8215 16.6680 97.2127 Constraint (T0288)A42.CB (T0288)I54.CB 6.6105 11.0176 14.3228 97.2127 Constraint (T0288)I33.CB (T0288)A42.CB 4.7090 7.8484 10.2029 97.2127 Constraint (T0288)Y32.CB (T0288)A42.CB 8.0042 13.3404 17.3425 97.2127 Constraint (T0288)V57.CB (T0288)V68.CB 8.1486 13.5810 17.6553 97.2126 Constraint (T0288)V34.CB (T0288)K67.CB 6.5694 10.9489 14.2336 97.0212 Constraint (T0288)T55.CB (T0288)T82.CB 6.8855 11.4759 14.9187 96.9007 Constraint (T0288)T55.CB (T0288)V81.CB 8.1930 13.6551 17.7516 96.9007 Constraint (T0288)I33.CB (T0288)V81.CB 7.8989 13.1648 17.1142 96.9007 Constraint (T0288)R60.CB (T0288)V81.CB 6.6748 11.1247 14.4621 96.8915 Constraint (T0288)R60.CB (T0288)I74.CB 6.2214 10.3690 13.4797 96.8915 Constraint (T0288)V48.CB (T0288)T82.CB 7.4059 12.3431 16.0460 96.8915 Constraint (T0288)V48.CB (T0288)I74.CB 7.6191 12.6986 16.5081 96.8915 Constraint (T0288)P41.CB (T0288)T82.CB 7.6271 12.7118 16.5254 96.8915 Constraint (T0288)P41.CB (T0288)V81.CB 5.3504 8.9173 11.5925 96.8915 Constraint (T0288)P41.CB (T0288)I74.CB 7.1717 11.9528 15.5387 96.8915 Constraint (T0288)T55.CB (T0288)I74.CB 8.1414 13.5690 17.6397 96.5231 Constraint (T0288)V36.CB (T0288)I74.CB 8.4008 14.0014 18.2018 96.5126 Constraint (T0288)A42.CB (T0288)T82.CB 7.7344 12.8906 16.7578 96.5125 Constraint (T0288)A42.CB (T0288)I74.CB 6.6511 11.0851 14.4107 96.5125 Constraint (T0288)N58.CB (T0288)Q75.CB 7.3046 12.1743 15.8266 96.5125 Constraint (T0288)V57.CB (T0288)Q75.CB 6.4354 10.7257 13.9434 96.5125 Constraint (T0288)N58.CB (T0288)E80.CB 5.2280 8.7134 11.3274 96.5125 Constraint (T0288)T55.CB (T0288)E69.CB 8.2452 13.7420 17.8645 96.2129 Constraint (T0288)I62.CB (T0288)V81.CB 7.3081 12.1801 15.8341 96.1876 Constraint (T0288)R60.CB (T0288)T82.CB 6.1647 10.2746 13.3569 96.1533 Constraint (T0288)T55.CB (T0288)K67.CB 8.6692 14.4487 18.7832 96.0094 Constraint (T0288)N58.CB (T0288)A71.CB 8.2726 13.7876 17.9239 96.0091 Constraint (T0288)V48.CB (T0288)V81.CB 6.6281 11.0468 14.3609 95.8915 Constraint (T0288)T40.CB (T0288)A50.CB 7.8338 13.0563 16.9732 95.6037 Constraint (T0288)T40.CB (T0288)A49.CB 7.7728 12.9546 16.8410 95.6037 Constraint (T0288)N39.CB (T0288)V48.CB 7.7987 12.9977 16.8971 95.6037 Constraint (T0288)V36.CB (T0288)D45.CB 5.8554 9.7590 12.6867 95.6037 Constraint (T0288)Q35.CB (T0288)V48.CB 6.2067 10.3446 13.4480 95.6037 Constraint (T0288)V34.CB (T0288)V48.CB 6.8136 11.3559 14.7627 95.6037 Constraint (T0288)I33.CB (T0288)D45.CB 7.2900 12.1501 15.7951 95.6037 Constraint (T0288)E53.CB (T0288)V70.CB 6.7912 11.3186 14.7142 95.2248 Constraint (T0288)D52.CB (T0288)V70.CB 7.8932 13.1553 17.1019 95.2248 Constraint (T0288)A42.CB (T0288)D52.CB 5.9058 9.8430 12.7959 95.2247 Constraint (T0288)Q35.CB (T0288)A71.CB 8.5672 14.2787 18.5623 95.2247 Constraint (T0288)K63.CB (T0288)M73.CB 7.4622 12.4369 16.1680 95.2247 Constraint (T0288)I54.CB (T0288)K63.CB 5.6447 9.4078 12.2302 95.2247 Constraint (T0288)E53.CB (T0288)K63.CB 5.6820 9.4701 12.3111 95.2247 Constraint (T0288)S61.CB (T0288)T82.CB 7.6268 12.7113 16.5247 95.1533 Constraint (T0288)S61.CB (T0288)V81.CB 8.8390 14.7317 19.1512 95.1533 Constraint (T0288)N58.CB (T0288)E76.CB 5.6857 9.4762 12.3190 95.1122 Constraint (T0288)V57.CB (T0288)E76.CB 5.8478 9.7463 12.6702 95.1122 Constraint (T0288)I62.CB (T0288)T82.CB 7.3011 12.1685 15.8191 94.9127 Constraint (T0288)I33.CB (T0288)T82.CB 9.0391 15.0652 19.5848 94.9127 Constraint (T0288)T40.CB (T0288)V81.CB 7.5267 12.5446 16.3079 94.9035 Constraint (T0288)V57.CB (T0288)E80.CB 6.8577 11.4294 14.8582 94.7743 Constraint (T0288)P41.CB (T0288)V57.CB 8.4356 14.0593 18.2771 94.5916 Constraint (T0288)P41.CB (T0288)I54.CB 8.7387 14.5646 18.9339 94.5916 Constraint (T0288)P41.CB (T0288)A50.CB 9.1238 15.2064 19.7683 94.5916 Constraint (T0288)I62.CB (T0288)Q75.CB 8.0761 13.4602 17.4983 94.5246 Constraint (T0288)P41.CB (T0288)V77.CB 7.1649 11.9416 15.5241 94.4947 Constraint (T0288)I54.CB (T0288)V68.CB 8.3904 13.9840 18.1792 94.2127 Constraint (T0288)L31.CB (T0288)M73.CB 6.1282 10.2137 13.2778 94.2126 Constraint (T0288)L31.CB (T0288)K72.CB 7.3062 12.1770 15.8301 94.2126 Constraint (T0288)L31.CB (T0288)A71.CB 5.4938 9.1564 11.9033 94.2126 Constraint (T0288)L31.CB (T0288)V70.CB 3.1404 5.2340 6.8042 94.2126 Constraint (T0288)L31.CB (T0288)E69.CB 5.6380 9.3966 12.2156 94.2126 Constraint (T0288)L31.CB (T0288)V68.CB 6.4295 10.7158 13.9306 94.2126 Constraint (T0288)L31.CB (T0288)N58.CB 8.4303 14.0504 18.2656 94.2126 Constraint (T0288)L31.CB (T0288)V57.CB 5.5107 9.1845 11.9399 94.2126 Constraint (T0288)L31.CB (T0288)T55.CB 5.0844 8.4739 11.0161 94.2126 Constraint (T0288)L31.CB (T0288)I54.CB 2.9331 4.8885 6.3551 94.2126 Constraint (T0288)L31.CB (T0288)A50.CB 7.7689 12.9482 16.8327 94.2126 Constraint (T0288)L31.CB (T0288)A49.CB 8.5705 14.2841 18.5693 94.2126 Constraint (T0288)A42.CB (T0288)V77.CB 7.9474 13.2456 17.2193 94.1158 Constraint (T0288)N58.CB (T0288)V77.CB 3.7692 6.2819 8.1665 94.1158 Constraint (T0288)V57.CB (T0288)V77.CB 4.3125 7.1875 9.3437 94.1158 Constraint (T0288)A42.CB (T0288)E80.CB 7.9601 13.2669 17.2469 94.1114 Constraint (T0288)V36.CB (T0288)V81.CB 8.5881 14.3135 18.6076 94.1104 Constraint (T0288)E53.CB (T0288)K67.CB 7.7718 12.9529 16.8388 94.0213 Constraint (T0288)K67.CB (T0288)E76.CB 8.8845 14.8075 19.2498 93.9087 Constraint (T0288)D45.CB (T0288)V81.CB 6.3781 10.6301 13.8192 93.9036 Constraint (T0288)S61.CB (T0288)I74.CB 8.2356 13.7261 17.8439 93.9020 Constraint (T0288)R60.CB (T0288)Q75.CB 7.9063 13.1771 17.1302 93.8915 Constraint (T0288)P41.CB (T0288)E80.CB 6.2964 10.4939 13.6421 93.8915 Constraint (T0288)N58.CB (T0288)K78.CB 6.0262 10.0437 13.0568 93.6459 Constraint (T0288)Y32.CB (T0288)I74.CB 8.1098 13.5164 17.5713 93.5241 Constraint (T0288)D52.CB (T0288)I74.CB 8.4070 14.0116 18.2151 93.5136 Constraint (T0288)I54.CB (T0288)Q75.CB 8.4221 14.0368 18.2479 93.5126 Constraint (T0288)L31.CB (T0288)I74.CB 5.8759 9.7932 12.7312 93.5125 Constraint (T0288)I74.CB (T0288)I83.CB 5.3859 8.9765 11.6694 93.5125 Constraint (T0288)M73.CB (T0288)I83.CB 6.2983 10.4972 13.6464 93.5125 Constraint (T0288)A71.CB (T0288)I83.CB 8.1086 13.5144 17.5687 93.5125 Constraint (T0288)V70.CB (T0288)I83.CB 6.3566 10.5943 13.7725 93.5125 Constraint (T0288)N58.CB (T0288)I83.CB 4.7773 7.9622 10.3509 93.5125 Constraint (T0288)V57.CB (T0288)I83.CB 3.4609 5.7681 7.4985 93.5125 Constraint (T0288)T55.CB (T0288)I83.CB 5.1116 8.5193 11.0751 93.5125 Constraint (T0288)I54.CB (T0288)I83.CB 3.6085 6.0142 7.8184 93.5125 Constraint (T0288)A42.CB (T0288)I83.CB 5.5541 9.2568 12.0339 93.5125 Constraint (T0288)I33.CB (T0288)I83.CB 5.6990 9.4984 12.3479 93.5125 Constraint (T0288)V48.CB (T0288)N58.CB 9.1165 15.1941 19.7524 93.3881 Constraint (T0288)V34.CB (T0288)I74.CB 8.1642 13.6070 17.6892 93.3316 Constraint (T0288)Y32.CB (T0288)E69.CB 8.7808 14.6347 19.0252 93.2129 Constraint (T0288)Y32.CB (T0288)V68.CB 8.9053 14.8421 19.2948 93.2129 Constraint (T0288)I62.CB (T0288)E76.CB 7.8433 13.0721 16.9938 93.1243 Constraint (T0288)V36.CB (T0288)I83.CB 7.5275 12.5459 16.3096 93.1113 Constraint (T0288)L31.CB (T0288)K67.CB 3.9542 6.5903 8.5674 93.0091 Constraint (T0288)D52.CB (T0288)T82.CB 8.4879 14.1465 18.3905 92.9128 Constraint (T0288)V48.CB (T0288)I62.CB 8.6888 14.4813 18.8256 92.6037 Constraint (T0288)R60.CB (T0288)E76.CB 6.2453 10.4088 13.5315 92.4912 Constraint (T0288)D52.CB (T0288)V81.CB 8.4322 14.0537 18.2698 92.2387 Constraint (T0288)A42.CB (T0288)E53.CB 8.5082 14.1803 18.4344 92.2247 Constraint (T0288)A43.CB (T0288)D52.CB 7.5304 12.5507 16.3159 92.2247 Constraint (T0288)V34.CB (T0288)A43.CB 8.2647 13.7745 17.9068 92.2247 Constraint (T0288)I33.CB (T0288)A43.CB 6.6116 11.0194 14.3252 92.2247 Constraint (T0288)L31.CB (T0288)I62.CB 3.3128 5.5213 7.1777 92.2247 Constraint (T0288)L31.CB (T0288)E53.CB 4.1998 6.9997 9.0996 92.2247 Constraint (T0288)L31.CB (T0288)D52.CB 5.7889 9.6482 12.5427 92.2247 Constraint (T0288)Y32.CB (T0288)K63.CB 7.2896 12.1493 15.7941 92.2247 Constraint (T0288)I62.CB (T0288)V77.CB 7.3940 12.3233 16.0203 92.1278 Constraint (T0288)T40.CB (T0288)I74.CB 8.0064 13.3441 17.3473 91.9036 Constraint (T0288)D45.CB (T0288)T82.CB 6.8046 11.3409 14.7432 91.9035 Constraint (T0288)I21.CB (T0288)K72.CB 7.0397 11.7328 15.2526 91.6204 Constraint (T0288)I17.CB (T0288)M73.CB 6.9703 11.6172 15.1024 91.6204 Constraint (T0288)I17.CB (T0288)K72.CB 8.1472 13.5786 17.6522 91.6204 Constraint (T0288)I17.CB (T0288)A71.CB 6.6523 11.0872 14.4133 91.6204 Constraint (T0288)I17.CB (T0288)V70.CB 7.2100 12.0166 15.6216 91.6204 Constraint (T0288)I17.CB (T0288)N58.CB 7.1564 11.9274 15.5056 91.6204 Constraint (T0288)I17.CB (T0288)V57.CB 6.0699 10.1165 13.1514 91.6204 Constraint (T0288)I17.CB (T0288)I54.CB 6.5918 10.9863 14.2822 91.6204 Constraint (T0288)I17.CB (T0288)D52.CB 7.7917 12.9861 16.8819 91.6204 Constraint (T0288)I17.CB (T0288)A50.CB 8.4693 14.1154 18.3501 91.6204 Constraint (T0288)I17.CB (T0288)A49.CB 8.3775 13.9626 18.1513 91.6204 Constraint (T0288)I17.CB (T0288)A42.CB 3.5351 5.8918 7.6593 91.6204 Constraint (T0288)I17.CB (T0288)N39.CB 7.5564 12.5940 16.3722 91.6204 Constraint (T0288)I17.CB (T0288)D38.CB 7.9997 13.3329 17.3328 91.6204 Constraint (T0288)I17.CB (T0288)F37.CB 5.2759 8.7932 11.4312 91.6204 Constraint (T0288)I17.CB (T0288)V36.CB 5.7422 9.5704 12.4415 91.6204 Constraint (T0288)I17.CB (T0288)Q35.CB 7.0107 11.6845 15.1898 91.6204 Constraint (T0288)I17.CB (T0288)V34.CB 7.8671 13.1118 17.0454 91.6204 Constraint (T0288)I17.CB (T0288)I33.CB 6.0827 10.1378 13.1791 91.6204 Constraint (T0288)Q35.CB (T0288)D45.CB 8.9121 14.8536 19.3096 91.5926 Constraint (T0288)L31.CB (T0288)S61.CB 6.4544 10.7574 13.9846 91.5916 Constraint (T0288)L31.CB (T0288)R60.CB 7.1389 11.8982 15.4676 91.5916 Constraint (T0288)L31.CB (T0288)V48.CB 7.6249 12.7081 16.5206 91.5916 Constraint (T0288)S61.CB (T0288)K72.CB 8.5982 14.3304 18.6295 91.5916 Constraint (T0288)Q35.CB (T0288)I74.CB 8.5495 14.2491 18.5239 91.5352 Constraint (T0288)I62.CB (T0288)I83.CB 5.5143 9.1905 11.9476 91.5246 Constraint (T0288)R60.CB (T0288)V77.CB 5.9569 9.9281 12.9066 91.4947 Constraint (T0288)L31.CB (T0288)A42.CB 8.2968 13.8280 17.9764 91.2127 Constraint (T0288)A43.CB (T0288)I83.CB 8.2624 13.7707 17.9019 91.1234 Constraint (T0288)I54.CB (T0288)V77.CB 7.4919 12.4865 16.2325 91.1159 Constraint (T0288)V68.CB (T0288)V77.CB 9.1946 15.3243 19.9216 91.1158 Constraint (T0288)A43.CB (T0288)V81.CB 8.5933 14.3222 18.6188 91.1104 Constraint (T0288)I21.CB (T0288)I74.CB 4.6689 7.7814 10.1159 90.9203 Constraint (T0288)I21.CB (T0288)M73.CB 6.4330 10.7217 13.9382 90.9203 Constraint (T0288)I21.CB (T0288)A71.CB 4.2609 7.1015 9.2319 90.9203 Constraint (T0288)I21.CB (T0288)V70.CB 3.8560 6.4266 8.3546 90.9203 Constraint (T0288)I21.CB (T0288)E69.CB 6.7741 11.2902 14.6772 90.9203 Constraint (T0288)I21.CB (T0288)V68.CB 6.4478 10.7463 13.9702 90.9203 Constraint (T0288)I21.CB (T0288)K67.CB 4.1570 6.9284 9.0069 90.9203 Constraint (T0288)I21.CB (T0288)I62.CB 5.6943 9.4905 12.3377 90.9203 Constraint (T0288)I21.CB (T0288)V57.CB 6.1872 10.3121 13.4057 90.9203 Constraint (T0288)I21.CB (T0288)T55.CB 7.4643 12.4406 16.1727 90.9203 Constraint (T0288)I21.CB (T0288)I54.CB 4.1369 6.8948 8.9633 90.9203 Constraint (T0288)I21.CB (T0288)E53.CB 6.0434 10.0724 13.0941 90.9203 Constraint (T0288)I21.CB (T0288)D52.CB 5.9513 9.9188 12.8944 90.9203 Constraint (T0288)I21.CB (T0288)A50.CB 6.4091 10.6818 13.8863 90.9203 Constraint (T0288)I21.CB (T0288)A49.CB 7.7878 12.9797 16.8736 90.9203 Constraint (T0288)I21.CB (T0288)F37.CB 7.4496 12.4161 16.1409 90.9203 Constraint (T0288)I21.CB (T0288)V36.CB 6.4855 10.8091 14.0519 90.9203 Constraint (T0288)I21.CB (T0288)Q35.CB 5.3809 8.9682 11.6587 90.9203 Constraint (T0288)I21.CB (T0288)V34.CB 3.8070 6.3450 8.2485 90.9203 Constraint (T0288)I21.CB (T0288)I33.CB 3.6511 6.0851 7.9107 90.9203 Constraint (T0288)I21.CB (T0288)Y32.CB 3.9681 6.6135 8.5976 90.9203 Constraint (T0288)S20.CB (T0288)I74.CB 6.4191 10.6984 13.9079 90.9203 Constraint (T0288)S20.CB (T0288)A71.CB 6.0373 10.0621 13.0807 90.9203 Constraint (T0288)S20.CB (T0288)V70.CB 6.9607 11.6012 15.0815 90.9203 Constraint (T0288)S20.CB (T0288)K67.CB 6.5785 10.9641 14.2534 90.9203 Constraint (T0288)S20.CB (T0288)I54.CB 6.8813 11.4689 14.9096 90.9203 Constraint (T0288)S20.CB (T0288)E53.CB 8.3766 13.9610 18.1493 90.9203 Constraint (T0288)S20.CB (T0288)D52.CB 7.1015 11.8359 15.3866 90.9203 Constraint (T0288)S20.CB (T0288)A50.CB 5.4928 9.1547 11.9012 90.9203 Constraint (T0288)S20.CB (T0288)A49.CB 7.5708 12.6181 16.4035 90.9203 Constraint (T0288)S20.CB (T0288)D38.CB 7.5170 12.5284 16.2869 90.9203 Constraint (T0288)S20.CB (T0288)F37.CB 4.7892 7.9820 10.3766 90.9203 Constraint (T0288)S20.CB (T0288)V36.CB 4.7517 7.9196 10.2954 90.9203 Constraint (T0288)S20.CB (T0288)Q35.CB 2.6305 4.3842 5.6995 90.9203 Constraint (T0288)S20.CB (T0288)V34.CB 2.8756 4.7927 6.2305 90.9203 Constraint (T0288)S20.CB (T0288)I33.CB 4.2595 7.0992 9.2289 90.9203 Constraint (T0288)S20.CB (T0288)Y32.CB 5.7347 9.5578 12.4251 90.9203 Constraint (T0288)I19.CB (T0288)V77.CB 7.6897 12.8162 16.6611 90.9203 Constraint (T0288)I19.CB (T0288)I74.CB 5.3654 8.9424 11.6251 90.9203 Constraint (T0288)I19.CB (T0288)A71.CB 6.7987 11.3311 14.7305 90.9203 Constraint (T0288)I19.CB (T0288)V70.CB 6.9597 11.5994 15.0793 90.9203 Constraint (T0288)I19.CB (T0288)I62.CB 8.1806 13.6343 17.7246 90.9203 Constraint (T0288)I19.CB (T0288)V57.CB 7.0325 11.7209 15.2372 90.9203 Constraint (T0288)I19.CB (T0288)I54.CB 5.5098 9.1830 11.9379 90.9203 Constraint (T0288)I19.CB (T0288)E53.CB 7.5595 12.5992 16.3790 90.9203 Constraint (T0288)I19.CB (T0288)D52.CB 5.5074 9.1791 11.9328 90.9203 Constraint (T0288)I19.CB (T0288)A50.CB 5.2735 8.7892 11.4260 90.9203 Constraint (T0288)I19.CB (T0288)A49.CB 5.8772 9.7953 12.7339 90.9203 Constraint (T0288)I19.CB (T0288)A42.CB 2.8744 4.7907 6.2279 90.9203 Constraint (T0288)I19.CB (T0288)N39.CB 7.3616 12.2694 15.9502 90.9203 Constraint (T0288)I19.CB (T0288)D38.CB 6.7043 11.1738 14.5259 90.9203 Constraint (T0288)I19.CB (T0288)F37.CB 4.1038 6.8397 8.8916 90.9203 Constraint (T0288)I19.CB (T0288)V36.CB 3.1530 5.2550 6.8315 90.9203 Constraint (T0288)I19.CB (T0288)Q35.CB 4.0104 6.6840 8.6891 90.9203 Constraint (T0288)I19.CB (T0288)V34.CB 4.8079 8.0132 10.4172 90.9203 Constraint (T0288)I19.CB (T0288)I33.CB 3.2217 5.3695 6.9803 90.9203 Constraint (T0288)I19.CB (T0288)Y32.CB 6.1508 10.2513 13.3267 90.9203 Constraint (T0288)I17.CB (T0288)T82.CB 6.9187 11.5312 14.9906 90.9203 Constraint (T0288)I17.CB (T0288)V81.CB 3.8817 6.4696 8.4104 90.9203 Constraint (T0288)I17.CB (T0288)V77.CB 5.0569 8.4282 10.9567 90.9203 Constraint (T0288)I17.CB (T0288)I74.CB 4.0678 6.7797 8.8137 90.9203 Constraint (T0288)L44.CB (T0288)V81.CB 7.9960 13.3267 17.3247 90.9036 Constraint (T0288)L31.CB (T0288)V81.CB 8.3237 13.8729 18.0348 90.9007 Constraint (T0288)A50.CB (T0288)I83.CB 8.5094 14.1823 18.4370 90.9007 Constraint (T0288)A49.CB (T0288)I83.CB 7.2069 12.0115 15.6150 90.9007 Constraint (T0288)Y32.CB (T0288)I83.CB 7.4285 12.3808 16.0951 90.9007 Constraint (T0288)S61.CB (T0288)I83.CB 7.0850 11.8084 15.3509 90.8915 Constraint (T0288)R60.CB (T0288)I83.CB 6.3794 10.6324 13.8221 90.8915 Constraint (T0288)V48.CB (T0288)I83.CB 4.6519 7.7532 10.0791 90.8915 Constraint (T0288)P41.CB (T0288)I83.CB 6.6233 11.0388 14.3504 90.8915 Constraint (T0288)V57.CB (T0288)T66.CB 8.0768 13.4613 17.4997 90.6242 Constraint (T0288)P41.CB (T0288)N58.CB 8.8402 14.7337 19.1538 90.5917 Constraint (T0288)E53.CB (T0288)I74.CB 8.6765 14.4608 18.7990 90.5242 Constraint (T0288)I74.CB (T0288)H84.CB 7.9322 13.2203 17.1864 90.5127 Constraint (T0288)M73.CB (T0288)H84.CB 7.6677 12.7795 16.6134 90.5127 Constraint (T0288)V70.CB (T0288)H84.CB 7.5871 12.6452 16.4387 90.5127 Constraint (T0288)N58.CB (T0288)H84.CB 5.6277 9.3795 12.1934 90.5127 Constraint (T0288)V57.CB (T0288)H84.CB 4.7223 7.8705 10.2317 90.5127 Constraint (T0288)T55.CB (T0288)H84.CB 2.9989 4.9981 6.4976 90.5127 Constraint (T0288)I54.CB (T0288)H84.CB 4.4799 7.4665 9.7065 90.5127 Constraint (T0288)I33.CB (T0288)H84.CB 7.5480 12.5801 16.3541 90.5127 Constraint (T0288)E53.CB (T0288)T82.CB 9.2144 15.3573 19.9645 90.5126 Constraint (T0288)L31.CB (T0288)Q75.CB 8.3069 13.8448 17.9982 90.5125 Constraint (T0288)C30.CB (T0288)V70.CB 5.8072 9.6786 12.5822 90.2016 Constraint (T0288)C30.CB (T0288)V57.CB 7.6511 12.7518 16.5774 90.2016 Constraint (T0288)C30.CB (T0288)T55.CB 4.8316 8.0527 10.4686 90.2016 Constraint (T0288)C30.CB (T0288)I54.CB 4.6613 7.7688 10.0994 90.2016 Constraint (T0288)D52.CB (T0288)I83.CB 5.3426 8.9043 11.5756 90.1876 Constraint (T0288)I19.CB (T0288)T55.CB 8.8720 14.7867 19.2227 89.9204 Constraint (T0288)I19.CB (T0288)V81.CB 6.2533 10.4221 13.5487 89.9203 Constraint (T0288)E53.CB (T0288)I83.CB 6.2435 10.4058 13.5275 89.9127 Constraint (T0288)P41.CB (T0288)K78.CB 7.7588 12.9313 16.8107 89.8986 Constraint (T0288)D45.CB (T0288)I54.CB 8.1544 13.5907 17.6679 89.6037 Constraint (T0288)I33.CB (T0288)L44.CB 8.7384 14.5641 18.9333 89.6037 Constraint (T0288)K65.CB (T0288)I74.CB 6.3860 10.6433 13.8363 89.5028 Constraint (T0288)T55.CB (T0288)K65.CB 6.1976 10.3293 13.4281 89.5028 Constraint (T0288)I54.CB (T0288)K65.CB 5.6557 9.4262 12.2541 89.5028 Constraint (T0288)Y32.CB (T0288)K65.CB 7.4938 12.4897 16.2366 89.5028 Constraint (T0288)L31.CB (T0288)K63.CB 5.1065 8.5109 11.0642 89.2247 Constraint (T0288)I21.CB (T0288)V81.CB 7.5966 12.6611 16.4594 89.0466 Constraint (T0288)I19.CB (T0288)T82.CB 8.4869 14.1449 18.3884 89.0466 Constraint (T0288)A42.CB (T0288)N58.CB 9.0526 15.0877 19.6140 89.0093 Constraint (T0288)I17.CB (T0288)V48.CB 5.3501 8.9169 11.5920 88.9994 Constraint (T0288)I17.CB (T0288)D45.CB 5.9675 9.9458 12.9295 88.9994 Constraint (T0288)I17.CB (T0288)P41.CB 3.3610 5.6016 7.2821 88.9994 Constraint (T0288)I17.CB (T0288)T40.CB 4.3161 7.1935 9.3516 88.9994 Constraint (T0288)C30.CB (T0288)K67.CB 5.9226 9.8711 12.8324 88.9981 Constraint (T0288)D45.CB (T0288)E80.CB 7.0070 11.6783 15.1818 88.9036 Constraint (T0288)D45.CB (T0288)I83.CB 5.7597 9.5995 12.4793 88.9035 Constraint (T0288)R60.CB (T0288)E80.CB 8.5916 14.3193 18.6151 88.6770 Constraint (T0288)I17.CB (T0288)Y32.CB 8.7489 14.5815 18.9560 88.6204 Constraint (T0288)I17.CB (T0288)I62.CB 8.3963 13.9938 18.1919 88.6204 Constraint (T0288)I21.CB (T0288)Q75.CB 6.8332 11.3886 14.8052 88.6204 Constraint (T0288)I17.CB (T0288)A43.CB 6.1097 10.1828 13.2376 88.6204 Constraint (T0288)T40.CB (T0288)D52.CB 8.7192 14.5320 18.8916 88.5927 Constraint (T0288)Q35.CB (T0288)L44.CB 8.9628 14.9381 19.4195 88.5926 Constraint (T0288)I62.CB (T0288)H84.CB 5.3290 8.8817 11.5463 88.5248 Constraint (T0288)E53.CB (T0288)H84.CB 5.7634 9.6057 12.4874 88.5248 Constraint (T0288)I21.CB (T0288)V77.CB 7.9772 13.2954 17.2840 88.3215 Constraint (T0288)I21.CB (T0288)T66.CB 6.8698 11.4497 14.8846 88.2993 Constraint (T0288)I21.CB (T0288)K65.CB 6.3897 10.6495 13.8443 88.2993 Constraint (T0288)I21.CB (T0288)R60.CB 8.5905 14.3175 18.6128 88.2993 Constraint (T0288)I21.CB (T0288)V48.CB 6.5544 10.9241 14.2013 88.2993 Constraint (T0288)I21.CB (T0288)P41.CB 8.6950 14.4917 18.8392 88.2993 Constraint (T0288)S20.CB (T0288)V48.CB 6.5940 10.9901 14.2871 88.2993 Constraint (T0288)S20.CB (T0288)P41.CB 7.8959 13.1598 17.1078 88.2993 Constraint (T0288)S20.CB (T0288)T40.CB 6.4477 10.7462 13.9701 88.2993 Constraint (T0288)I19.CB (T0288)V48.CB 3.7648 6.2746 8.1570 88.2993 Constraint (T0288)I19.CB (T0288)D45.CB 6.2312 10.3854 13.5010 88.2993 Constraint (T0288)I19.CB (T0288)P41.CB 5.0755 8.4591 10.9969 88.2993 Constraint (T0288)I19.CB (T0288)T40.CB 4.4237 7.3728 9.5847 88.2993 Constraint (T0288)C30.CB (T0288)I62.CB 4.7234 7.8723 10.2340 88.2136 Constraint (T0288)C30.CB (T0288)E53.CB 3.3897 5.6495 7.3443 88.2136 Constraint (T0288)C30.CB (T0288)D52.CB 6.3016 10.5026 13.6534 88.2136 Constraint (T0288)I19.CB (T0288)M73.CB 8.0918 13.4864 17.5323 87.9204 Constraint (T0288)I21.CB (T0288)A42.CB 6.4918 10.8196 14.0655 87.9203 Constraint (T0288)S20.CB (T0288)A42.CB 5.7826 9.6377 12.5290 87.9203 Constraint (T0288)S20.CB (T0288)N39.CB 8.8519 14.7532 19.1791 87.9203 Constraint (T0288)S20.CB (T0288)Q75.CB 7.7980 12.9967 16.8957 87.9203 Constraint (T0288)I19.CB (T0288)Q75.CB 7.5381 12.5636 16.3326 87.9203 Constraint (T0288)I17.CB (T0288)E76.CB 7.3200 12.2000 15.8600 87.9203 Constraint (T0288)I17.CB (T0288)Q75.CB 5.6909 9.4849 12.3304 87.9203 Constraint (T0288)I19.CB (T0288)A43.CB 5.1571 8.5951 11.1737 87.9203 Constraint (T0288)I17.CB (T0288)E80.CB 6.3865 10.6441 13.8374 87.9203 Constraint (T0288)Y32.CB (T0288)H84.CB 8.1676 13.6127 17.6965 87.9009 Constraint (T0288)V70.CB (T0288)T82.CB 8.4212 14.0353 18.2459 87.9007 Constraint (T0288)S61.CB (T0288)H84.CB 5.3187 8.8644 11.5238 87.8917 Constraint (T0288)R60.CB (T0288)H84.CB 6.0382 10.0637 13.0829 87.8917 Constraint (T0288)V48.CB (T0288)H84.CB 6.9344 11.5574 15.0246 87.8917 Constraint (T0288)I54.CB (T0288)T66.CB 7.7475 12.9125 16.7862 87.6243 Constraint (T0288)T66.CB (T0288)E76.CB 8.9093 14.8489 19.3035 87.6242 Constraint (T0288)T66.CB (T0288)Q75.CB 8.4620 14.1033 18.3343 87.6242 Constraint (T0288)C30.CB (T0288)S61.CB 6.6943 11.1572 14.5043 87.5805 Constraint (T0288)D52.CB (T0288)H84.CB 6.0849 10.1415 13.1840 87.5248 Constraint (T0288)L31.CB (T0288)I83.CB 6.2864 10.4773 13.6205 87.5125 Constraint (T0288)V34.CB (T0288)I83.CB 8.7839 14.6398 19.0318 87.5125 Constraint (T0288)S20.CB (T0288)V57.CB 8.7380 14.5634 18.9324 87.2994 Constraint (T0288)A49.CB (T0288)H84.CB 8.4574 14.0956 18.3243 87.0986 Constraint (T0288)I17.CB (T0288)K78.CB 6.8795 11.4658 14.9055 87.0466 Constraint (T0288)S20.CB (T0288)M73.CB 8.9511 14.9185 19.3940 86.9205 Constraint (T0288)S20.CB (T0288)V68.CB 8.4232 14.0386 18.2502 86.9204 Constraint (T0288)T40.CB (T0288)I83.CB 8.1967 13.6612 17.7595 86.9036 Constraint (T0288)P41.CB (T0288)D52.CB 8.6782 14.4637 18.8028 86.6037 Constraint (T0288)E53.CB (T0288)K65.CB 7.2109 12.0182 15.6236 86.5029 Constraint (T0288)K65.CB (T0288)E76.CB 7.8346 13.0577 16.9750 86.5028 Constraint (T0288)K65.CB (T0288)Q75.CB 8.0301 13.3835 17.3985 86.5028 Constraint (T0288)V34.CB (T0288)I62.CB 8.8150 14.6916 19.0991 86.2247 Constraint (T0288)V48.CB (T0288)E80.CB 8.7124 14.5206 18.8768 86.1534 Constraint (T0288)I17.CB (T0288)L44.CB 6.5087 10.8479 14.1022 85.9994 Constraint (T0288)K63.CB (T0288)I83.CB 7.9745 13.2908 17.2780 85.9127 Constraint (T0288)L44.CB (T0288)I83.CB 8.2861 13.8101 17.9532 85.9035 Constraint (T0288)I17.CB (T0288)L31.CB 7.8967 13.1612 17.1095 85.6204 Constraint (T0288)K63.CB (T0288)I74.CB 8.8891 14.8151 19.2597 85.5248 Constraint (T0288)V48.CB (T0288)V77.CB 8.8627 14.7711 19.2024 85.3034 Constraint (T0288)I19.CB (T0288)L44.CB 6.9698 11.6163 15.1012 85.2993 Constraint (T0288)C30.CB (T0288)K63.CB 4.4290 7.3817 9.5963 85.2136 Constraint (T0288)I21.CB (T0288)A43.CB 8.9297 14.8828 19.3477 84.9203 Constraint (T0288)S20.CB (T0288)A43.CB 7.2575 12.0958 15.7245 84.9203 Constraint (T0288)I19.CB (T0288)K67.CB 7.9503 13.2505 17.2256 84.9203 Constraint (T0288)I21.CB (T0288)L31.CB 3.1659 5.2764 6.8594 84.9203 Constraint (T0288)S20.CB (T0288)L31.CB 6.4079 10.6798 13.8837 84.9203 Constraint (T0288)I19.CB (T0288)L31.CB 6.4878 10.8129 14.0568 84.9203 Constraint (T0288)I21.CB (T0288)K63.CB 8.1096 13.5160 17.5708 84.9203 Constraint (T0288)S20.CB (T0288)I62.CB 8.9184 14.8640 19.3232 84.9203 Constraint (T0288)I21.CB (T0288)I83.CB 6.4119 10.6866 13.8925 84.9203 Constraint (T0288)I19.CB (T0288)I83.CB 5.6494 9.4157 12.2404 84.9203 Constraint (T0288)I17.CB (T0288)I83.CB 5.2830 8.8051 11.4466 84.9203 Constraint (T0288)L31.CB (T0288)T82.CB 9.0674 15.1123 19.6460 84.9008 Constraint (T0288)P41.CB (T0288)Q75.CB 8.4849 14.1414 18.3839 84.8916 Constraint (T0288)L31.CB (T0288)T66.CB 5.5122 9.1870 11.9431 84.6242 Constraint (T0288)V48.CB (T0288)V70.CB 8.5711 14.2852 18.5707 84.5919 Constraint (T0288)A42.CB (T0288)H84.CB 8.4196 14.0326 18.2424 84.5128 Constraint (T0288)L31.CB (T0288)H84.CB 6.9580 11.5966 15.0756 84.5127 Constraint (T0288)A42.CB (T0288)Q75.CB 8.7528 14.5880 18.9644 84.5126 Constraint (T0288)Q10.CB (T0288)V48.CB 7.3230 12.2051 15.8666 84.2932 Constraint (T0288)Q10.CB (T0288)A42.CB 6.0516 10.0861 13.1119 84.2932 Constraint (T0288)L9.CB (T0288)I74.CB 6.4677 10.7795 14.0133 84.2932 Constraint (T0288)L9.CB (T0288)V57.CB 6.2583 10.4306 13.5597 84.2932 Constraint (T0288)L9.CB (T0288)V48.CB 5.0159 8.3599 10.8679 84.2932 Constraint (T0288)L9.CB (T0288)A42.CB 4.3094 7.1823 9.3370 84.2932 Constraint (T0288)L9.CB (T0288)P41.CB 3.6431 6.0719 7.8934 84.2932 Constraint (T0288)T8.CB (T0288)V57.CB 6.7447 11.2412 14.6136 84.2932 Constraint (T0288)T8.CB (T0288)I54.CB 7.7683 12.9472 16.8314 84.2932 Constraint (T0288)T8.CB (T0288)V48.CB 6.1812 10.3020 13.3926 84.2932 Constraint (T0288)T8.CB (T0288)A42.CB 6.5080 10.8467 14.1007 84.2932 Constraint (T0288)T8.CB (T0288)P41.CB 6.1371 10.2285 13.2970 84.2932 Constraint (T0288)S61.CB (T0288)V77.CB 8.8137 14.6894 19.0963 84.2922 Constraint (T0288)A42.CB (T0288)V70.CB 8.4606 14.1010 18.3313 84.2130 Constraint (T0288)S20.CB (T0288)I83.CB 8.2430 13.7384 17.8599 84.0466 Constraint (T0288)Q10.CB (T0288)I19.CB 7.7044 12.8406 16.6928 84.0375 Constraint (T0288)K63.CB (T0288)H84.CB 6.3798 10.6330 13.8229 83.9129 Constraint (T0288)L44.CB (T0288)E80.CB 8.2176 13.6960 17.8048 83.9036 Constraint (T0288)V57.CB (T0288)K78.CB 7.2593 12.0989 15.7286 83.7813 Constraint (T0288)L9.CB (T0288)I19.CB 5.7816 9.6360 12.5268 83.6363 Constraint (T0288)Y32.CB (T0288)T66.CB 8.1132 13.5219 17.5785 83.6245 Constraint (T0288)L31.CB (T0288)K65.CB 4.1818 6.9696 9.0605 83.5028 Constraint (T0288)F37.CB (T0288)V81.CB 8.8304 14.7173 19.1325 83.2994 Constraint (T0288)Q10.CB (T0288)T82.CB 5.8832 9.8053 12.7469 83.2993 Constraint (T0288)Q10.CB (T0288)V81.CB 4.3782 7.2970 9.4861 83.2993 Constraint (T0288)Q10.CB (T0288)V77.CB 6.2849 10.4748 13.6173 83.2993 Constraint (T0288)Q10.CB (T0288)N58.CB 7.4042 12.3404 16.0425 83.2993 Constraint (T0288)Q10.CB (T0288)D45.CB 5.2339 8.7232 11.3401 83.2993 Constraint (T0288)Q10.CB (T0288)P41.CB 3.8415 6.4025 8.3232 83.2993 Constraint (T0288)Q10.CB (T0288)T40.CB 6.5164 10.8607 14.1189 83.2993 Constraint (T0288)L9.CB (T0288)T82.CB 4.4724 7.4540 9.6902 83.2993 Constraint (T0288)L9.CB (T0288)V81.CB 3.1716 5.2860 6.8718 83.2993 Constraint (T0288)L9.CB (T0288)V77.CB 5.7653 9.6089 12.4916 83.2993 Constraint (T0288)L9.CB (T0288)N58.CB 6.2757 10.4595 13.5973 83.2993 Constraint (T0288)L9.CB (T0288)D45.CB 3.9057 6.5096 8.4625 83.2993 Constraint (T0288)T8.CB (T0288)T82.CB 3.2353 5.3922 7.0099 83.2993 Constraint (T0288)T8.CB (T0288)V81.CB 4.4495 7.4159 9.6407 83.2993 Constraint (T0288)T8.CB (T0288)V77.CB 7.0203 11.7005 15.2107 83.2993 Constraint (T0288)T8.CB (T0288)N58.CB 6.0898 10.1496 13.1945 83.2993 Constraint (T0288)T8.CB (T0288)T55.CB 8.5281 14.2135 18.4776 83.2993 Constraint (T0288)T8.CB (T0288)I19.CB 8.0688 13.4480 17.4824 83.2993 Constraint (T0288)T8.CB (T0288)I17.CB 6.6761 11.1269 14.4650 83.2993 Constraint (T0288)V7.CB (T0288)T82.CB 4.3451 7.2418 9.4143 83.2993 Constraint (T0288)V7.CB (T0288)V81.CB 5.4671 9.1118 11.8453 83.2993 Constraint (T0288)V7.CB (T0288)N58.CB 6.9718 11.6196 15.1055 83.2993 Constraint (T0288)V7.CB (T0288)V57.CB 6.4270 10.7117 13.9252 83.2993 Constraint (T0288)V7.CB (T0288)T55.CB 6.6668 11.1113 14.4447 83.2993 Constraint (T0288)V7.CB (T0288)I54.CB 6.0015 10.0026 13.0033 83.2993 Constraint (T0288)V7.CB (T0288)D52.CB 5.7174 9.5290 12.3877 83.2993 Constraint (T0288)V7.CB (T0288)V48.CB 4.2438 7.0730 9.1949 83.2993 Constraint (T0288)V7.CB (T0288)D45.CB 4.2418 7.0697 9.1907 83.2993 Constraint (T0288)L9.CB (T0288)I54.CB 7.0706 11.7844 15.3197 83.2932 Constraint (T0288)C30.CB (T0288)E69.CB 7.2313 12.0521 15.6677 83.2018 Constraint (T0288)Y32.CB (T0288)M73.CB 9.0942 15.1570 19.7042 82.8242 Constraint (T0288)Q35.CB (T0288)I83.CB 9.1323 15.2205 19.7866 82.5127 Constraint (T0288)I33.CB (T0288)K65.CB 8.6578 14.4297 18.7586 82.5030 Constraint (T0288)I21.CB (T0288)E76.CB 8.6114 14.3524 18.6581 82.3215 Constraint (T0288)I21.CB (T0288)T40.CB 8.1867 13.6445 17.7378 82.2994 Constraint (T0288)V7.CB (T0288)A42.CB 5.6015 9.3358 12.1365 82.2993 Constraint (T0288)L9.CB (T0288)D52.CB 7.7222 12.8703 16.7313 82.2993 Constraint (T0288)T8.CB (T0288)R60.CB 8.9446 14.9077 19.3800 82.2993 Constraint (T0288)V7.CB (T0288)I62.CB 8.2823 13.8038 17.9449 82.2993 Constraint (T0288)V7.CB (T0288)E53.CB 7.4467 12.4112 16.1345 82.2993 Constraint (T0288)V7.CB (T0288)A49.CB 6.5217 10.8694 14.1303 82.2993 Constraint (T0288)V7.CB (T0288)I33.CB 6.7611 11.2686 14.6491 82.2993 Constraint (T0288)V7.CB (T0288)I17.CB 6.7185 11.1975 14.5568 82.2993 Constraint (T0288)K6.CB (T0288)T82.CB 4.3573 7.2622 9.4409 82.2993 Constraint (T0288)K6.CB (T0288)I62.CB 8.4175 14.0292 18.2380 82.2993 Constraint (T0288)K6.CB (T0288)V57.CB 6.9752 11.6254 15.1130 82.2993 Constraint (T0288)K6.CB (T0288)T55.CB 6.0300 10.0500 13.0650 82.2993 Constraint (T0288)K6.CB (T0288)I54.CB 6.8711 11.4519 14.8875 82.2993 Constraint (T0288)K6.CB (T0288)E53.CB 7.7915 12.9859 16.8817 82.2993 Constraint (T0288)K6.CB (T0288)D52.CB 6.9522 11.5869 15.0630 82.2993 Constraint (T0288)K6.CB (T0288)V48.CB 6.7234 11.2057 14.5674 82.2993 Constraint (T0288)T8.CB (T0288)D45.CB 4.6367 7.7279 10.0462 82.2993 Constraint (T0288)L9.CB (T0288)I33.CB 7.2877 12.1461 15.7900 82.2932 Constraint (T0288)Q10.CB (T0288)V57.CB 8.1092 13.5154 17.5700 82.2932 Constraint (T0288)Q35.CB (T0288)V70.CB 8.8890 14.8149 19.2594 82.2250 Constraint (T0288)A42.CB (T0288)A71.CB 8.6285 14.3809 18.6951 82.2127 Constraint (T0288)K65.CB (T0288)I83.CB 7.9910 13.3183 17.3138 82.1016 Constraint (T0288)C30.CB (T0288)I83.CB 8.0139 13.3565 17.3635 82.1003 Constraint (T0288)I21.CB (T0288)C30.CB 5.9905 9.9841 12.9793 81.9203 Constraint (T0288)S20.CB (T0288)C30.CB 8.7858 14.6431 19.0360 81.9203 Constraint (T0288)T55.CB (T0288)T66.CB 8.9325 14.8875 19.3537 81.6245 Constraint (T0288)Y32.CB (T0288)S61.CB 9.1334 15.2223 19.7890 81.5917 Constraint (T0288)Q10.CB (T0288)I74.CB 7.8563 13.0938 17.0219 81.2993 Constraint (T0288)V7.CB (T0288)R60.CB 8.9024 14.8374 19.2886 81.2993 Constraint (T0288)K6.CB (T0288)N58.CB 7.0385 11.7308 15.2500 81.2993 Constraint (T0288)L9.CB (T0288)T40.CB 5.9234 9.8723 12.8339 81.2993 Constraint (T0288)T8.CB (T0288)I74.CB 8.1769 13.6282 17.7167 81.2932 Constraint (T0288)C30.CB (T0288)T66.CB 6.6431 11.0719 14.3935 81.2872 Constraint (T0288)E53.CB (T0288)M73.CB 8.9453 14.9088 19.3814 81.2139 Constraint (T0288)C30.CB (T0288)A71.CB 8.2119 13.6865 17.7924 81.2017 Constraint (T0288)C30.CB (T0288)A50.CB 8.4356 14.0593 18.2771 81.2016 Constraint (T0288)F37.CB (T0288)I83.CB 9.1062 15.1770 19.7301 81.0986 Constraint (T0288)I21.CB (T0288)H84.CB 8.3985 13.9975 18.1967 81.0469 Constraint (T0288)D52.CB (T0288)K67.CB 8.9745 14.9575 19.4447 81.0215 Constraint (T0288)Q35.CB (T0288)K67.CB 8.4072 14.0120 18.2156 81.0215 Constraint (T0288)I19.CB (T0288)H84.CB 8.5825 14.3041 18.5953 80.9207 Constraint (T0288)L31.CB (T0288)V77.CB 8.6251 14.3752 18.6878 80.9133 Constraint (T0288)I54.CB (T0288)E76.CB 8.8286 14.7144 19.1287 80.9100 Constraint (T0288)C30.CB (T0288)K65.CB 5.5031 9.1719 11.9235 80.5028 Constraint (T0288)S20.CB (T0288)V81.CB 8.7012 14.5020 18.8527 80.2994 Constraint (T0288)K6.CB (T0288)V81.CB 6.9189 11.5316 14.9910 80.2993 Constraint (T0288)K6.CB (T0288)S61.CB 8.3770 13.9616 18.1501 80.2993 Constraint (T0288)V7.CB (T0288)V77.CB 7.9890 13.3151 17.3096 80.2993 Constraint (T0288)Q10.CB (T0288)K78.CB 6.0546 10.0910 13.1182 80.2993 Constraint (T0288)V7.CB (T0288)P41.CB 6.5268 10.8781 14.1415 80.2993 Constraint (T0288)Q10.CB (T0288)E80.CB 3.5631 5.9385 7.7201 80.2993 Constraint (T0288)Q10.CB (T0288)L44.CB 5.6753 9.4588 12.2965 80.2993 Constraint (T0288)Q10.CB (T0288)A43.CB 7.4697 12.4495 16.1844 80.2993 Constraint (T0288)L9.CB (T0288)E80.CB 4.3150 7.1916 9.3491 80.2993 Constraint (T0288)L9.CB (T0288)L44.CB 5.5365 9.2276 11.9958 80.2993 Constraint (T0288)T8.CB (T0288)E80.CB 4.2911 7.1518 9.2973 80.2993 Constraint (T0288)T8.CB (T0288)L44.CB 6.9531 11.5884 15.0649 80.2993 Constraint (T0288)Q14.CB (T0288)V81.CB 7.9394 13.2324 17.2021 80.2993 Constraint (T0288)Q14.CB (T0288)P41.CB 5.9823 9.9705 12.9617 80.2993 Constraint (T0288)Q14.CB (T0288)T40.CB 6.3685 10.6142 13.7985 80.2993 Constraint (T0288)A13.CB (T0288)V81.CB 7.5130 12.5216 16.2781 80.2993 Constraint (T0288)N15.CB (T0288)V81.CB 6.8287 11.3811 14.7955 80.2993 Constraint (T0288)N15.CB (T0288)I74.CB 6.5443 10.9072 14.1794 80.2993 Constraint (T0288)N15.CB (T0288)P41.CB 5.1443 8.5738 11.1460 80.2993 Constraint (T0288)N15.CB (T0288)T40.CB 5.3466 8.9110 11.5843 80.2993 Constraint (T0288)N15.CB (T0288)F37.CB 5.9358 9.8931 12.8610 80.2993 Constraint (T0288)C30.CB (T0288)M73.CB 8.3435 13.9058 18.0775 80.2018 Constraint (T0288)C30.CB (T0288)V68.CB 8.2773 13.7956 17.9342 80.2018 Constraint (T0288)L9.CB (T0288)M73.CB 8.3587 13.9311 18.1105 80.1932 Constraint (T0288)K65.CB (T0288)H84.CB 7.9617 13.2695 17.2504 80.1018 Constraint (T0288)I33.CB (T0288)K63.CB 8.7911 14.6519 19.0475 79.9247 Constraint (T0288)C30.CB (T0288)H84.CB 7.4667 12.4444 16.1778 79.5017 Constraint (T0288)K6.CB (T0288)I33.CB 8.6083 14.3472 18.6513 79.2994 Constraint (T0288)K65.CB (T0288)V77.CB 8.3266 13.8776 18.0409 79.2994 Constraint (T0288)I21.CB (T0288)S61.CB 8.9549 14.9248 19.4022 79.2993 Constraint (T0288)V7.CB (T0288)I19.CB 6.7708 11.2846 14.6700 79.2993 Constraint (T0288)V7.CB (T0288)I74.CB 8.0245 13.3742 17.3864 79.2993 Constraint (T0288)K6.CB (T0288)D45.CB 6.6370 11.0617 14.3802 79.2993 Constraint (T0288)A13.CB (T0288)P41.CB 5.8207 9.7012 12.6115 79.2993 Constraint (T0288)L9.CB (T0288)T55.CB 8.9226 14.8709 19.3322 79.2934 Constraint (T0288)D52.CB (T0288)K63.CB 8.2892 13.8153 17.9599 79.2243 Constraint (T0288)N15.CB (T0288)V77.CB 6.5617 10.9361 14.2170 79.1993 Constraint (T0288)T55.CB (T0288)N86.CB 4.2098 7.0164 9.1213 78.9684 Constraint (T0288)I19.CB (T0288)C30.CB 8.9671 14.9451 19.4287 78.9204 Constraint (T0288)D45.CB (T0288)H84.CB 7.9723 13.2872 17.2734 78.9038 Constraint (T0288)T40.CB (T0288)E80.CB 8.7726 14.6210 19.0074 78.9037 Constraint (T0288)T55.CB (T0288)Y85.CB 4.5736 7.6227 9.9094 78.8686 Constraint (T0288)A49.CB (T0288)Y85.CB 5.2329 8.7215 11.3380 78.8686 Constraint (T0288)I33.CB (T0288)Y85.CB 5.0283 8.3805 10.8946 78.8686 Constraint (T0288)Y32.CB (T0288)Y85.CB 5.9725 9.9542 12.9405 78.8686 Constraint (T0288)E53.CB (T0288)T66.CB 8.9418 14.9030 19.3738 78.6365 Constraint (T0288)T8.CB (T0288)D52.CB 8.1852 13.6419 17.7345 78.2994 Constraint (T0288)V7.CB (T0288)E80.CB 6.7034 11.1723 14.5240 78.2993 Constraint (T0288)K6.CB (T0288)A42.CB 8.3097 13.8496 18.0045 78.2993 Constraint (T0288)L9.CB (T0288)K78.CB 6.8901 11.4835 14.9286 78.2993 Constraint (T0288)K11.CB (T0288)V81.CB 4.0697 6.7828 8.8176 78.2993 Constraint (T0288)K11.CB (T0288)A42.CB 6.0236 10.0393 13.0511 78.2993 Constraint (T0288)K11.CB (T0288)P41.CB 3.8415 6.4024 8.3231 78.2993 Constraint (T0288)K11.CB (T0288)T40.CB 5.9941 9.9902 12.9873 78.2993 Constraint (T0288)L9.CB (T0288)A43.CB 6.3999 10.6666 13.8666 78.2993 Constraint (T0288)K11.CB (T0288)I74.CB 6.2699 10.4498 13.5847 78.2932 Constraint (T0288)K11.CB (T0288)V57.CB 7.5909 12.6515 16.4470 78.2932 Constraint (T0288)T8.CB (T0288)I33.CB 8.7150 14.5250 18.8826 78.2932 Constraint (T0288)L9.CB (T0288)A49.CB 8.0640 13.4400 17.4720 78.2932 Constraint (T0288)L9.CB (T0288)I83.CB 4.2742 7.1237 9.2608 78.2932 Constraint (T0288)T8.CB (T0288)I83.CB 4.4701 7.4501 9.6851 78.2932 Constraint (T0288)A13.CB (T0288)V77.CB 7.4427 12.4046 16.1259 78.0993 Constraint (T0288)A49.CB (T0288)K87.CB 5.0334 8.3890 10.9056 78.0947 Constraint (T0288)I21.CB (T0288)N58.CB 8.7932 14.6553 19.0519 77.9994 Constraint (T0288)C30.CB (T0288)A49.CB 8.9895 14.9825 19.4773 77.9982 Constraint (T0288)I17.CB (T0288)H84.CB 8.5558 14.2596 18.5375 77.9207 Constraint (T0288)A50.CB (T0288)Y85.CB 6.7865 11.3109 14.7042 77.8686 Constraint (T0288)I54.CB (T0288)Y85.CB 4.0265 6.7109 8.7242 77.8686 Constraint (T0288)D45.CB (T0288)V57.CB 8.4622 14.1037 18.3349 77.6037 Constraint (T0288)Q14.CB (T0288)F37.CB 7.0985 11.8309 15.3801 77.2994 Constraint (T0288)N15.CB (T0288)A42.CB 6.5836 10.9727 14.2646 77.2993 Constraint (T0288)K11.CB (T0288)T82.CB 6.8461 11.4102 14.8332 77.2993 Constraint (T0288)K11.CB (T0288)V77.CB 4.7804 7.9674 10.3576 77.2993 Constraint (T0288)K11.CB (T0288)N58.CB 7.1910 11.9850 15.5805 77.2993 Constraint (T0288)K11.CB (T0288)V48.CB 7.7960 12.9934 16.8914 77.2993 Constraint (T0288)D12.CB (T0288)V81.CB 6.2515 10.4191 13.5449 77.2993 Constraint (T0288)D12.CB (T0288)V77.CB 6.9435 11.5725 15.0443 77.2993 Constraint (T0288)D12.CB (T0288)A42.CB 6.8496 11.4159 14.8407 77.2993 Constraint (T0288)D12.CB (T0288)P41.CB 4.2256 7.0427 9.1555 77.2993 Constraint (T0288)D12.CB (T0288)T40.CB 5.7307 9.5512 12.4165 77.2993 Constraint (T0288)Q10.CB (T0288)I83.CB 6.6754 11.1256 14.4633 77.2993 Constraint (T0288)V7.CB (T0288)I83.CB 3.2503 5.4171 7.0422 77.2993 Constraint (T0288)N15.CB (T0288)Q75.CB 6.0908 10.1513 13.1967 77.2993 Constraint (T0288)L9.CB (T0288)V36.CB 6.8826 11.4710 14.9123 77.2932 Constraint (T0288)E53.CB (T0288)K87.CB 4.9244 8.2073 10.6695 77.1068 Constraint (T0288)E53.CB (T0288)N86.CB 3.3535 5.5891 7.2658 76.9804 Constraint (T0288)D52.CB (T0288)N86.CB 4.5129 7.5215 9.7780 76.9804 Constraint (T0288)I54.CB (T0288)N86.CB 5.4155 9.0258 11.7335 76.9684 Constraint (T0288)E53.CB (T0288)Y85.CB 4.0029 6.6716 8.6730 76.8806 Constraint (T0288)D52.CB (T0288)Y85.CB 3.0717 5.1195 6.6553 76.8806 Constraint (T0288)S61.CB (T0288)A71.CB 9.0289 15.0481 19.5625 76.5920 Constraint (T0288)A49.CB (T0288)N86.CB 6.7422 11.2371 14.6082 76.5672 Constraint (T0288)A13.CB (T0288)T40.CB 6.8763 11.4605 14.8987 76.2994 Constraint (T0288)L9.CB (T0288)R60.CB 8.9903 14.9838 19.4789 76.2994 Constraint (T0288)K11.CB (T0288)D45.CB 6.5901 10.9836 14.2786 76.2993 Constraint (T0288)D12.CB (T0288)Q75.CB 8.1954 13.6590 17.7566 76.2993 Constraint (T0288)K6.CB (T0288)I83.CB 4.5084 7.5139 9.7681 76.2993 Constraint (T0288)A13.CB (T0288)E80.CB 7.1123 11.8538 15.4099 76.2993 Constraint (T0288)Y32.CB (T0288)K87.CB 6.6948 11.1581 14.5055 76.2565 Constraint (T0288)N15.CB (T0288)K78.CB 7.0610 11.7683 15.2988 76.1993 Constraint (T0288)V48.CB (T0288)Y85.CB 4.6678 7.7796 10.1135 76.1212 Constraint (T0288)D52.CB (T0288)K87.CB 3.9983 6.6639 8.6630 76.1068 Constraint (T0288)I33.CB (T0288)K87.CB 6.4983 10.8305 14.0796 76.1008 Constraint (T0288)A13.CB (T0288)K78.CB 6.2677 10.4461 13.5799 76.0993 Constraint (T0288)A25.CB (T0288)K67.CB 5.6126 9.3544 12.1607 75.9995 Constraint (T0288)T55.CB (T0288)K87.CB 6.6169 11.0282 14.3367 75.9947 Constraint (T0288)I33.CB (T0288)N86.CB 6.6632 11.1054 14.4370 75.9684 Constraint (T0288)Y32.CB (T0288)N86.CB 6.1622 10.2703 13.3514 75.9684 Constraint (T0288)K72.CB (T0288)I83.CB 8.7661 14.6102 18.9932 75.5128 Constraint (T0288)K11.CB (T0288)K78.CB 4.9898 8.3164 10.8113 75.2993 Constraint (T0288)K11.CB (T0288)Q75.CB 6.7270 11.2116 14.5751 75.2993 Constraint (T0288)K11.CB (T0288)E80.CB 4.4027 7.3378 9.5392 75.2993 Constraint (T0288)K11.CB (T0288)L44.CB 6.7669 11.2781 14.6615 75.2993 Constraint (T0288)K11.CB (T0288)A43.CB 7.8051 13.0086 16.9111 75.2993 Constraint (T0288)T8.CB (T0288)A43.CB 8.2080 13.6800 17.7841 75.2993 Constraint (T0288)L9.CB (T0288)H84.CB 7.0836 11.8061 15.3479 75.2935 Constraint (T0288)E69.CB (T0288)V81.CB 8.8725 14.7875 19.2238 74.9269 Constraint (T0288)A50.CB (T0288)K87.CB 6.6106 11.0177 14.3231 74.3626 Constraint (T0288)K6.CB (T0288)A49.CB 8.1052 13.5086 17.5612 74.2996 Constraint (T0288)T8.CB (T0288)H84.CB 5.9776 9.9626 12.9514 74.2995 Constraint (T0288)V7.CB (T0288)H84.CB 4.4785 7.4642 9.7035 74.2995 Constraint (T0288)D12.CB (T0288)I74.CB 8.0791 13.4651 17.5047 74.2993 Constraint (T0288)K11.CB (T0288)F37.CB 7.6258 12.7097 16.5225 74.2993 Constraint (T0288)D12.CB (T0288)E80.CB 5.9759 9.9599 12.9478 74.2993 Constraint (T0288)D12.CB (T0288)L44.CB 6.7433 11.2388 14.6105 74.2993 Constraint (T0288)R60.CB (T0288)K78.CB 8.1030 13.5051 17.5566 74.2958 Constraint (T0288)T40.CB (T0288)V77.CB 8.7381 14.5635 18.9325 74.2141 Constraint (T0288)T8.CB (T0288)K78.CB 7.6668 12.7780 16.6114 74.1993 Constraint (T0288)E69.CB (T0288)I83.CB 8.5927 14.3212 18.6176 74.1758 Constraint (T0288)Q14.CB (T0288)K78.CB 7.0974 11.8290 15.3777 73.9993 Constraint (T0288)I54.CB (T0288)K87.CB 6.7800 11.3000 14.6900 73.9947 Constraint (T0288)V36.CB (T0288)Y85.CB 7.2979 12.1632 15.8121 73.8686 Constraint (T0288)C30.CB (T0288)I74.CB 8.6301 14.3835 18.6985 73.5122 Constraint (T0288)A25.CB (T0288)K63.CB 7.2514 12.0856 15.7113 73.3901 Constraint (T0288)A50.CB (T0288)N86.CB 7.9271 13.2118 17.1754 73.3566 Constraint (T0288)K6.CB (T0288)H84.CB 3.4547 5.7578 7.4851 73.2995 Constraint (T0288)D12.CB (T0288)K78.CB 6.1888 10.3147 13.4091 73.2993 Constraint (T0288)K11.CB (T0288)E76.CB 7.3475 12.2458 15.9195 73.2993 Constraint (T0288)K11.CB (T0288)V36.CB 8.6019 14.3365 18.6374 73.2993 Constraint (T0288)V48.CB (T0288)K87.CB 6.3647 10.6078 13.7901 73.2271 Constraint (T0288)V48.CB (T0288)N86.CB 7.2131 12.0218 15.6283 73.2211 Constraint (T0288)N15.CB (T0288)E80.CB 7.9245 13.2076 17.1698 73.1994 Constraint (T0288)V7.CB (T0288)L44.CB 6.7720 11.2867 14.6727 73.1993 Constraint (T0288)I62.CB (T0288)Y85.CB 6.5121 10.8535 14.1095 72.8806 Constraint (T0288)L31.CB (T0288)Y85.CB 6.3192 10.5321 13.6917 72.8686 Constraint (T0288)I17.CB (T0288)K67.CB 8.9571 14.9286 19.4071 72.6206 Constraint (T0288)C30.CB (T0288)V48.CB 8.9767 14.9612 19.4495 72.5807 Constraint (T0288)C30.CB (T0288)R60.CB 8.3853 13.9756 18.1682 72.5805 Constraint (T0288)Q14.CB (T0288)Q75.CB 7.2548 12.0914 15.7188 72.2993 Constraint (T0288)K11.CB (T0288)I83.CB 7.1060 11.8434 15.3964 72.2932 Constraint (T0288)L9.CB (T0288)E76.CB 8.7801 14.6334 19.0235 72.1993 Constraint (T0288)L9.CB (T0288)F37.CB 7.3260 12.2100 15.8730 72.1933 Constraint (T0288)I19.CB (T0288)N58.CB 8.8539 14.7565 19.1834 71.9995 Constraint (T0288)S20.CB (T0288)K72.CB 8.8589 14.7649 19.1944 71.9204 Constraint (T0288)V34.CB (T0288)Y85.CB 8.0138 13.3563 17.3632 71.8807 Constraint (T0288)A42.CB (T0288)Y85.CB 6.5861 10.9768 14.2699 71.8686 Constraint (T0288)L9.CB (T0288)I21.CB 8.0371 13.3951 17.4136 71.5363 Constraint (T0288)P4.CB (T0288)T55.CB 4.6778 7.7964 10.1353 71.2996 Constraint (T0288)P4.CB (T0288)I54.CB 6.9371 11.5619 15.0305 71.2996 Constraint (T0288)P4.CB (T0288)E53.CB 5.9034 9.8391 12.7908 71.2996 Constraint (T0288)P4.CB (T0288)D52.CB 6.2797 10.4661 13.6059 71.2996 Constraint (T0288)T8.CB (T0288)T40.CB 8.2936 13.8227 17.9696 71.2994 Constraint (T0288)D12.CB (T0288)N39.CB 7.1925 11.9875 15.5838 71.2994 Constraint (T0288)D12.CB (T0288)D45.CB 7.3607 12.2679 15.9482 71.2993 Constraint (T0288)E53.CB (T0288)A71.CB 9.0808 15.1346 19.6750 71.2356 Constraint (T0288)L9.CB (T0288)N39.CB 8.2120 13.6867 17.7927 71.1993 Constraint (T0288)V7.CB (T0288)A43.CB 7.1673 11.9455 15.5292 71.1993 Constraint (T0288)L9.CB (T0288)Q75.CB 8.1888 13.6480 17.7424 71.1933 Constraint (T0288)Q14.CB (T0288)V77.CB 7.4818 12.4696 16.2105 70.9993 Constraint (T0288)D45.CB (T0288)I74.CB 8.4993 14.1655 18.4152 70.9037 Constraint (T0288)A13.CB (T0288)A42.CB 8.1262 13.5436 17.6067 70.2994 Constraint (T0288)Q10.CB (T0288)N39.CB 8.2509 13.7515 17.8770 70.2994 Constraint (T0288)I33.CB (T0288)V77.CB 9.1533 15.2554 19.8321 70.2994 Constraint (T0288)Q10.CB (T0288)V36.CB 8.6326 14.3877 18.7041 70.2934 Constraint (T0288)T55.CB (T0288)A71.CB 9.2420 15.4034 20.0244 70.2234 Constraint (T0288)V7.CB (T0288)A50.CB 8.3945 13.9909 18.1882 70.1993 Constraint (T0288)V7.CB (T0288)V36.CB 7.1747 11.9578 15.5452 70.1993 Constraint (T0288)V7.CB (T0288)Y32.CB 8.7498 14.5831 18.9580 70.1993 Constraint (T0288)K6.CB (T0288)R60.CB 8.3121 13.8535 18.0096 70.1993 Constraint (T0288)Q26.CB (T0288)K63.CB 7.2234 12.0390 15.6507 69.8995 Constraint (T0288)A25.CB (T0288)K65.CB 6.3837 10.6394 13.8313 69.7006 Constraint (T0288)C30.CB (T0288)N86.CB 5.8869 9.8116 12.7550 69.6314 Constraint (T0288)D52.CB (T0288)S61.CB 9.3303 15.5505 20.2156 69.5928 Constraint (T0288)C30.CB (T0288)Y85.CB 6.6488 11.0813 14.4057 69.5315 Constraint (T0288)T40.CB (T0288)Q75.CB 8.9873 14.9789 19.4726 69.5034 Constraint (T0288)I62.CB (T0288)N86.CB 6.8035 11.3391 14.7408 69.4793 Constraint (T0288)L16.CB (T0288)A71.CB 7.0896 11.8161 15.3609 69.4205 Constraint (T0288)L16.CB (T0288)N39.CB 7.2091 12.0152 15.6197 69.4205 Constraint (T0288)L16.CB (T0288)D38.CB 7.6799 12.7998 16.6397 69.4205 Constraint (T0288)L16.CB (T0288)F37.CB 4.8479 8.0798 10.5038 69.4205 Constraint (T0288)L16.CB (T0288)V36.CB 6.9018 11.5030 14.9538 69.4205 Constraint (T0288)L16.CB (T0288)Q35.CB 7.3951 12.3252 16.0227 69.4205 Constraint (T0288)L16.CB (T0288)I33.CB 8.0657 13.4429 17.4757 69.4205 Constraint (T0288)P4.CB (T0288)A49.CB 8.0623 13.4371 17.4682 69.2996 Constraint (T0288)K11.CB (T0288)N39.CB 8.2367 13.7279 17.8463 69.2995 Constraint (T0288)N15.CB (T0288)V36.CB 7.8603 13.1005 17.0306 69.2995 Constraint (T0288)A25.CB (T0288)T66.CB 5.1689 8.6149 11.1994 69.2994 Constraint (T0288)K6.CB (T0288)I17.CB 8.9938 14.9896 19.4865 69.2994 Constraint (T0288)D12.CB (T0288)F37.CB 7.1664 11.9440 15.5272 69.2994 Constraint (T0288)V7.CB (T0288)T40.CB 7.8565 13.0941 17.0224 69.1993 Constraint (T0288)V7.CB (T0288)I21.CB 8.3989 13.9982 18.1976 69.1993 Constraint (T0288)I54.CB (T0288)E80.CB 9.3182 15.5304 20.1895 69.1106 Constraint (T0288)A42.CB (T0288)M73.CB 9.0419 15.0699 19.5909 69.0093 Constraint (T0288)N39.CB (T0288)A50.CB 9.0129 15.0214 19.5279 68.8243 Constraint (T0288)L16.CB (T0288)V81.CB 6.1964 10.3273 13.4256 68.7203 Constraint (T0288)L16.CB (T0288)V77.CB 6.3278 10.5463 13.7102 68.7203 Constraint (T0288)L16.CB (T0288)I74.CB 5.5054 9.1757 11.9284 68.7203 Constraint (T0288)K63.CB (T0288)Y85.CB 7.5204 12.5339 16.2941 68.4797 Constraint (T0288)L16.CB (T0288)A42.CB 5.4330 9.0550 11.7716 68.4205 Constraint (T0288)A25.CB (T0288)I54.CB 8.3549 13.9248 18.1023 68.3902 Constraint (T0288)P4.CB (T0288)V48.CB 8.0916 13.4860 17.5317 68.2996 Constraint (T0288)A13.CB (T0288)Q75.CB 7.9049 13.1748 17.1273 68.2995 Constraint (T0288)Q14.CB (T0288)A42.CB 7.7493 12.9155 16.7901 68.2994 Constraint (T0288)Q10.CB (T0288)F37.CB 8.3711 13.9518 18.1374 68.2994 Constraint (T0288)Q26.CB (T0288)K67.CB 6.1247 10.2079 13.2703 67.9995 Constraint (T0288)I21.CB (T0288)Y85.CB 7.0037 11.6728 15.1746 67.9469 Constraint (T0288)L31.CB (T0288)K87.CB 8.2971 13.8286 17.9771 67.5624 Constraint (T0288)V57.CB (T0288)Y85.CB 6.1017 10.1696 13.2204 67.4676 Constraint (T0288)D45.CB (T0288)Y85.CB 6.7715 11.2859 14.6716 67.4332 Constraint (T0288)L16.CB (T0288)A43.CB 7.0531 11.7552 15.2818 67.4205 Constraint (T0288)C28.CB (T0288)I62.CB 7.1940 11.9899 15.5869 67.2904 Constraint (T0288)K63.CB (T0288)K72.CB 9.0088 15.0146 19.5190 67.2250 Constraint (T0288)K11.CB (T0288)M73.CB 8.1297 13.5495 17.6143 67.1933 Constraint (T0288)A25.CB (T0288)V70.CB 7.0455 11.7425 15.2653 66.9995 Constraint (T0288)K65.CB (T0288)V81.CB 8.9029 14.8381 19.2896 66.9994 Constraint (T0288)A25.CB (T0288)I62.CB 7.3345 12.2242 15.8915 66.9891 Constraint (T0288)I19.CB (T0288)Y85.CB 6.6180 11.0300 14.3390 66.9469 Constraint (T0288)L16.CB (T0288)K78.CB 7.4376 12.3960 16.1148 66.8467 Constraint (T0288)L16.CB (T0288)V48.CB 7.8121 13.0201 16.9262 66.7994 Constraint (T0288)L16.CB (T0288)P41.CB 4.5848 7.6414 9.9338 66.7994 Constraint (T0288)L16.CB (T0288)T40.CB 4.4855 7.4758 9.7185 66.7994 Constraint (T0288)K63.CB (T0288)N86.CB 6.5023 10.8371 14.0883 66.7792 Constraint (T0288)S61.CB (T0288)Y85.CB 7.7313 12.8855 16.7511 66.7263 Constraint (T0288)L31.CB (T0288)N86.CB 6.5767 10.9612 14.2495 66.5733 Constraint (T0288)L16.CB (T0288)M73.CB 8.3688 13.9481 18.1325 66.4206 Constraint (T0288)L16.CB (T0288)K72.CB 8.5519 14.2531 18.5290 66.4205 Constraint (T0288)Q26.CB (T0288)T66.CB 5.6019 9.3365 12.1374 66.2994 Constraint (T0288)K6.CB (T0288)E80.CB 7.3371 12.2285 15.8970 66.1994 Constraint (T0288)C28.CB (T0288)K67.CB 6.8862 11.4770 14.9201 65.9877 Constraint (T0288)L31.CB (T0288)E76.CB 8.9410 14.9017 19.3723 65.9205 Constraint (T0288)V70.CB (T0288)Y85.CB 7.6031 12.6718 16.4734 65.8748 Constraint (T0288)L16.CB (T0288)D45.CB 8.0635 13.4392 17.4710 65.7995 Constraint (T0288)V57.CB (T0288)N86.CB 7.8573 13.0955 17.0242 65.7734 Constraint (T0288)L16.CB (T0288)I83.CB 8.1569 13.5949 17.6733 65.7205 Constraint (T0288)L16.CB (T0288)E76.CB 7.8826 13.1376 17.0789 65.7203 Constraint (T0288)L16.CB (T0288)Q75.CB 5.6691 9.4486 12.2831 65.7203 Constraint (T0288)C28.CB (T0288)K65.CB 6.7616 11.2694 14.6502 65.7008 Constraint (T0288)L9.CB (T0288)S20.CB 8.2967 13.8279 17.9763 65.5364 Constraint (T0288)L16.CB (T0288)V57.CB 8.3753 13.9589 18.1465 65.4206 Constraint (T0288)L16.CB (T0288)V34.CB 8.7064 14.5106 18.8638 65.4205 Constraint (T0288)A25.CB (T0288)E53.CB 7.2955 12.1592 15.8070 65.3902 Constraint (T0288)C28.CB (T0288)V70.CB 7.7894 12.9823 16.8770 65.3889 Constraint (T0288)P4.CB (T0288)H84.CB 4.1573 6.9289 9.0075 65.2996 Constraint (T0288)K6.CB (T0288)P41.CB 8.9894 14.9823 19.4770 65.2994 Constraint (T0288)Q14.CB (T0288)I74.CB 7.8239 13.0398 16.9518 65.2993 Constraint (T0288)C28.CB (T0288)K63.CB 5.6903 9.4838 12.3290 65.2904 Constraint (T0288)C28.CB (T0288)T66.CB 6.6399 11.0665 14.3864 65.2876 Constraint (T0288)N39.CB (T0288)A49.CB 8.7297 14.5494 18.9143 65.2248 Constraint (T0288)V7.CB (T0288)L31.CB 8.5997 14.3328 18.6326 65.1993 Constraint (T0288)K11.CB (T0288)A71.CB 8.7697 14.6162 19.0011 65.1933 Constraint (T0288)Q35.CB (T0288)Y85.CB 8.7340 14.5566 18.9236 65.1807 Constraint (T0288)Q14.CB (T0288)E80.CB 8.1316 13.5526 17.6184 65.0994 Constraint (T0288)P29.CB (T0288)K67.CB 5.9499 9.9164 12.8914 64.9771 Constraint (T0288)V34.CB (T0288)N86.CB 9.0584 15.0973 19.6265 64.9675 Constraint (T0288)I21.CB (T0288)N86.CB 8.3865 13.9775 18.1708 64.9467 Constraint (T0288)L16.CB (T0288)L44.CB 7.5709 12.6181 16.4035 64.7995 Constraint (T0288)N58.CB (T0288)Y85.CB 7.8080 13.0133 16.9172 64.7735 Constraint (T0288)T40.CB (T0288)I54.CB 9.2715 15.4525 20.0883 64.6040 Constraint (T0288)L44.CB (T0288)T82.CB 8.8466 14.7444 19.1677 64.6038 Constraint (T0288)P4.CB (T0288)I83.CB 6.6765 11.1275 14.4657 64.2996 Constraint (T0288)V34.CB (T0288)V68.CB 8.8963 14.8271 19.2752 64.2354 Constraint (T0288)E53.CB (T0288)E69.CB 8.8264 14.7106 19.1238 64.2253 Constraint (T0288)P4.CB (T0288)K63.CB 7.4110 12.3517 16.0573 64.1996 Constraint (T0288)V7.CB (T0288)Y85.CB 4.5770 7.6284 9.9169 64.1995 Constraint (T0288)A49.CB (T0288)L88.CB 5.9295 9.8825 12.8473 64.0948 Constraint (T0288)S61.CB (T0288)N86.CB 7.4175 12.3625 16.0713 64.0260 Constraint (T0288)V36.CB (T0288)K87.CB 8.1567 13.5944 17.6728 63.8995 Constraint (T0288)I74.CB (T0288)Y85.CB 7.8017 13.0029 16.9037 63.7736 Constraint (T0288)V70.CB (T0288)N86.CB 8.7165 14.5275 18.8858 63.7734 Constraint (T0288)R60.CB (T0288)Y85.CB 8.4186 14.0309 18.2402 63.7263 Constraint (T0288)L16.CB (T0288)E80.CB 7.9111 13.1852 17.1407 63.7205 Constraint (T0288)F37.CB (T0288)Q75.CB 9.0755 15.1258 19.6635 63.6876 Constraint (T0288)P29.CB (T0288)E53.CB 5.9413 9.9022 12.8729 63.3904 Constraint (T0288)P29.CB (T0288)V68.CB 8.1931 13.6552 17.7518 63.3783 Constraint (T0288)P29.CB (T0288)V70.CB 6.7078 11.1797 14.5336 63.3783 Constraint (T0288)P29.CB (T0288)E69.CB 7.5484 12.5806 16.3548 63.3783 Constraint (T0288)P29.CB (T0288)I54.CB 6.7785 11.2975 14.6868 63.3783 Constraint (T0288)S61.CB (T0288)E76.CB 8.9816 14.9693 19.4601 63.2997 Constraint (T0288)S20.CB (T0288)D45.CB 9.1077 15.1795 19.7333 63.2995 Constraint (T0288)A13.CB (T0288)F37.CB 7.9223 13.2039 17.1651 63.2995 Constraint (T0288)A13.CB (T0288)L44.CB 7.8874 13.1456 17.0893 63.2994 Constraint (T0288)Q26.CB (T0288)K65.CB 6.7406 11.2343 14.6046 63.2994 Constraint (T0288)D12.CB (T0288)A43.CB 7.5139 12.5231 16.2801 63.2994 Constraint (T0288)C28.CB (T0288)E53.CB 6.4607 10.7677 13.9981 63.2905 Constraint (T0288)P29.CB (T0288)T66.CB 6.0212 10.0354 13.0460 63.2875 Constraint (T0288)P29.CB (T0288)T55.CB 6.8273 11.3789 14.7925 63.2783 Constraint (T0288)A43.CB (T0288)Y85.CB 8.5042 14.1736 18.4257 63.1807 Constraint (T0288)I54.CB (T0288)L88.CB 7.3238 12.2063 15.8682 62.9948 Constraint (T0288)S20.CB (T0288)Y85.CB 8.5969 14.3282 18.6266 62.9471 Constraint (T0288)I19.CB (T0288)N86.CB 9.0592 15.0987 19.6283 62.9468 Constraint (T0288)L16.CB (T0288)V70.CB 8.5782 14.2971 18.5862 62.4207 Constraint (T0288)N15.CB (T0288)N39.CB 6.6531 11.0885 14.4150 62.2996 Constraint (T0288)P4.CB (T0288)Y32.CB 8.7511 14.5852 18.9607 62.2996 Constraint (T0288)P29.CB (T0288)K63.CB 5.5104 9.1841 11.9393 62.2903 Constraint (T0288)D45.CB (T0288)V77.CB 8.5211 14.2019 18.4624 62.2070 Constraint (T0288)L9.CB (T0288)I62.CB 8.8458 14.7430 19.1659 62.1994 Constraint (T0288)E53.CB (T0288)L88.CB 4.5747 7.6244 9.9117 62.1068 Constraint (T0288)D52.CB (T0288)L88.CB 4.7773 7.9621 10.3507 62.1068 Constraint (T0288)I19.CB (T0288)E80.CB 8.7991 14.6652 19.0648 61.9995 Constraint (T0288)P29.CB (T0288)K65.CB 6.0535 10.0891 13.1158 61.7008 Constraint (T0288)C30.CB (T0288)K87.CB 7.3833 12.3054 15.9970 61.6577 Constraint (T0288)D45.CB (T0288)N58.CB 8.8198 14.6997 19.1096 61.6039 Constraint (T0288)V34.CB (T0288)K87.CB 8.5758 14.2930 18.5809 61.5686 Constraint (T0288)P4.CB (T0288)I33.CB 8.5416 14.2360 18.5068 61.2996 Constraint (T0288)Q10.CB (T0288)Q75.CB 8.8064 14.6774 19.0806 61.2995 Constraint (T0288)P29.CB (T0288)I62.CB 6.1499 10.2499 13.3248 61.2904 Constraint (T0288)C28.CB (T0288)I54.CB 7.7272 12.8787 16.7423 61.2783 Constraint (T0288)V48.CB (T0288)L88.CB 7.7445 12.9075 16.7798 61.2212 Constraint (T0288)P4.CB (T0288)T82.CB 7.6026 12.6711 16.4724 61.1996 Constraint (T0288)P4.CB (T0288)I62.CB 7.9019 13.1699 17.1208 61.1996 Constraint (T0288)P4.CB (T0288)S61.CB 7.5730 12.6217 16.4082 61.1996 Constraint (T0288)Q26.CB (T0288)E53.CB 7.6751 12.7918 16.6294 61.1902 Constraint (T0288)I33.CB (T0288)L88.CB 6.7214 11.2023 14.5630 61.1009 Constraint (T0288)C28.CB (T0288)T55.CB 7.1452 11.9086 15.4812 61.0783 Constraint (T0288)Y32.CB (T0288)L88.CB 5.9479 9.9132 12.8871 61.0637 Constraint (T0288)P41.CB (T0288)Y85.CB 8.5095 14.1824 18.4372 61.0262 Constraint (T0288)F37.CB (T0288)A71.CB 8.8429 14.7382 19.1596 60.9982 Constraint (T0288)T55.CB (T0288)L88.CB 7.0583 11.7638 15.2930 60.9950 Constraint (T0288)I19.CB (T0288)K72.CB 8.8770 14.7950 19.2335 60.9204 Constraint (T0288)N15.CB (T0288)D45.CB 8.1977 13.6628 17.7616 60.2998 Constraint (T0288)V7.CB (T0288)N86.CB 6.7789 11.2982 14.6877 60.2993 Constraint (T0288)P4.CB (T0288)V57.CB 8.2507 13.7511 17.8764 60.1996 Constraint (T0288)L9.CB (T0288)D38.CB 8.8467 14.7446 19.1679 60.1934 Constraint (T0288)A50.CB (T0288)L88.CB 6.4939 10.8232 14.0701 60.0637 Constraint (T0288)S20.CB (T0288)V77.CB 9.1028 15.1713 19.7227 59.9995 Constraint (T0288)I17.CB (T0288)Y85.CB 7.5573 12.5954 16.3741 59.9471 Constraint (T0288)K67.CB (T0288)I83.CB 8.7236 14.5393 18.9011 59.7984 Constraint (T0288)K11.CB (T0288)S20.CB 8.7996 14.6659 19.0657 59.6377 Constraint (T0288)C28.CB (T0288)E69.CB 8.2145 13.6909 17.7982 59.3783 Constraint (T0288)A13.CB (T0288)N39.CB 7.6200 12.7001 16.5101 59.2995 Constraint (T0288)T8.CB (T0288)M73.CB 9.0944 15.1574 19.7046 59.2934 Constraint (T0288)K6.CB (T0288)Y85.CB 4.7596 7.9327 10.3125 59.1996 Constraint (T0288)K6.CB (T0288)K87.CB 6.7910 11.3183 14.7137 59.1995 Constraint (T0288)L9.CB (T0288)V70.CB 8.6765 14.4608 18.7990 59.1934 Constraint (T0288)K63.CB (T0288)T82.CB 9.3340 15.5567 20.2238 58.9997 Constraint (T0288)I21.CB (T0288)T82.CB 9.1939 15.3232 19.9201 58.9996 Constraint (T0288)Q26.CB (T0288)V70.CB 7.5504 12.5841 16.3593 58.9995 Constraint (T0288)M73.CB (T0288)Y85.CB 8.5742 14.2903 18.5774 58.7796 Constraint (T0288)D45.CB (T0288)K87.CB 8.3471 13.9118 18.0853 58.4333 Constraint (T0288)K65.CB (T0288)Y85.CB 8.7247 14.5412 18.9035 58.4033 Constraint (T0288)N15.CB (T0288)A43.CB 7.2481 12.0801 15.7042 58.2997 Constraint (T0288)V7.CB (T0288)K87.CB 6.7534 11.2556 14.6323 58.2996 Constraint (T0288)K6.CB (T0288)I19.CB 9.0995 15.1658 19.7156 58.2995 Constraint (T0288)A42.CB (T0288)I62.CB 9.0790 15.1316 19.6711 58.2251 Constraint (T0288)K6.CB (T0288)V77.CB 8.8024 14.6706 19.0718 58.1996 Constraint (T0288)K6.CB (T0288)N86.CB 6.1716 10.2861 13.3719 58.1994 Constraint (T0288)L9.CB (T0288)Q35.CB 8.9174 14.8623 19.3210 58.1994 Constraint (T0288)A25.CB (T0288)V34.CB 8.1526 13.5876 17.6639 58.0901 Constraint (T0288)A25.CB (T0288)V68.CB 6.5947 10.9911 14.2885 57.9998 Constraint (T0288)I17.CB (T0288)R60.CB 8.7135 14.5224 18.8792 57.9998 Constraint (T0288)K6.CB (T0288)K63.CB 9.0764 15.1274 19.6656 57.9997 Constraint (T0288)K65.CB (T0288)T82.CB 9.4044 15.6739 20.3761 57.9994 Constraint (T0288)T55.CB (T0288)V77.CB 9.0342 15.0569 19.5740 57.2997 Constraint (T0288)N15.CB (T0288)D38.CB 7.5980 12.6634 16.4624 57.2996 Constraint (T0288)N15.CB (T0288)L44.CB 7.1586 11.9310 15.5103 57.2996 Constraint (T0288)Q10.CB (T0288)E76.CB 9.0797 15.1329 19.6727 57.2995 Constraint (T0288)Q14.CB (T0288)N39.CB 6.8534 11.4223 14.8491 57.2995 Constraint (T0288)V7.CB (T0288)M73.CB 9.0314 15.0524 19.5681 57.1995 Constraint (T0288)D12.CB (T0288)T82.CB 8.5396 14.2326 18.5024 57.0996 Constraint (T0288)I19.CB (T0288)K87.CB 8.6650 14.4417 18.7742 57.0732 Constraint (T0288)Q26.CB (T0288)I62.CB 7.6165 12.6941 16.5023 56.2995 Constraint (T0288)T8.CB (T0288)V36.CB 8.6566 14.4276 18.7559 56.2934 Constraint (T0288)P29.CB (T0288)S61.CB 7.2339 12.0565 15.6734 56.2783 Constraint (T0288)P4.CB (T0288)Y85.CB 4.8966 8.1609 10.6092 56.1996 Constraint (T0288)V7.CB (T0288)F37.CB 9.0423 15.0706 19.5917 56.1995 Constraint (T0288)N15.CB (T0288)E76.CB 7.2626 12.1043 15.7356 56.1993 Constraint (T0288)K11.CB (T0288)I21.CB 8.9091 14.8485 19.3031 56.1993 Constraint (T0288)A42.CB (T0288)T55.CB 9.1736 15.2893 19.8760 56.0094 Constraint (T0288)K65.CB (T0288)N86.CB 8.8408 14.7347 19.1551 56.0020 Constraint (T0288)E53.CB (T0288)V81.CB 9.3679 15.6132 20.2972 55.9892 Constraint (T0288)A43.CB (T0288)I54.CB 9.1327 15.2212 19.7876 55.9248 Constraint (T0288)A42.CB (T0288)K87.CB 8.3816 13.9694 18.1602 55.8998 Constraint (T0288)D52.CB (T0288)K65.CB 8.9760 14.9600 19.4480 55.5030 Constraint (T0288)L16.CB (T0288)I54.CB 8.9016 14.8360 19.2868 55.4208 Constraint (T0288)T47.CB (T0288)V57.CB 8.7241 14.5402 18.9023 55.2996 Constraint (T0288)V36.CB (T0288)T47.CB 6.3272 10.5454 13.7090 55.2996 Constraint (T0288)I33.CB (T0288)T47.CB 6.6779 11.1298 14.4687 55.2996 Constraint (T0288)I19.CB (T0288)T47.CB 6.7533 11.2555 14.6322 55.2996 Constraint (T0288)I17.CB (T0288)T47.CB 7.3003 12.1672 15.8174 55.2996 Constraint (T0288)N15.CB (T0288)A71.CB 7.1649 11.9415 15.5240 55.2994 Constraint (T0288)C28.CB (T0288)S61.CB 7.6041 12.6735 16.4755 55.2783 Constraint (T0288)I19.CB (T0288)E76.CB 9.1969 15.3281 19.9266 54.6205 Constraint (T0288)N15.CB (T0288)V48.CB 8.4713 14.1189 18.3545 54.2997 Constraint (T0288)T47.CB (T0288)T82.CB 7.0546 11.7577 15.2851 54.2997 Constraint (T0288)T47.CB (T0288)V81.CB 7.2555 12.0925 15.7203 54.2997 Constraint (T0288)Q10.CB (T0288)T47.CB 6.9512 11.5853 15.0608 54.2996 Constraint (T0288)L9.CB (T0288)T47.CB 5.0743 8.4572 10.9943 54.2996 Constraint (T0288)T8.CB (T0288)T47.CB 4.9993 8.3322 10.8318 54.2996 Constraint (T0288)V7.CB (T0288)T47.CB 3.4711 5.7851 7.5207 54.2996 Constraint (T0288)K6.CB (T0288)T47.CB 5.5399 9.2332 12.0032 54.2996 Constraint (T0288)N15.CB (T0288)Q35.CB 8.1658 13.6096 17.6925 54.2961 Constraint (T0288)P29.CB (T0288)A71.CB 8.7689 14.6148 18.9993 54.2876 Constraint (T0288)T8.CB (T0288)Y85.CB 6.1261 10.2101 13.2731 54.1998 Constraint (T0288)P4.CB (T0288)L31.CB 8.7364 14.5606 18.9288 54.1996 Constraint (T0288)V7.CB (T0288)V70.CB 9.0568 15.0946 19.6230 54.1995 Constraint (T0288)L9.CB (T0288)Y85.CB 6.5720 10.9533 14.2392 54.1937 Constraint (T0288)L9.CB (T0288)L31.CB 8.9611 14.9352 19.4157 54.1934 Constraint (T0288)Q26.CB (T0288)V68.CB 7.2461 12.0769 15.7000 53.9997 Constraint (T0288)I33.CB (T0288)Q75.CB 9.0700 15.1167 19.6517 53.5031 Constraint (T0288)A42.CB (T0288)N86.CB 9.2000 15.3333 19.9333 53.4735 Constraint (T0288)P4.CB (T0288)N86.CB 3.8655 6.4425 8.3753 53.2997 Constraint (T0288)P29.CB (T0288)D52.CB 8.3930 13.9884 18.1849 53.2905 Constraint (T0288)A13.CB (T0288)I74.CB 8.2270 13.7117 17.8252 53.0996 Constraint (T0288)Q26.CB (T0288)E69.CB 7.3625 12.2708 15.9520 52.9997 Constraint (T0288)Q14.CB (T0288)E76.CB 8.1966 13.6611 17.7594 52.9993 Constraint (T0288)C30.CB (T0288)L88.CB 6.7874 11.3123 14.7059 52.6578 Constraint (T0288)Y27.CB (T0288)K63.CB 6.7008 11.1680 14.5185 52.3906 Constraint (T0288)V3.CB (T0288)T55.CB 6.9171 11.5285 14.9870 52.2997 Constraint (T0288)V3.CB (T0288)E53.CB 6.8681 11.4468 14.8809 52.2997 Constraint (T0288)V3.CB (T0288)D52.CB 6.8411 11.4018 14.8223 52.2997 Constraint (T0288)P4.CB (T0288)K87.CB 5.0649 8.4414 10.9739 52.2996 Constraint (T0288)Q14.CB (T0288)D38.CB 8.0661 13.4435 17.4765 52.2995 Constraint (T0288)T8.CB (T0288)A49.CB 8.3917 13.9862 18.1820 52.2935 Constraint (T0288)K67.CB (T0288)V77.CB 9.3854 15.6423 20.3350 52.0034 Constraint (T0288)A25.CB (T0288)E69.CB 6.4356 10.7260 13.9438 51.9996 Constraint (T0288)D12.CB (T0288)V36.CB 8.3328 13.8880 18.0545 51.2994 Constraint (T0288)I21.CB (T0288)K87.CB 8.9085 14.8475 19.3017 51.0731 Constraint (T0288)P4.CB (T0288)T47.CB 7.6556 12.7593 16.5871 50.2997 Constraint (T0288)P4.CB (T0288)C30.CB 8.1076 13.5127 17.5665 50.2996 Constraint (T0288)L9.CB (T0288)A50.CB 9.0206 15.0343 19.5445 50.1936 Constraint (T0288)Y27.CB (T0288)E53.CB 7.4064 12.3440 16.0472 49.3906 Constraint (T0288)F37.CB (T0288)T47.CB 8.6459 14.4099 18.7328 49.2998 Constraint (T0288)V3.CB (T0288)I54.CB 8.6322 14.3871 18.7032 49.2997 Constraint (T0288)T47.CB (T0288)H84.CB 7.1217 11.8695 15.4303 49.2996 Constraint (T0288)T47.CB (T0288)I83.CB 5.3988 8.9980 11.6974 49.2996 Constraint (T0288)L9.CB (T0288)A71.CB 8.8693 14.7822 19.2168 49.1934 Constraint (T0288)A42.CB (T0288)K78.CB 9.2315 15.3859 20.0016 48.8059 Constraint (T0288)I17.CB (T0288)T55.CB 9.2313 15.3855 20.0012 48.6208 Constraint (T0288)V3.CB (T0288)A49.CB 7.7217 12.8696 16.7304 48.2997 Constraint (T0288)V7.CB (T0288)S61.CB 9.0150 15.0251 19.5326 48.2996 Constraint (T0288)D12.CB (T0288)V48.CB 8.1379 13.5632 17.6322 48.2995 Constraint (T0288)N15.CB (T0288)M73.CB 8.0601 13.4335 17.4636 48.1993 Constraint (T0288)I19.CB (T0288)K65.CB 9.1626 15.2711 19.8524 47.9995 Constraint (T0288)A13.CB (T0288)E76.CB 8.2156 13.6926 17.8004 47.9995 Constraint (T0288)I21.CB (T0288)D45.CB 9.1885 15.3141 19.9083 47.9995 Constraint (T0288)R60.CB (T0288)N86.CB 9.2584 15.4306 20.0598 47.8322 Constraint (T0288)V34.CB (T0288)L88.CB 7.8636 13.1060 17.0378 47.5673 Constraint (T0288)N15.CB (T0288)K72.CB 7.8524 13.0873 17.0135 47.1994 Constraint (T0288)Y27.CB (T0288)I62.CB 7.2859 12.1432 15.7862 47.1906 Constraint (T0288)F37.CB (T0288)I54.CB 9.1461 15.2434 19.8165 47.0200 Constraint (T0288)C28.CB (T0288)V68.CB 8.3876 13.9793 18.1731 46.9998 Constraint (T0288)A25.CB (T0288)A71.CB 7.6184 12.6973 16.5065 46.9998 Constraint (T0288)Y27.CB (T0288)K67.CB 6.2573 10.4288 13.5574 46.9894 Constraint (T0288)I62.CB (T0288)K87.CB 9.0096 15.0160 19.5208 46.5686 Constraint (T0288)Q35.CB (T0288)T47.CB 9.2195 15.3659 19.9757 46.2998 Constraint (T0288)V3.CB (T0288)H84.CB 6.6544 11.0907 14.4180 46.2997 Constraint (T0288)Q14.CB (T0288)A43.CB 8.0570 13.4283 17.4568 46.2996 Constraint (T0288)Q14.CB (T0288)L44.CB 7.6838 12.8064 16.6483 46.2995 Constraint (T0288)K11.CB (T0288)I33.CB 8.9450 14.9083 19.3808 46.1935 Constraint (T0288)E53.CB (T0288)Q89.CB 6.3303 10.5505 13.7156 46.1069 Constraint (T0288)A49.CB (T0288)Q89.CB 7.1189 11.8648 15.4242 46.0949 Constraint (T0288)I17.CB (T0288)E53.CB 9.1365 15.2275 19.7958 45.6209 Constraint (T0288)V34.CB (T0288)T66.CB 9.0314 15.0523 19.5680 45.3366 Constraint (T0288)T47.CB (T0288)E80.CB 8.3408 13.9013 18.0717 45.2998 Constraint (T0288)K11.CB (T0288)T47.CB 8.0206 13.3677 17.3780 45.2998 Constraint (T0288)V3.CB (T0288)V48.CB 8.6930 14.4883 18.8348 45.2997 Constraint (T0288)K63.CB (T0288)K87.CB 8.8342 14.7237 19.1408 45.2746 Constraint (T0288)N15.CB (T0288)I83.CB 8.5471 14.2451 18.5187 45.1998 Constraint (T0288)T47.CB (T0288)Y85.CB 5.4160 9.0266 11.7346 45.1997 Constraint (T0288)Y27.CB (T0288)I54.CB 8.1984 13.6640 17.7633 45.1785 Constraint (T0288)A43.CB (T0288)I74.CB 9.2336 15.3893 20.0060 45.0213 Constraint (T0288)Y27.CB (T0288)V70.CB 7.4521 12.4202 16.1463 44.9894 Constraint (T0288)S20.CB (T0288)E69.CB 9.1093 15.1821 19.7368 44.9206 Constraint (T0288)L44.CB (T0288)Y85.CB 9.0141 15.0234 19.5305 44.8323 Constraint (T0288)Y27.CB (T0288)E69.CB 7.5695 12.6158 16.4005 44.2893 Constraint (T0288)Y27.CB (T0288)T66.CB 5.7271 9.5451 12.4087 44.2878 Constraint (T0288)N15.CB (T0288)V57.CB 8.3903 13.9839 18.1791 44.1996 Constraint (T0288)D52.CB (T0288)Q89.CB 6.3757 10.6262 13.8141 44.1069 Constraint (T0288)Q26.CB (T0288)I54.CB 8.6293 14.3822 18.6969 43.7891 Constraint (T0288)P29.CB (T0288)N86.CB 7.8127 13.0211 16.9274 43.5878 Constraint (T0288)V34.CB (T0288)K65.CB 8.9864 14.9773 19.4705 43.5030 Constraint (T0288)Y27.CB (T0288)K65.CB 6.2461 10.4101 13.5332 43.2998 Constraint (T0288)T47.CB (T0288)N86.CB 7.8292 13.0487 16.9632 43.2997 Constraint (T0288)D12.CB (T0288)I83.CB 8.4398 14.0663 18.2861 43.2995 Constraint (T0288)L31.CB (T0288)L88.CB 7.7239 12.8732 16.7351 43.2127 Constraint (T0288)P4.CB (T0288)N58.CB 9.1420 15.2367 19.8078 43.1997 Constraint (T0288)P29.CB (T0288)V57.CB 8.5900 14.3167 18.6117 43.0783 Constraint (T0288)Y32.CB (T0288)T47.CB 9.3185 15.5309 20.1901 42.2998 Constraint (T0288)V3.CB (T0288)I83.CB 8.6016 14.3361 18.6369 42.2998 Constraint (T0288)S20.CB (T0288)K65.CB 9.1113 15.1855 19.7411 42.2995 Constraint (T0288)S20.CB (T0288)T66.CB 9.0057 15.0096 19.5125 42.2995 Constraint (T0288)V48.CB (T0288)A71.CB 9.1081 15.1802 19.7343 42.2919 Constraint (T0288)M2.CB (T0288)T55.CB 7.3237 12.2062 15.8680 42.1998 Constraint (T0288)K11.CB (T0288)I54.CB 8.7234 14.5390 18.9008 42.1935 Constraint (T0288)V36.CB (T0288)A71.CB 8.9464 14.9107 19.3839 41.9129 Constraint (T0288)D52.CB (T0288)Y90.CB 7.4483 12.4138 16.1379 41.6059 Constraint (T0288)T47.CB (T0288)K87.CB 6.3817 10.6362 13.8271 41.2999 Constraint (T0288)P4.CB (T0288)L88.CB 6.6935 11.1558 14.5025 41.2997 Constraint (T0288)T8.CB (T0288)I62.CB 9.0287 15.0479 19.5623 41.0997 Constraint (T0288)D12.CB (T0288)E76.CB 8.4365 14.0608 18.2791 41.0995 Constraint (T0288)Y32.CB (T0288)Q89.CB 7.6345 12.7242 16.5415 41.0625 Constraint (T0288)T40.CB (T0288)Y85.CB 9.1994 15.3324 19.9321 40.6311 Constraint (T0288)N15.CB (T0288)I33.CB 8.5592 14.2653 18.5449 40.2961 Constraint (T0288)D52.CB (T0288)A71.CB 9.2937 15.4896 20.1364 40.2033 Constraint (T0288)V3.CB (T0288)Y85.CB 5.9700 9.9499 12.9349 40.1998 Constraint (T0288)M2.CB (T0288)E53.CB 6.4571 10.7619 13.9905 40.1998 Constraint (T0288)M2.CB (T0288)D52.CB 6.7737 11.2895 14.6763 40.1998 Constraint (T0288)V7.CB (T0288)S20.CB 9.2000 15.3334 19.9334 40.1997 Constraint (T0288)N15.CB (T0288)V70.CB 8.5984 14.3307 18.6299 40.1997 Constraint (T0288)K11.CB (T0288)K72.CB 8.8037 14.6728 19.0746 40.1933 Constraint (T0288)L16.CB (T0288)N58.CB 8.7542 14.5903 18.9674 40.0997 Constraint (T0288)P4.CB (T0288)R60.CB 9.0599 15.0998 19.6298 39.9997 Constraint (T0288)T55.CB (T0288)Q89.CB 7.9596 13.2659 17.2457 39.7951 Constraint (T0288)A13.CB (T0288)A43.CB 8.2845 13.8074 17.9497 39.2999 Constraint (T0288)V3.CB (T0288)K87.CB 4.6591 7.7652 10.0947 39.2998 Constraint (T0288)P4.CB (T0288)D45.CB 9.0449 15.0749 19.5973 38.9998 Constraint (T0288)V36.CB (T0288)V70.CB 8.8932 14.8220 19.2686 38.9129 Constraint (T0288)D45.CB (T0288)N86.CB 9.0232 15.0387 19.5503 38.8321 Constraint (T0288)A50.CB (T0288)Q89.CB 7.7867 12.9779 16.8712 38.7379 Constraint (T0288)V3.CB (T0288)N86.CB 4.5127 7.5211 9.7774 38.2998 Constraint (T0288)E69.CB (T0288)H84.CB 8.9302 14.8836 19.3487 38.2082 Constraint (T0288)K6.CB (T0288)I74.CB 9.1721 15.2869 19.8729 38.1998 Constraint (T0288)M2.CB (T0288)A49.CB 7.7190 12.8649 16.7244 38.1998 Constraint (T0288)I33.CB (T0288)Q89.CB 8.2434 13.7390 17.8606 38.1081 Constraint (T0288)V7.CB (T0288)L88.CB 8.6263 14.3771 18.6902 38.0995 Constraint (T0288)V7.CB (T0288)L16.CB 9.0492 15.0821 19.6067 37.9996 Constraint (T0288)K6.CB (T0288)L44.CB 8.7477 14.5795 18.9534 37.9996 Constraint (T0288)L16.CB (T0288)T82.CB 9.0394 15.0656 19.5853 37.9734 Constraint (T0288)V34.CB (T0288)T55.CB 9.4017 15.6694 20.3703 37.8352 Constraint (T0288)A25.CB (T0288)T55.CB 7.9038 13.1730 17.1249 37.6902 Constraint (T0288)C28.CB (T0288)N86.CB 7.4696 12.4494 16.1842 37.3879 Constraint (T0288)T40.CB (T0288)A71.CB 9.0984 15.1641 19.7133 37.3041 Constraint (T0288)V3.CB (T0288)T47.CB 7.9879 13.3131 17.3070 37.2999 Constraint (T0288)D38.CB (T0288)T47.CB 8.9060 14.8434 19.2964 37.2998 Constraint (T0288)P41.CB (T0288)A71.CB 9.0429 15.0716 19.5930 37.2918 Constraint (T0288)E53.CB (T0288)Y90.CB 7.1943 11.9906 15.5877 37.2689 Constraint (T0288)M2.CB (T0288)H84.CB 7.6766 12.7944 16.6327 37.1998 Constraint (T0288)D12.CB (T0288)D38.CB 7.6919 12.8198 16.6658 37.1996 Constraint (T0288)V36.CB (T0288)L88.CB 8.4529 14.0882 18.3147 36.9755 Constraint (T0288)A49.CB (T0288)Y90.CB 7.4741 12.4568 16.1938 36.5999 Constraint (T0288)Y27.CB (T0288)T55.CB 7.5849 12.6416 16.4340 36.0785 Constraint (T0288)V48.CB (T0288)M73.CB 9.2562 15.4270 20.0552 35.9890 Constraint (T0288)Q14.CB (T0288)V36.CB 8.3532 13.9221 18.0987 35.1996 Constraint (T0288)Q14.CB (T0288)A71.CB 8.7000 14.4999 18.8499 35.1995 Constraint (T0288)I19.CB (T0288)L88.CB 8.9569 14.9281 19.4066 35.0734 Constraint (T0288)A50.CB (T0288)K67.CB 9.1250 15.2084 19.7709 34.7095 Constraint (T0288)Q35.CB (T0288)K87.CB 8.9416 14.9027 19.3735 34.5689 Constraint (T0288)Y27.CB (T0288)V68.CB 7.2791 12.1318 15.7714 34.2999 Constraint (T0288)A13.CB (T0288)D45.CB 7.8308 13.0513 16.9667 34.2998 Constraint (T0288)V36.CB (T0288)N86.CB 9.2289 15.3815 19.9960 34.2986 Constraint (T0288)M2.CB (T0288)I54.CB 8.6883 14.4806 18.8247 34.1998 Constraint (T0288)K6.CB (T0288)L31.CB 9.2965 15.4941 20.1423 34.0996 Constraint (T0288)S20.CB (T0288)L44.CB 9.4445 15.7409 20.4631 33.9997 Constraint (T0288)I21.CB (T0288)L88.CB 8.2369 13.7281 17.8466 33.8734 Constraint (T0288)P29.CB (T0288)Y85.CB 8.6165 14.3608 18.6690 33.4880 Constraint (T0288)A25.CB (T0288)M73.CB 8.4354 14.0590 18.2767 33.2999 Constraint (T0288)C28.CB (T0288)D52.CB 8.4985 14.1641 18.4133 33.0906 Constraint (T0288)Y27.CB (T0288)S61.CB 7.5934 12.6557 16.4524 33.0785 Constraint (T0288)V7.CB (T0288)K78.CB 8.9158 14.8596 19.3175 32.9998 Constraint (T0288)V36.CB (T0288)V57.CB 9.1431 15.2385 19.8100 32.9985 Constraint (T0288)K11.CB (T0288)V70.CB 9.0594 15.0990 19.6287 32.9935 Constraint (T0288)K72.CB (T0288)T82.CB 9.3575 15.5958 20.2745 32.9894 Constraint (T0288)D52.CB (T0288)M73.CB 9.2788 15.4647 20.1041 32.9103 Constraint (T0288)I62.CB (T0288)L88.CB 8.5844 14.3073 18.5995 32.7129 Constraint (T0288)A25.CB (T0288)K72.CB 8.1408 13.5679 17.6383 32.2999 Constraint (T0288)D45.CB (T0288)T55.CB 9.1940 15.3233 19.9203 32.2035 Constraint (T0288)Q26.CB (T0288)S61.CB 8.5859 14.3099 18.6028 31.9890 Constraint (T0288)I54.CB (T0288)Q89.CB 8.2733 13.7888 17.9254 31.8021 Constraint (T0288)T47.CB (T0288)L88.CB 8.3505 13.9175 18.0927 31.2997 Constraint (T0288)A25.CB (T0288)S61.CB 7.5590 12.5984 16.3779 31.2890 Constraint (T0288)N15.CB (T0288)N58.CB 8.2682 13.7803 17.9144 31.1996 Constraint (T0288)M2.CB (T0288)Y85.CB 6.3368 10.5613 13.7297 31.0998 Constraint (T0288)P29.CB (T0288)R60.CB 8.3255 13.8758 18.0385 31.0785 Constraint (T0288)V34.CB (T0288)V57.CB 9.1417 15.2362 19.8071 31.0107 Constraint (T0288)P41.CB (T0288)E76.CB 9.3228 15.5379 20.1993 30.9881 Constraint (T0288)Y32.CB (T0288)Y90.CB 8.4141 14.0234 18.2305 30.5699 Constraint (T0288)I17.CB (T0288)E69.CB 9.1379 15.2298 19.7987 30.3210 Constraint (T0288)Q14.CB (T0288)D45.CB 8.1884 13.6473 17.7415 30.3000 Constraint (T0288)V3.CB (T0288)C30.CB 8.8490 14.7484 19.1729 30.2998 Constraint (T0288)V3.CB (T0288)Y32.CB 8.9453 14.9089 19.3815 30.2997 Constraint (T0288)D38.CB (T0288)D52.CB 9.3132 15.5219 20.1785 30.2035 Constraint (T0288)T8.CB (T0288)K87.CB 8.0140 13.3566 17.3636 30.1998 Constraint (T0288)M2.CB (T0288)K87.CB 4.4034 7.3390 9.5407 30.1998 Constraint (T0288)M2.CB (T0288)N86.CB 4.4671 7.4451 9.6787 30.1998 Constraint (T0288)V3.CB (T0288)K63.CB 8.9695 14.9492 19.4339 29.9998 Constraint (T0288)A49.CB (T0288)V81.CB 9.2600 15.4333 20.0633 29.9892 Constraint (T0288)C28.CB (T0288)Y85.CB 8.4373 14.0621 18.2808 29.9807 Constraint (T0288)C30.CB (T0288)Q89.CB 7.7213 12.8688 16.7295 29.4581 Constraint (T0288)M2.CB (T0288)Y32.CB 8.4791 14.1318 18.3713 29.1998 Constraint (T0288)P29.CB (T0288)M73.CB 8.8136 14.6893 19.0962 28.8774 Constraint (T0288)A50.CB (T0288)Y90.CB 8.1767 13.6278 17.7162 28.7021 Constraint (T0288)A13.CB (T0288)D38.CB 8.2962 13.8270 17.9750 28.2998 Constraint (T0288)I21.CB (T0288)T47.CB 9.0643 15.1072 19.6394 28.2997 Constraint (T0288)P41.CB (T0288)M73.CB 9.0701 15.1168 19.6519 28.2918 Constraint (T0288)D12.CB (T0288)N58.CB 7.8475 13.0792 17.0029 28.0997 Constraint (T0288)Q26.CB (T0288)A71.CB 8.0228 13.3714 17.3828 28.0000 Constraint (T0288)C30.CB (T0288)K72.CB 8.6077 14.3462 18.6501 27.9142 Constraint (T0288)D45.CB (T0288)K78.CB 9.1761 15.2935 19.8816 27.8730 Constraint (T0288)Q26.CB (T0288)T55.CB 7.6499 12.7499 16.5748 27.3902 Constraint (T0288)I17.CB (T0288)V68.CB 9.2444 15.4074 20.0296 27.3211 Constraint (T0288)V3.CB (T0288)L88.CB 6.0663 10.1105 13.1436 27.2998 Constraint (T0288)V3.CB (T0288)I33.CB 8.9562 14.9271 19.4052 27.2998 Constraint (T0288)N15.CB (T0288)V34.CB 8.7063 14.5106 18.8637 27.2963 Constraint (T0288)V7.CB (T0288)Q35.CB 9.2265 15.3775 19.9908 27.1999 Constraint (T0288)M2.CB (T0288)K63.CB 8.6002 14.3337 18.6338 26.9998 Constraint (T0288)I17.CB (T0288)K65.CB 9.2692 15.4487 20.0833 26.9998 Constraint (T0288)A50.CB (T0288)V70.CB 9.2758 15.4597 20.0976 26.9140 Constraint (T0288)I33.CB (T0288)E69.CB 8.8972 14.8287 19.2774 26.9130 Constraint (T0288)D52.CB (T0288)Y91.CB 7.2848 12.1414 15.7838 26.4117 Constraint (T0288)I33.CB (T0288)T66.CB 9.2013 15.3355 19.9361 26.3245 Constraint (T0288)K63.CB (T0288)L88.CB 7.6772 12.7953 16.6339 26.2747 Constraint (T0288)P41.CB (T0288)H84.CB 9.1636 15.2727 19.8545 26.2024 Constraint (T0288)M2.CB (T0288)I33.CB 8.9000 14.8333 19.2833 26.1998 Constraint (T0288)N15.CB (T0288)I54.CB 9.1105 15.1842 19.7394 26.1963 Constraint (T0288)V36.CB (T0288)K67.CB 8.9529 14.9215 19.3979 25.7095 Constraint (T0288)K67.CB (T0288)Y85.CB 9.0017 15.0029 19.5037 25.4714 Constraint (T0288)K67.CB (T0288)V81.CB 9.1600 15.2667 19.8468 25.3895 Constraint (T0288)C28.CB (T0288)L88.CB 7.5467 12.5779 16.3512 25.3880 Constraint (T0288)Q14.CB (T0288)V48.CB 8.7301 14.5502 18.9153 25.1999 Constraint (T0288)Q35.CB (T0288)L88.CB 8.6084 14.3473 18.6515 25.1997 Constraint (T0288)Q10.CB (T0288)Y85.CB 7.8135 13.0225 16.9293 25.0999 Constraint (T0288)D12.CB (T0288)V57.CB 8.3021 13.8369 17.9880 25.0998 Constraint (T0288)I62.CB (T0288)K78.CB 9.3531 15.5885 20.2651 24.9963 Constraint (T0288)A43.CB (T0288)K87.CB 8.8644 14.7740 19.2062 24.4675 Constraint (T0288)E53.CB (T0288)Y91.CB 7.1204 11.8673 15.4275 24.4117 Constraint (T0288)A25.CB (T0288)R60.CB 8.4197 14.0328 18.2427 24.2999 Constraint (T0288)V34.CB (T0288)Q75.CB 9.2965 15.4942 20.1424 24.2995 Constraint (T0288)V48.CB (T0288)Q89.CB 8.0944 13.4907 17.5380 24.2344 Constraint (T0288)M2.CB (T0288)V48.CB 8.7017 14.5028 18.8536 24.1998 Constraint (T0288)M2.CB (T0288)C30.CB 7.8166 13.0277 16.9360 24.1998 Constraint (T0288)Y27.CB (T0288)A71.CB 8.0675 13.4459 17.4796 24.1000 Constraint (T0288)T8.CB (T0288)N86.CB 7.9697 13.2829 17.2678 24.0998 Constraint (T0288)K11.CB (T0288)D38.CB 8.7009 14.5015 18.8520 23.9999 Constraint (T0288)L9.CB (T0288)E53.CB 9.0300 15.0499 19.5649 23.9996 Constraint (T0288)I19.CB (T0288)V68.CB 8.8723 14.7871 19.2232 23.6207 Constraint (T0288)A49.CB (T0288)Y91.CB 7.0856 11.8094 15.3522 23.4117 Constraint (T0288)N15.CB (T0288)T82.CB 9.0176 15.0294 19.5382 23.1999 Constraint (T0288)A71.CB (T0288)T82.CB 9.4334 15.7224 20.4391 22.9893 Constraint (T0288)A42.CB (T0288)K67.CB 8.8333 14.7222 19.1389 22.7096 Constraint (T0288)I33.CB (T0288)Y90.CB 8.6400 14.4000 18.7201 22.6000 Constraint (T0288)P29.CB (T0288)L88.CB 7.8971 13.1618 17.1103 22.4941 Constraint (T0288)A25.CB (T0288)D52.CB 8.2547 13.7578 17.8851 22.3904 Constraint (T0288)M2.CB (T0288)T47.CB 8.5430 14.2384 18.5099 22.1999 Constraint (T0288)P4.CB (T0288)Q89.CB 6.9147 11.5246 14.9819 22.1999 Constraint (T0288)K6.CB (T0288)L88.CB 8.0847 13.4745 17.5169 22.1999 Constraint (T0288)M2.CB (T0288)L88.CB 5.2937 8.8228 11.4696 22.1999 Constraint (T0288)M2.CB (T0288)A50.CB 8.8216 14.7026 19.1134 22.1998 Constraint (T0288)C28.CB (T0288)A71.CB 8.5161 14.1934 18.4515 22.0999 Constraint (T0288)I33.CB (T0288)N58.CB 9.1979 15.3298 19.9288 22.0108 Constraint (T0288)K6.CB (T0288)M73.CB 9.1748 15.2914 19.8788 22.0000 Constraint (T0288)S1.CB (T0288)D52.CB 7.9340 13.2233 17.1903 21.9999 Constraint (T0288)K11.CB (T0288)R60.CB 8.5908 14.3179 18.6133 21.9936 Constraint (T0288)L16.CB (T0288)L31.CB 8.8454 14.7424 19.1651 21.4210 Constraint (T0288)T55.CB (T0288)Y90.CB 7.8476 13.0793 17.0031 21.4000 Constraint (T0288)P29.CB (T0288)K87.CB 8.8859 14.8098 19.2527 21.3939 Constraint (T0288)A25.CB (T0288)L88.CB 7.9565 13.2608 17.2390 21.3938 Constraint (T0288)A25.CB (T0288)I74.CB 9.0572 15.0953 19.6239 21.3000 Constraint (T0288)L9.CB (T0288)K87.CB 8.7566 14.5943 18.9726 21.1997 Constraint (T0288)Q14.CB (T0288)Q35.CB 8.5381 14.2302 18.4993 21.1997 Constraint (T0288)Q10.CB (T0288)M73.CB 8.7537 14.5896 18.9664 21.0997 Constraint (T0288)C30.CB (T0288)Y90.CB 8.0238 13.3731 17.3850 21.0630 Constraint (T0288)T47.CB (T0288)I74.CB 8.9838 14.9730 19.4649 20.9999 Constraint (T0288)T47.CB (T0288)V77.CB 9.2254 15.3757 19.9884 20.9999 Constraint (T0288)S1.CB (T0288)E53.CB 8.2294 13.7156 17.8303 20.9999 Constraint (T0288)A25.CB (T0288)N86.CB 7.9400 13.2333 17.2033 20.9927 Constraint (T0288)Q26.CB (T0288)N86.CB 7.6601 12.7669 16.5970 20.9926 Constraint (T0288)I62.CB (T0288)E80.CB 9.4870 15.8116 20.5551 20.9893 Constraint (T0288)I33.CB (T0288)V68.CB 8.8763 14.7938 19.2320 20.9132 Constraint (T0288)L31.CB (T0288)Q89.CB 8.8527 14.7546 19.1809 20.7069 Constraint (T0288)I19.CB (T0288)E69.CB 8.9751 14.9585 19.4460 20.6208 Constraint (T0288)V57.CB (T0288)K87.CB 8.9697 14.9495 19.4344 20.4616 Constraint (T0288)C28.CB (T0288)K87.CB 8.6272 14.3786 18.6922 20.3819 Constraint (T0288)Y27.CB (T0288)M73.CB 9.0126 15.0209 19.5272 20.1000 Constraint (T0288)Q10.CB (T0288)I54.CB 7.6917 12.8195 16.6654 20.0938 Constraint (T0288)Q10.CB (T0288)I33.CB 7.8952 13.1587 17.1063 20.0938 Constraint (T0288)A42.CB (T0288)L88.CB 8.8783 14.7971 19.2362 20.0128 Constraint (T0288)I19.CB (T0288)K78.CB 9.0368 15.0613 19.5797 20.0000 Constraint (T0288)Y32.CB (T0288)Y91.CB 8.0925 13.4874 17.5337 19.9735 Constraint (T0288)S20.CB (T0288)P29.CB 8.4602 14.1003 18.3304 19.4013 Constraint (T0288)Y27.CB (T0288)N86.CB 7.8418 13.0697 16.9907 19.3880 Constraint (T0288)P29.CB (T0288)A50.CB 8.6689 14.4481 18.7825 19.3000 Constraint (T0288)V7.CB (T0288)V34.CB 9.2648 15.4414 20.0738 19.1999 Constraint (T0288)A50.CB (T0288)Y91.CB 7.8421 13.0701 16.9912 19.1369 Constraint (T0288)Q26.CB (T0288)D52.CB 8.5661 14.2768 18.5598 19.0906 Constraint (T0288)A13.CB (T0288)N58.CB 8.0999 13.4999 17.5498 18.9999 Constraint (T0288)T47.CB (T0288)N58.CB 8.8121 14.6868 19.0928 18.9998 Constraint (T0288)V7.CB (T0288)K63.CB 9.1548 15.2580 19.8354 18.9997 Constraint (T0288)L9.CB (T0288)V34.CB 9.2666 15.4444 20.0777 18.9996 Constraint (T0288)T40.CB (T0288)K78.CB 8.3781 13.9635 18.1525 18.6147 Constraint (T0288)L16.CB (T0288)K67.CB 8.5268 14.2113 18.4746 18.3210 Constraint (T0288)A25.CB (T0288)V57.CB 8.4640 14.1067 18.3388 18.3000 Constraint (T0288)D12.CB (T0288)T47.CB 8.2380 13.7299 17.8489 18.2999 Constraint (T0288)P4.CB (T0288)Y90.CB 7.8904 13.1507 17.0959 18.1999 Constraint (T0288)Q10.CB (T0288)H84.CB 7.6896 12.8160 16.6608 18.0999 Constraint (T0288)S20.CB (T0288)T47.CB 9.1690 15.2816 19.8661 18.0000 Constraint (T0288)T40.CB (T0288)V57.CB 9.1898 15.3164 19.9113 18.0000 Constraint (T0288)S1.CB (T0288)A49.CB 7.8063 13.0105 16.9136 17.9999 Constraint (T0288)V7.CB (T0288)N39.CB 9.4768 15.7946 20.5330 17.9999 Constraint (T0288)S20.CB (T0288)L88.CB 9.1556 15.2593 19.8371 17.9998 Constraint (T0288)Q14.CB (T0288)K72.CB 8.5672 14.2787 18.5623 17.9998 Constraint (T0288)F37.CB (T0288)V77.CB 9.3921 15.6535 20.3496 17.9998 Constraint (T0288)P29.CB (T0288)H84.CB 7.7076 12.8459 16.6997 17.9773 Constraint (T0288)C28.CB (T0288)R60.CB 8.6411 14.4018 18.7224 17.9773 Constraint (T0288)Q10.CB (T0288)S20.CB 8.7107 14.5178 18.8731 17.8380 Constraint (T0288)A71.CB (T0288)Y85.CB 9.0298 15.0497 19.5647 17.4854 Constraint (T0288)A43.CB (T0288)E80.CB 8.6741 14.4569 18.7939 17.4212 Constraint (T0288)I54.CB (T0288)Y90.CB 8.2399 13.7332 17.8531 17.4000 Constraint (T0288)V3.CB (T0288)A50.CB 8.8842 14.8070 19.2491 17.0998 Constraint (T0288)K6.CB (T0288)A43.CB 9.0719 15.1198 19.6557 17.0998 Constraint (T0288)A13.CB (T0288)T82.CB 8.0632 13.4387 17.4703 16.9999 Constraint (T0288)Q14.CB (T0288)N58.CB 8.5615 14.2692 18.5499 16.9998 Constraint (T0288)Y27.CB (T0288)V57.CB 9.3215 15.5358 20.1965 16.9894 Constraint (T0288)T40.CB (T0288)T82.CB 9.0308 15.0514 19.5668 16.7381 Constraint (T0288)L44.CB (T0288)V77.CB 9.2585 15.4309 20.0601 16.4121 Constraint (T0288)I33.CB (T0288)Y91.CB 8.4008 14.0013 18.2017 16.4118 Constraint (T0288)V3.CB (T0288)Q89.CB 5.6152 9.3587 12.1663 16.2999 Constraint (T0288)Q26.CB (T0288)K72.CB 8.1678 13.6130 17.6970 16.2000 Constraint (T0288)M2.CB (T0288)I83.CB 9.1442 15.2404 19.8125 16.1998 Constraint (T0288)T8.CB (T0288)E53.CB 7.8099 13.0164 16.9213 16.0999 Constraint (T0288)Q10.CB (T0288)R60.CB 9.0645 15.1075 19.6398 16.0998 Constraint (T0288)Q10.CB (T0288)D38.CB 8.4237 14.0395 18.2514 16.0998 Constraint (T0288)Q14.CB (T0288)I83.CB 9.1107 15.1844 19.7397 15.9999 Constraint (T0288)S1.CB (T0288)H84.CB 8.6047 14.3412 18.6435 15.9999 Constraint (T0288)Q26.CB (T0288)M73.CB 8.7139 14.5232 18.8801 15.9998 Constraint (T0288)Y27.CB (T0288)R60.CB 8.9742 14.9571 19.4442 15.9894 Constraint (T0288)C28.CB (T0288)H84.CB 7.9842 13.3071 17.2992 15.9773 Constraint (T0288)K63.CB (T0288)Q89.CB 8.9957 14.9929 19.4907 15.8734 Constraint (T0288)V34.CB (T0288)E69.CB 9.2356 15.3926 20.0104 15.6317 Constraint (T0288)A25.CB (T0288)A50.CB 8.5698 14.2829 18.5678 15.3904 Constraint (T0288)C28.CB (T0288)Q89.CB 7.9727 13.2878 17.2742 15.3820 Constraint (T0288)N15.CB (T0288)K67.CB 9.0488 15.0814 19.6058 15.1997 Constraint (T0288)D12.CB (T0288)Q35.CB 9.2027 15.3378 19.9392 15.1997 Constraint (T0288)Y27.CB (T0288)K72.CB 8.7758 14.6264 19.0143 15.1000 Constraint (T0288)A13.CB (T0288)V36.CB 8.3624 13.9374 18.1186 15.0999 Constraint (T0288)D12.CB (T0288)A71.CB 8.8638 14.7731 19.2050 15.0999 Constraint (T0288)Q10.CB (T0288)T55.CB 9.0876 15.1461 19.6899 15.0939 Constraint (T0288)T8.CB (T0288)F37.CB 8.8587 14.7644 19.1938 15.0938 Constraint (T0288)S1.CB (T0288)K87.CB 5.8095 9.6825 12.5872 15.0000 Constraint (T0288)S1.CB (T0288)Y85.CB 7.2157 12.0262 15.6340 15.0000 Constraint (T0288)Q14.CB (T0288)V57.CB 8.9028 14.8381 19.2895 15.0000 Constraint (T0288)S1.CB (T0288)T55.CB 8.4560 14.0933 18.3213 14.9999 Constraint (T0288)Y32.CB (T0288)A43.CB 9.2233 15.3721 19.9837 14.9999 Constraint (T0288)C28.CB (T0288)M73.CB 8.6521 14.4202 18.7462 14.9999 Constraint (T0288)T8.CB (T0288)E76.CB 9.2932 15.4887 20.1354 14.9999 Constraint (T0288)Y32.CB (T0288)V81.CB 9.3634 15.6056 20.2873 14.9999 Constraint (T0288)I19.CB (T0288)R60.CB 8.9142 14.8569 19.3140 14.9999 Constraint (T0288)P4.CB (T0288)A50.CB 9.3152 15.5254 20.1830 14.9998 Constraint (T0288)Q35.CB (T0288)Q75.CB 9.1553 15.2589 19.8366 14.9996 Constraint (T0288)N58.CB (T0288)K67.CB 9.0075 15.0125 19.5162 14.9989 Constraint (T0288)L9.CB (T0288)Y32.CB 8.8441 14.7401 19.1622 14.9937 Constraint (T0288)Q10.CB (T0288)I21.CB 8.3763 13.9604 18.1486 14.8381 Constraint (T0288)V48.CB (T0288)Y90.CB 8.1251 13.5418 17.6043 14.7265 Constraint (T0288)V48.CB (T0288)Y91.CB 8.2887 13.8146 17.9589 14.5381 Constraint (T0288)V34.CB (T0288)Q89.CB 8.9793 14.9654 19.4551 14.5008 Constraint (T0288)Y27.CB (T0288)L88.CB 7.7473 12.9122 16.7859 14.3941 Constraint (T0288)Q26.CB (T0288)Q89.CB 7.6282 12.7137 16.5278 14.3939 Constraint (T0288)L16.CB (T0288)V68.CB 8.8761 14.7935 19.2316 14.3210 Constraint (T0288)L44.CB (T0288)I74.CB 9.0952 15.1587 19.7063 14.2039 Constraint (T0288)V3.CB (T0288)Y90.CB 6.6722 11.1203 14.4564 14.1999 Constraint (T0288)N15.CB (T0288)V68.CB 8.7713 14.6189 19.0046 14.1997 Constraint (T0288)Q10.CB (T0288)D52.CB 7.7859 12.9766 16.8695 14.1000 Constraint (T0288)A13.CB (T0288)V48.CB 8.1427 13.5712 17.6426 14.1000 Constraint (T0288)A13.CB (T0288)I83.CB 8.2164 13.6941 17.8023 14.0999 Constraint (T0288)Q10.CB (T0288)A49.CB 8.2090 13.6817 17.7862 14.0939 Constraint (T0288)V48.CB (T0288)K67.CB 8.9562 14.9270 19.4051 14.0887 Constraint (T0288)V7.CB (T0288)C30.CB 9.3391 15.5651 20.2347 14.0000 Constraint (T0288)P4.CB (T0288)C28.CB 8.5979 14.3299 18.6288 14.0000 Constraint (T0288)S1.CB (T0288)N86.CB 5.9533 9.9222 12.8989 14.0000 Constraint (T0288)K11.CB (T0288)Y85.CB 8.7106 14.5176 18.8729 13.9999 Constraint (T0288)Q14.CB (T0288)M73.CB 8.4443 14.0739 18.2960 13.9998 Constraint (T0288)L16.CB (T0288)A50.CB 9.2906 15.4843 20.1296 13.9997 Constraint (T0288)C28.CB (T0288)V57.CB 8.6134 14.3556 18.6623 13.9878 Constraint (T0288)P29.CB (T0288)I83.CB 8.3474 13.9123 18.0860 13.9773 Constraint (T0288)N58.CB (T0288)V68.CB 9.1287 15.2144 19.7788 13.9773 Constraint (T0288)C30.CB (T0288)N58.CB 9.0947 15.1579 19.7052 13.9023 Constraint (T0288)F37.CB (T0288)K67.CB 9.2225 15.3708 19.9820 13.7099 Constraint (T0288)V70.CB (T0288)L88.CB 8.8928 14.8213 19.2676 13.6760 Constraint (T0288)Y32.CB (T0288)D45.CB 9.3653 15.6089 20.2916 13.2031 Constraint (T0288)I33.CB (T0288)S61.CB 9.3122 15.5203 20.1764 13.2024 Constraint (T0288)K6.CB (T0288)Y32.CB 8.8839 14.8065 19.2484 13.1000 Constraint (T0288)K6.CB (T0288)C30.CB 9.1458 15.2430 19.8159 13.1000 Constraint (T0288)D12.CB (T0288)I33.CB 9.1690 15.2816 19.8661 13.0999 Constraint (T0288)L16.CB (T0288)T47.CB 8.8485 14.7474 19.1717 13.0000 Constraint (T0288)K11.CB (T0288)H84.CB 8.9119 14.8531 19.3090 12.9938 Constraint (T0288)C30.CB (T0288)Y91.CB 7.7918 12.9863 16.8822 12.9748 Constraint (T0288)F37.CB (T0288)V70.CB 9.0160 15.0266 19.5346 12.6988 Constraint (T0288)Q26.CB (T0288)K87.CB 8.4998 14.1663 18.4162 12.3939 Constraint (T0288)T47.CB (T0288)Q89.CB 8.6331 14.3885 18.7050 12.2999 Constraint (T0288)M2.CB (T0288)Q89.CB 5.5400 9.2333 12.0033 12.1999 Constraint (T0288)T8.CB (T0288)I21.CB 8.4277 14.0461 18.2600 12.1000 Constraint (T0288)D12.CB (T0288)I21.CB 8.8318 14.7197 19.1356 12.0999 Constraint (T0288)D12.CB (T0288)M73.CB 8.2949 13.8248 17.9722 12.0998 Constraint (T0288)T8.CB (T0288)L31.CB 8.4370 14.0617 18.2801 12.0940 Constraint (T0288)T8.CB (T0288)V70.CB 8.9384 14.8973 19.3665 12.0940 Constraint (T0288)Q10.CB (T0288)V70.CB 8.8077 14.6795 19.0834 12.0939 Constraint (T0288)T8.CB (T0288)A50.CB 8.1825 13.6375 17.7287 12.0939 Constraint (T0288)T8.CB (T0288)Y32.CB 8.6895 14.4825 18.8273 12.0939 Constraint (T0288)P4.CB (T0288)V81.CB 9.2399 15.3998 20.0198 12.0000 Constraint (T0288)A13.CB (T0288)A71.CB 8.8391 14.7318 19.1513 12.0000 Constraint (T0288)A49.CB (T0288)T82.CB 8.9580 14.9300 19.4090 11.9999 Constraint (T0288)L9.CB (T0288)N86.CB 8.7630 14.6049 18.9864 11.9999 Constraint (T0288)D52.CB (T0288)V77.CB 9.3673 15.6121 20.2957 11.9998 Constraint (T0288)V3.CB (T0288)D45.CB 9.3116 15.5194 20.1752 11.9998 Constraint (T0288)Q26.CB (T0288)V57.CB 8.8558 14.7597 19.1876 11.9998 Constraint (T0288)S20.CB (T0288)E76.CB 9.0856 15.1426 19.6854 11.9996 Constraint (T0288)V70.CB (T0288)E80.CB 9.0415 15.0691 19.5899 11.9894 Constraint (T0288)E69.CB (T0288)T82.CB 9.0617 15.1028 19.6337 11.5391 Constraint (T0288)Q26.CB (T0288)L88.CB 7.4550 12.4249 16.1524 11.3940 Constraint (T0288)V7.CB (T0288)Q89.CB 8.4081 14.0136 18.2176 11.1998 Constraint (T0288)S61.CB (T0288)L88.CB 8.8955 14.8259 19.2737 11.1393 Constraint (T0288)Q10.CB (T0288)I62.CB 9.0689 15.1149 19.6493 11.1000 Constraint (T0288)K6.CB (T0288)A50.CB 8.5946 14.3243 18.6216 11.1000 Constraint (T0288)T8.CB (T0288)S61.CB 9.2314 15.3857 20.0014 11.1000 Constraint (T0288)M2.CB (T0288)Y90.CB 6.4583 10.7639 13.9931 11.0999 Constraint (T0288)P4.CB (T0288)Y91.CB 7.0132 11.6886 15.1952 11.0999 Constraint (T0288)D12.CB (T0288)I54.CB 9.1150 15.1916 19.7491 11.0999 Constraint (T0288)Y27.CB (T0288)D52.CB 8.0725 13.4542 17.4905 11.0907 Constraint (T0288)K11.CB (T0288)Q35.CB 9.1979 15.3298 19.9287 11.0000 Constraint (T0288)A13.CB (T0288)K72.CB 9.3077 15.5128 20.1666 11.0000 Constraint (T0288)P29.CB (T0288)K72.CB 9.0278 15.0464 19.5603 11.0000 Constraint (T0288)A13.CB (T0288)V57.CB 8.3929 13.9882 18.1846 11.0000 Constraint (T0288)S1.CB (T0288)L88.CB 6.3948 10.6580 13.8554 11.0000 Constraint (T0288)A25.CB (T0288)Y85.CB 8.2003 13.6672 17.7673 10.9929 Constraint (T0288)L44.CB (T0288)K78.CB 8.9588 14.9314 19.4108 10.8767 Constraint (T0288)K67.CB (T0288)H84.CB 9.3729 15.6215 20.3080 10.8110 Constraint (T0288)Q26.CB (T0288)A50.CB 9.1162 15.1937 19.7518 10.8000 Constraint (T0288)K65.CB (T0288)L88.CB 8.9014 14.8356 19.2863 10.4011 Constraint (T0288)A25.CB (T0288)Q89.CB 6.7691 11.2818 14.6663 10.3939 Constraint (T0288)Y27.CB (T0288)Q89.CB 8.2848 13.8079 17.9503 10.3820 Constraint (T0288)I54.CB (T0288)Y91.CB 8.1621 13.6035 17.6845 10.3118 Constraint (T0288)I74.CB (T0288)N86.CB 9.1505 15.2508 19.8261 10.2129 Constraint (T0288)V34.CB (T0288)D45.CB 9.1738 15.2897 19.8766 10.2035 Constraint (T0288)K6.CB (T0288)V36.CB 8.5453 14.2422 18.5149 10.1000 Constraint (T0288)K6.CB (T0288)Q89.CB 8.0453 13.4088 17.4315 10.0999 Constraint (T0288)Q10.CB (T0288)L31.CB 8.7387 14.5645 18.9339 10.0939 Constraint (T0288)Q10.CB (T0288)A71.CB 8.8201 14.7002 19.1103 10.0939 Constraint (T0288)K6.CB (T0288)K78.CB 8.8400 14.7334 19.1534 10.0000 Constraint (T0288)N15.CB (T0288)T47.CB 8.8437 14.7396 19.1614 10.0000 Constraint (T0288)Q14.CB (T0288)T82.CB 8.8742 14.7903 19.2274 10.0000 Constraint (T0288)A13.CB (T0288)T47.CB 8.4367 14.0611 18.2795 10.0000 Constraint (T0288)S1.CB (T0288)A50.CB 9.0433 15.0722 19.5939 9.9999 Constraint (T0288)A13.CB (T0288)M73.CB 8.6490 14.4149 18.7394 9.9999 Constraint (T0288)I54.CB (T0288)K78.CB 9.0242 15.0403 19.5524 9.9965 Constraint (T0288)Q26.CB (T0288)Y85.CB 8.1944 13.6574 17.7546 9.9930 Constraint (T0288)C30.CB (T0288)A42.CB 8.9695 14.9492 19.4339 9.6988 Constraint (T0288)A25.CB (T0288)Y90.CB 7.7399 12.8999 16.7698 9.3940 Constraint (T0288)P41.CB (T0288)V70.CB 8.1125 13.5208 17.5771 9.2923 Constraint (T0288)P29.CB (T0288)I74.CB 8.4894 14.1490 18.3937 9.2000 Constraint (T0288)M2.CB (T0288)I62.CB 8.9652 14.9420 19.4246 9.1999 Constraint (T0288)Q14.CB (T0288)I33.CB 8.7601 14.6002 18.9803 9.1929 Constraint (T0288)C30.CB (T0288)V81.CB 9.1662 15.2770 19.8601 9.1370 Constraint (T0288)C28.CB (T0288)A50.CB 9.1955 15.3258 19.9235 9.1013 Constraint (T0288)Q10.CB (T0288)Q35.CB 9.0596 15.0993 19.6291 9.1000 Constraint (T0288)T8.CB (T0288)L88.CB 8.9658 14.9430 19.4259 9.0999 Constraint (T0288)V3.CB (T0288)Y91.CB 6.2518 10.4196 13.5455 9.0999 Constraint (T0288)V36.CB (T0288)H84.CB 9.3688 15.6146 20.2990 9.0743 Constraint (T0288)K6.CB (T0288)V70.CB 9.2637 15.4396 20.0714 9.0000 Constraint (T0288)Q26.CB (T0288)I74.CB 9.1518 15.2531 19.8290 9.0000 Constraint (T0288)V3.CB (T0288)S61.CB 8.9665 14.9442 19.4274 9.0000 Constraint (T0288)M2.CB (T0288)Y91.CB 6.6035 11.0058 14.3075 9.0000 Constraint (T0288)A50.CB (T0288)I74.CB 9.4396 15.7326 20.4524 8.9999 Constraint (T0288)V48.CB (T0288)Q75.CB 9.2888 15.4814 20.1258 8.9999 Constraint (T0288)Q35.CB (T0288)V81.CB 9.3989 15.6648 20.3642 8.9998 Constraint (T0288)Q26.CB (T0288)H84.CB 8.8782 14.7971 19.2362 8.9894 Constraint (T0288)A25.CB (T0288)H84.CB 8.4323 14.0539 18.2701 8.9894 Constraint (T0288)A71.CB (T0288)E80.CB 9.2726 15.4543 20.0906 8.9894 Constraint (T0288)C30.CB (T0288)T82.CB 9.1587 15.2645 19.8438 8.9273 Constraint (T0288)E53.CB (T0288)V68.CB 8.7920 14.6533 19.0493 8.9248 Constraint (T0288)T55.CB (T0288)V68.CB 8.8086 14.6810 19.0853 8.9144 Constraint (T0288)D52.CB (T0288)E69.CB 9.1394 15.2323 19.8019 8.9144 Constraint (T0288)F37.CB (T0288)Y85.CB 9.3293 15.5489 20.2135 8.9107 Constraint (T0288)N58.CB (T0288)N86.CB 8.4252 14.0420 18.2547 8.7060 Constraint (T0288)I62.CB (T0288)Q89.CB 8.5428 14.2380 18.5094 8.4131 Constraint (T0288)A43.CB (T0288)L88.CB 9.0509 15.0849 19.6104 8.4010 Constraint (T0288)C28.CB (T0288)Y90.CB 8.7432 14.5719 18.9435 8.3951 Constraint (T0288)Q26.CB (T0288)Y90.CB 8.5192 14.1986 18.4582 8.3940 Constraint (T0288)T66.CB (T0288)I83.CB 9.3352 15.5586 20.2262 8.3248 Constraint (T0288)E69.CB (T0288)Y85.CB 8.4568 14.0946 18.3230 8.2798 Constraint (T0288)L44.CB (T0288)I54.CB 9.2622 15.4370 20.0681 8.2142 Constraint (T0288)M2.CB (T0288)L31.CB 8.6275 14.3792 18.6929 8.1999 Constraint (T0288)D45.CB (T0288)L88.CB 8.4610 14.1016 18.3321 8.1392 Constraint (T0288)D12.CB (T0288)K72.CB 9.0920 15.1533 19.6993 8.1000 Constraint (T0288)C28.CB (T0288)I74.CB 8.7261 14.5436 18.9067 8.0000 Constraint (T0288)V7.CB (T0288)Y90.CB 9.1798 15.2996 19.8895 7.9999 Constraint (T0288)N15.CB (T0288)E69.CB 9.2328 15.3880 20.0044 7.9999 Constraint (T0288)P4.CB (T0288)K65.CB 9.1530 15.2551 19.8316 7.9999 Constraint (T0288)Q26.CB (T0288)R60.CB 8.9072 14.8453 19.2989 7.9997 Constraint (T0288)L9.CB (T0288)S61.CB 9.2523 15.4205 20.0467 7.9938 Constraint (T0288)Y27.CB (T0288)Y85.CB 8.2027 13.6711 17.7724 7.9929 Constraint (T0288)A25.CB (T0288)I83.CB 8.8759 14.7931 19.2310 7.9894 Constraint (T0288)P29.CB (T0288)N58.CB 9.4240 15.7067 20.4188 7.9894 Constraint (T0288)F37.CB (T0288)V57.CB 8.9809 14.9681 19.4585 7.9878 Constraint (T0288)V36.CB (T0288)Q89.CB 7.8656 13.1093 17.0421 7.9394 Constraint (T0288)K67.CB (T0288)L88.CB 9.1205 15.2009 19.7611 7.8736 Constraint (T0288)S20.CB (T0288)K87.CB 9.1622 15.2703 19.8514 7.8735 Constraint (T0288)K67.CB (T0288)N86.CB 9.2461 15.4101 20.0332 7.7774 Constraint (T0288)L16.CB (T0288)E69.CB 8.9328 14.8879 19.3543 7.7000 Constraint (T0288)L16.CB (T0288)I62.CB 9.1961 15.3269 19.9250 7.7000 Constraint (T0288)Y27.CB (T0288)A50.CB 9.3491 15.5818 20.2563 7.6896 Constraint (T0288)P29.CB (T0288)Q89.CB 8.4448 14.0746 18.2970 7.3951 Constraint (T0288)T55.CB (T0288)Y91.CB 6.9470 11.5783 15.0518 7.3119 Constraint (T0288)T40.CB (T0288)V70.CB 8.7074 14.5124 18.8661 7.3044 Constraint (T0288)A43.CB (T0288)T82.CB 8.8474 14.7457 19.1695 7.2107 Constraint (T0288)I33.CB (T0288)K72.CB 9.1919 15.3199 19.9158 7.2033 Constraint (T0288)N15.CB (T0288)L31.CB 8.8296 14.7160 19.1308 7.1964 Constraint (T0288)D45.CB (T0288)M73.CB 8.8564 14.7607 19.1889 7.1928 Constraint (T0288)D45.CB (T0288)V70.CB 8.4761 14.1269 18.3649 7.1928 Constraint (T0288)Q10.CB (T0288)A50.CB 8.8191 14.6986 19.1081 7.0939 Constraint (T0288)Q35.CB (T0288)V68.CB 8.9068 14.8447 19.2981 7.0108 Constraint (T0288)P4.CB (T0288)Q26.CB 8.5310 14.2183 18.4838 7.0000 Constraint (T0288)A13.CB (T0288)V70.CB 9.4540 15.7567 20.4838 7.0000 Constraint (T0288)S1.CB (T0288)D45.CB 9.1186 15.1976 19.7569 7.0000 Constraint (T0288)V3.CB (T0288)T82.CB 8.6320 14.3867 18.7027 7.0000 Constraint (T0288)S1.CB (T0288)V48.CB 8.4174 14.0291 18.2378 7.0000 Constraint (T0288)A50.CB (T0288)H84.CB 9.3320 15.5534 20.2194 7.0000 Constraint (T0288)P29.CB (T0288)A49.CB 9.2392 15.3986 20.0182 7.0000 Constraint (T0288)I19.CB (T0288)P29.CB 9.0714 15.1190 19.6547 7.0000 Constraint (T0288)Q14.CB (T0288)V70.CB 9.0860 15.1434 19.6864 7.0000 Constraint (T0288)P29.CB (T0288)Y91.CB 8.5089 14.1816 18.4360 7.0000 Constraint (T0288)V7.CB (T0288)Y91.CB 8.4282 14.0470 18.2611 6.9999 Constraint (T0288)M2.CB (T0288)S61.CB 8.9046 14.8410 19.2933 6.9999 Constraint (T0288)L16.CB (T0288)D52.CB 9.0459 15.0765 19.5994 6.9998 Constraint (T0288)L16.CB (T0288)Y32.CB 9.1839 15.3066 19.8986 6.9998 Constraint (T0288)D52.CB (T0288)K92.CB 7.9212 13.2020 17.1626 6.9736 Constraint (T0288)V68.CB (T0288)I83.CB 9.1425 15.2375 19.8088 6.9394 Constraint (T0288)T55.CB (T0288)K72.CB 9.0338 15.0563 19.5732 6.8140 Constraint (T0288)L31.CB (T0288)Y90.CB 8.5852 14.3086 18.6012 6.8013 Constraint (T0288)A43.CB (T0288)K78.CB 9.2888 15.4813 20.1256 6.7473 Constraint (T0288)Y27.CB (T0288)I74.CB 8.9058 14.8430 19.2959 6.1000 Constraint (T0288)K6.CB (T0288)Y91.CB 7.8718 13.1197 17.0556 6.0999 Constraint (T0288)V34.CB (T0288)Y91.CB 9.0187 15.0311 19.5404 6.0998 Constraint (T0288)L31.CB (T0288)Y91.CB 8.7132 14.5219 18.8785 6.0372 Constraint (T0288)V57.CB (T0288)L88.CB 8.3640 13.9401 18.1221 6.0130 Constraint (T0288)S1.CB (T0288)T47.CB 7.0104 11.6839 15.1891 6.0000 Constraint (T0288)V34.CB (T0288)T47.CB 9.2554 15.4257 20.0534 6.0000 Constraint (T0288)I19.CB (T0288)T66.CB 9.3718 15.6197 20.3056 6.0000 Constraint (T0288)V3.CB (T0288)Q26.CB 8.2195 13.6992 17.8090 6.0000 Constraint (T0288)S1.CB (T0288)I83.CB 9.1513 15.2522 19.8278 6.0000 Constraint (T0288)S1.CB (T0288)I33.CB 9.3102 15.5170 20.1720 6.0000 Constraint (T0288)Q14.CB (T0288)T47.CB 8.6013 14.3355 18.6361 6.0000 Constraint (T0288)V3.CB (T0288)C28.CB 8.2438 13.7397 17.8616 6.0000 Constraint (T0288)A13.CB (T0288)I33.CB 8.7834 14.6391 19.0308 6.0000 Constraint (T0288)T8.CB (T0288)N39.CB 9.3829 15.6382 20.3297 6.0000 Constraint (T0288)C30.CB (T0288)Q75.CB 8.4341 14.0569 18.2739 6.0000 Constraint (T0288)I21.CB (T0288)D38.CB 9.0618 15.1031 19.6340 5.9999 Constraint (T0288)M2.CB (T0288)Q26.CB 6.7318 11.2197 14.5856 5.9999 Constraint (T0288)Q35.CB (T0288)V57.CB 9.4323 15.7205 20.4367 5.9999 Constraint (T0288)I33.CB (T0288)R60.CB 8.4143 14.0238 18.2310 5.9999 Constraint (T0288)Y32.CB (T0288)R60.CB 8.5815 14.3025 18.5933 5.9999 Constraint (T0288)S20.CB (T0288)R60.CB 8.3832 13.9720 18.1637 5.9999 Constraint (T0288)S20.CB (T0288)N58.CB 8.8174 14.6957 19.1044 5.9999 Constraint (T0288)S20.CB (T0288)T55.CB 9.0922 15.1537 19.6999 5.9999 Constraint (T0288)N15.CB (T0288)R60.CB 7.8758 13.1264 17.0643 5.9999 Constraint (T0288)A49.CB (T0288)I74.CB 9.5441 15.9068 20.6788 5.9998 Constraint (T0288)V36.CB (T0288)Q75.CB 8.9769 14.9614 19.4499 5.9998 Constraint (T0288)V34.CB (T0288)K72.CB 9.2377 15.3962 20.0150 5.9997 Constraint (T0288)V34.CB (T0288)M73.CB 9.1101 15.1836 19.7386 5.9996 Constraint (T0288)A25.CB (T0288)K87.CB 6.8526 11.4210 14.8473 5.9929 Constraint (T0288)A25.CB (T0288)A49.CB 8.0959 13.4932 17.5411 5.9894 Constraint (T0288)K63.CB (T0288)V81.CB 9.5168 15.8614 20.6198 5.9893 Constraint (T0288)C28.CB (T0288)I83.CB 8.4559 14.0931 18.3211 5.9879 Constraint (T0288)E53.CB (T0288)K92.CB 7.1645 11.9409 15.5231 5.9736 Constraint (T0288)L16.CB (T0288)Y85.CB 8.8765 14.7941 19.2323 5.8736 Constraint (T0288)S61.CB (T0288)K87.CB 8.6485 14.4141 18.7384 5.8023 Constraint (T0288)A49.CB (T0288)V70.CB 9.2635 15.4392 20.0709 5.6105 Constraint (T0288)D45.CB (T0288)Y91.CB 7.7014 12.8357 16.6865 5.5383 Constraint (T0288)A43.CB (T0288)Q89.CB 8.6809 14.4681 18.8086 5.5382 Constraint (T0288)Y27.CB (T0288)K87.CB 7.5240 12.5401 16.3021 5.3880 Constraint (T0288)V57.CB (T0288)Q89.CB 8.4071 14.0118 18.2154 5.3059 Constraint (T0288)E69.CB (T0288)N86.CB 8.6468 14.4113 18.7347 5.2428 Constraint (T0288)D38.CB (T0288)I54.CB 9.1289 15.2149 19.7793 5.2145 Constraint (T0288)T47.CB (T0288)Y90.CB 8.5879 14.3131 18.6071 5.1999 Constraint (T0288)V36.CB (T0288)Y91.CB 8.6845 14.4741 18.8164 5.1370 Constraint (T0288)V3.CB (T0288)I62.CB 8.8591 14.7652 19.1948 5.1000 Constraint (T0288)V3.CB (T0288)P29.CB 8.2442 13.7403 17.8624 5.1000 Constraint (T0288)T47.CB (T0288)Y91.CB 8.3362 13.8936 18.0617 5.0999 Constraint (T0288)A50.CB (T0288)K92.CB 8.0117 13.3529 17.3587 5.0999 Constraint (T0288)S1.CB (T0288)Q89.CB 6.0714 10.1190 13.1547 5.0000 Constraint (T0288)S1.CB (T0288)Y90.CB 6.8668 11.4446 14.8780 5.0000 Constraint (T0288)P29.CB (T0288)V48.CB 9.1289 15.2148 19.7792 5.0000 Constraint (T0288)V7.CB (T0288)P29.CB 9.4167 15.6945 20.4028 5.0000 Constraint (T0288)K6.CB (T0288)P29.CB 9.2117 15.3528 19.9587 5.0000 Constraint (T0288)A13.CB (T0288)Q35.CB 8.2246 13.7077 17.8200 5.0000 Constraint (T0288)P4.CB (T0288)P29.CB 7.0418 11.7364 15.2573 4.9999 Constraint (T0288)P4.CB (T0288)K92.CB 7.2237 12.0395 15.6513 4.9999 Constraint (T0288)S1.CB (T0288)K63.CB 9.1585 15.2642 19.8435 4.9999 Constraint (T0288)K11.CB (T0288)I62.CB 8.8547 14.7578 19.1851 4.9999 Constraint (T0288)N15.CB (T0288)I62.CB 8.9172 14.8620 19.3206 4.9999 Constraint (T0288)T8.CB (T0288)Q75.CB 8.8148 14.6913 19.0987 4.9938 Constraint (T0288)Y27.CB (T0288)H84.CB 7.7360 12.8933 16.7614 4.9894 Constraint (T0288)A49.CB (T0288)K92.CB 7.6154 12.6923 16.5000 4.9736 Constraint (T0288)A42.CB (T0288)Q89.CB 7.9649 13.2748 17.2572 4.9395 Constraint (T0288)V70.CB (T0288)K87.CB 8.2870 13.8116 17.9551 4.6759 Constraint (T0288)M73.CB (T0288)N86.CB 8.7586 14.5977 18.9771 4.6117 Constraint (T0288)V34.CB (T0288)Y90.CB 8.8792 14.7986 19.2382 4.6010 Constraint (T0288)D45.CB (T0288)Q89.CB 6.6671 11.1118 14.4453 4.3407 Constraint (T0288)V36.CB (T0288)Y90.CB 8.5319 14.2198 18.4857 4.3385 Constraint (T0288)N39.CB (T0288)D52.CB 8.4798 14.1330 18.3729 4.2034 Constraint (T0288)V48.CB (T0288)K65.CB 9.2449 15.4082 20.0306 4.2034 Constraint (T0288)D45.CB (T0288)Q75.CB 9.2498 15.4163 20.0412 4.2034 Constraint (T0288)Q14.CB (T0288)V34.CB 8.5947 14.3245 18.6219 4.1930 Constraint (T0288)D45.CB (T0288)A71.CB 9.4204 15.7006 20.4108 4.1929 Constraint (T0288)D45.CB (T0288)I62.CB 9.1268 15.2113 19.7747 4.1929 Constraint (T0288)L31.CB (T0288)D45.CB 8.8872 14.8120 19.2556 4.1929 Constraint (T0288)D45.CB (T0288)Y90.CB 6.7567 11.2612 14.6395 4.1385 Constraint (T0288)I62.CB (T0288)Y90.CB 8.3633 13.9388 18.1204 4.1385 Constraint (T0288)T8.CB (T0288)S20.CB 8.8837 14.8062 19.2480 4.1000 Constraint (T0288)K6.CB (T0288)Y90.CB 7.6252 12.7087 16.5213 4.0999 Constraint (T0288)I19.CB (T0288)Q89.CB 8.9995 14.9991 19.4989 4.0999 Constraint (T0288)I62.CB (T0288)Y91.CB 8.6467 14.4112 18.7346 4.0372 Constraint (T0288)V36.CB (T0288)I62.CB 9.1190 15.1983 19.7577 4.0110 Constraint (T0288)Q35.CB (T0288)I62.CB 9.5370 15.8951 20.6636 4.0110 Constraint (T0288)V34.CB (T0288)K63.CB 9.4164 15.6941 20.4023 4.0110 Constraint (T0288)P4.CB (T0288)I74.CB 9.4875 15.8125 20.5562 4.0000 Constraint (T0288)P4.CB (T0288)I21.CB 9.4478 15.7463 20.4702 4.0000 Constraint (T0288)A13.CB (T0288)I54.CB 9.2723 15.4538 20.0900 4.0000 Constraint (T0288)M2.CB (T0288)D45.CB 9.0524 15.0874 19.6136 4.0000 Constraint (T0288)K63.CB (T0288)Y90.CB 9.5777 15.9629 20.7518 4.0000 Constraint (T0288)C30.CB (T0288)E76.CB 9.1542 15.2569 19.8340 4.0000 Constraint (T0288)K6.CB (T0288)C28.CB 9.3348 15.5580 20.2254 4.0000 Constraint (T0288)L16.CB (T0288)R60.CB 8.9618 14.9363 19.4172 4.0000 Constraint (T0288)M2.CB (T0288)K92.CB 8.4342 14.0570 18.2740 4.0000 Constraint (T0288)C28.CB (T0288)K72.CB 8.3494 13.9157 18.0904 4.0000 Constraint (T0288)K6.CB (T0288)I21.CB 9.1297 15.2162 19.7811 4.0000 Constraint (T0288)A71.CB (T0288)H84.CB 9.2082 15.3470 19.9511 3.9999 Constraint (T0288)S1.CB (T0288)Q26.CB 8.3993 13.9989 18.1986 3.9999 Constraint (T0288)M2.CB (T0288)C28.CB 7.2213 12.0355 15.6462 3.9999 Constraint (T0288)E69.CB (T0288)K78.CB 8.3503 13.9172 18.0923 3.9965 Constraint (T0288)V68.CB (T0288)K78.CB 9.0342 15.0569 19.5740 3.9965 Constraint (T0288)V48.CB (T0288)K78.CB 8.5858 14.3097 18.6026 3.9965 Constraint (T0288)K11.CB (T0288)T55.CB 8.6489 14.4149 18.7393 3.9940 Constraint (T0288)K11.CB (T0288)A50.CB 9.1812 15.3020 19.8926 3.9940 Constraint (T0288)K11.CB (T0288)L31.CB 7.6126 12.6876 16.4939 3.9940 Constraint (T0288)L9.CB (T0288)K72.CB 9.0960 15.1600 19.7079 3.9938 Constraint (T0288)A13.CB (T0288)Y27.CB 7.5569 12.5948 16.3733 3.9809 Constraint (T0288)Y32.CB (T0288)K92.CB 8.0936 13.4893 17.5361 3.9737 Constraint (T0288)I54.CB (T0288)K92.CB 8.8017 14.6694 19.0703 3.8737 Constraint (T0288)C30.CB (T0288)K92.CB 7.2230 12.0383 15.6498 3.8737 Constraint (T0288)I17.CB (T0288)K87.CB 8.6822 14.4703 18.8114 3.8736 Constraint (T0288)Y32.CB (T0288)K72.CB 9.5875 15.9792 20.7729 3.8245 Constraint (T0288)N39.CB (T0288)K78.CB 8.8697 14.7828 19.2176 3.7473 Constraint (T0288)L44.CB (T0288)H84.CB 9.1440 15.2400 19.8120 3.7381 Constraint (T0288)Q35.CB (T0288)Q89.CB 8.4098 14.0164 18.2213 3.5010 Constraint (T0288)A43.CB (T0288)Y90.CB 9.0611 15.1019 19.6325 3.4383 Constraint (T0288)L44.CB (T0288)K87.CB 9.2202 15.3671 19.9772 3.4010 Constraint (T0288)Y27.CB (T0288)Y90.CB 7.7302 12.8837 16.7488 3.3941 Constraint (T0288)I17.CB (T0288)C30.CB 8.2494 13.7490 17.8737 3.3212 Constraint (T0288)K63.CB (T0288)V77.CB 9.4646 15.7744 20.5067 3.3000 Constraint (T0288)I74.CB (T0288)K87.CB 8.9789 14.9648 19.4543 3.2748 Constraint (T0288)N58.CB (T0288)L88.CB 9.0190 15.0316 19.5411 3.1393 Constraint (T0288)V81.CB (T0288)Y90.CB 7.5369 12.5615 16.3300 3.1385 Constraint (T0288)V57.CB (T0288)Y90.CB 7.4505 12.4175 16.1428 3.1385 Constraint (T0288)A42.CB (T0288)Y90.CB 7.6187 12.6978 16.5072 3.1385 Constraint (T0288)A43.CB (T0288)Y91.CB 7.9071 13.1785 17.1321 3.1372 Constraint (T0288)A42.CB (T0288)Y91.CB 7.6506 12.7511 16.5764 3.1372 Constraint (T0288)I19.CB (T0288)C28.CB 9.0111 15.0185 19.5240 3.1013 Constraint (T0288)Q10.CB (T0288)K87.CB 8.9977 14.9962 19.4950 3.1000 Constraint (T0288)T8.CB (T0288)Q35.CB 9.1160 15.1933 19.7513 3.1000 Constraint (T0288)T8.CB (T0288)V34.CB 9.1422 15.2370 19.8082 3.1000 Constraint (T0288)D52.CB (T0288)V93.CB 7.5303 12.5505 16.3157 3.1000 Constraint (T0288)D12.CB (T0288)V70.CB 9.1890 15.3150 19.9096 3.1000 Constraint (T0288)V3.CB (T0288)K92.CB 6.4304 10.7174 13.9326 3.0999 Constraint (T0288)M2.CB (T0288)P29.CB 8.7179 14.5298 18.8887 3.0999 Constraint (T0288)P4.CB (T0288)V70.CB 9.1244 15.2073 19.7695 3.0000 Constraint (T0288)M2.CB (T0288)A25.CB 9.2053 15.3421 19.9448 3.0000 Constraint (T0288)S1.CB (T0288)I54.CB 9.4118 15.6864 20.3923 3.0000 Constraint (T0288)L31.CB (T0288)T47.CB 9.2400 15.4000 20.0200 3.0000 Constraint (T0288)L44.CB (T0288)V57.CB 9.5989 15.9981 20.7976 3.0000 Constraint (T0288)N39.CB (T0288)V77.CB 9.4631 15.7718 20.5034 3.0000 Constraint (T0288)V34.CB (T0288)V81.CB 9.1065 15.1776 19.7308 3.0000 Constraint (T0288)A25.CB (T0288)Q35.CB 7.8749 13.1249 17.0623 3.0000 Constraint (T0288)K11.CB (T0288)D52.CB 7.2651 12.1084 15.7409 3.0000 Constraint (T0288)K11.CB (T0288)A49.CB 8.1402 13.5669 17.6370 3.0000 Constraint (T0288)K11.CB (T0288)V34.CB 9.2610 15.4349 20.0654 3.0000 Constraint (T0288)T47.CB (T0288)K78.CB 9.3441 15.5735 20.2456 3.0000 Constraint (T0288)F37.CB (T0288)K78.CB 8.3829 13.9715 18.1629 3.0000 Constraint (T0288)V36.CB (T0288)K78.CB 9.3870 15.6451 20.3386 3.0000 Constraint (T0288)I33.CB (T0288)K78.CB 9.2089 15.3481 19.9525 3.0000 Constraint (T0288)I21.CB (T0288)K78.CB 7.8313 13.0521 16.9678 3.0000 Constraint (T0288)S20.CB (T0288)K78.CB 8.2185 13.6976 17.8068 3.0000 Constraint (T0288)F37.CB (T0288)E80.CB 9.4743 15.7905 20.5276 3.0000 Constraint (T0288)H84.CB (T0288)V93.CB 7.3587 12.2645 15.9438 3.0000 Constraint (T0288)T55.CB (T0288)V93.CB 5.7257 9.5429 12.4057 3.0000 Constraint (T0288)I54.CB (T0288)V93.CB 7.6887 12.8146 16.6589 3.0000 Constraint (T0288)E53.CB (T0288)V93.CB 5.9565 9.9275 12.9057 3.0000 Constraint (T0288)Y32.CB (T0288)V93.CB 8.4844 14.1407 18.3829 3.0000 Constraint (T0288)P29.CB (T0288)V93.CB 7.0346 11.7244 15.2417 3.0000 Constraint (T0288)P4.CB (T0288)V93.CB 7.0243 11.7072 15.2193 3.0000 Constraint (T0288)T8.CB (T0288)K63.CB 9.4358 15.7264 20.4443 3.0000 Constraint (T0288)Q10.CB (T0288)V34.CB 9.2095 15.3492 19.9540 3.0000 Constraint (T0288)Q14.CB (T0288)V68.CB 8.8938 14.8231 19.2700 3.0000 Constraint (T0288)D12.CB (T0288)Y85.CB 8.9350 14.8917 19.3592 3.0000 Constraint (T0288)L9.CB (T0288)L88.CB 9.2206 15.3676 19.9779 3.0000 Constraint (T0288)S61.CB (T0288)Q75.CB 8.8435 14.7391 19.1608 3.0000 Constraint (T0288)A50.CB (T0288)A71.CB 9.4897 15.8162 20.5610 3.0000 Constraint (T0288)A49.CB (T0288)I62.CB 8.7281 14.5469 18.9109 3.0000 Constraint (T0288)A49.CB (T0288)N58.CB 9.3215 15.5359 20.1967 3.0000 Constraint (T0288)L44.CB (T0288)N58.CB 8.8349 14.7248 19.1423 3.0000 Constraint (T0288)A43.CB (T0288)N58.CB 8.4681 14.1135 18.3476 3.0000 Constraint (T0288)T40.CB (T0288)N58.CB 7.5601 12.6002 16.3803 3.0000 Constraint (T0288)N39.CB (T0288)I83.CB 9.5488 15.9147 20.6892 3.0000 Constraint (T0288)N39.CB (T0288)V81.CB 8.2912 13.8187 17.9642 3.0000 Constraint (T0288)N39.CB (T0288)Q75.CB 9.2629 15.4382 20.0697 3.0000 Constraint (T0288)N39.CB (T0288)I74.CB 9.4291 15.7152 20.4297 3.0000 Constraint (T0288)V36.CB (T0288)N58.CB 9.2212 15.3687 19.9793 3.0000 Constraint (T0288)V34.CB (T0288)R60.CB 9.5696 15.9493 20.7340 3.0000 Constraint (T0288)I19.CB (T0288)S61.CB 9.4063 15.6772 20.3804 3.0000 Constraint (T0288)I17.CB (T0288)S61.CB 8.9431 14.9052 19.3767 3.0000 Constraint (T0288)S1.CB (T0288)Y32.CB 8.8483 14.7471 19.1712 2.9999 Constraint (T0288)S1.CB (T0288)C30.CB 8.9800 14.9667 19.4567 2.9999 Constraint (T0288)A50.CB (T0288)I62.CB 9.2612 15.4353 20.0658 2.9999 Constraint (T0288)A43.CB (T0288)V57.CB 8.9834 14.9724 19.4641 2.9999 Constraint (T0288)A43.CB (T0288)E53.CB 7.9914 13.3190 17.3147 2.9999 Constraint (T0288)A42.CB (T0288)R60.CB 9.3231 15.5385 20.2000 2.9999 Constraint (T0288)P41.CB (T0288)E53.CB 9.4259 15.7098 20.4227 2.9999 Constraint (T0288)N39.CB (T0288)I54.CB 9.1379 15.2298 19.7987 2.9999 Constraint (T0288)I21.CB (T0288)N39.CB 9.3456 15.5760 20.2489 2.9999 Constraint (T0288)V48.CB (T0288)K63.CB 9.4266 15.7111 20.4244 2.9999 Constraint (T0288)V36.CB (T0288)V77.CB 9.3248 15.5413 20.2036 2.9999 Constraint (T0288)V7.CB (T0288)Q75.CB 9.2438 15.4064 20.0283 2.9999 Constraint (T0288)V7.CB (T0288)K65.CB 9.4679 15.7798 20.5137 2.9999 Constraint (T0288)M2.CB (T0288)V70.CB 9.4422 15.7370 20.4580 2.9999 Constraint (T0288)M2.CB (T0288)K65.CB 9.2466 15.4110 20.0344 2.9999 Constraint (T0288)M2.CB (T0288)V57.CB 9.5100 15.8499 20.6049 2.9999 Constraint (T0288)M2.CB (T0288)V34.CB 9.4046 15.6744 20.3767 2.9999 Constraint (T0288)M2.CB (T0288)I21.CB 9.0882 15.1470 19.6911 2.9999 Constraint (T0288)A25.CB (T0288)Y91.CB 9.3236 15.5393 20.2011 2.9998 Constraint (T0288)I21.CB (T0288)Q89.CB 9.3282 15.5470 20.2111 2.9997 Constraint (T0288)N15.CB (T0288)D52.CB 8.4748 14.1247 18.3622 2.9964 Constraint (T0288)N15.CB (T0288)A50.CB 8.6262 14.3770 18.6901 2.9964 Constraint (T0288)N15.CB (T0288)A49.CB 9.1480 15.2466 19.8206 2.9964 Constraint (T0288)N15.CB (T0288)Y32.CB 7.5849 12.6415 16.4340 2.9964 Constraint (T0288)K11.CB (T0288)Y32.CB 7.7891 12.9818 16.8763 2.9940 Constraint (T0288)T8.CB (T0288)C30.CB 9.0699 15.1166 19.6516 2.9940 Constraint (T0288)K11.CB (T0288)S61.CB 8.7450 14.5749 18.9474 2.9939 Constraint (T0288)K72.CB (T0288)H84.CB 9.4374 15.7289 20.4476 2.9894 Constraint (T0288)V68.CB (T0288)V81.CB 8.5396 14.2326 18.5024 2.9894 Constraint (T0288)V48.CB (T0288)E69.CB 9.3207 15.5344 20.1947 2.9894 Constraint (T0288)A43.CB (T0288)V70.CB 9.3271 15.5451 20.2087 2.9894 Constraint (T0288)A42.CB (T0288)E69.CB 9.3113 15.5188 20.1744 2.9894 Constraint (T0288)Y27.CB (T0288)I83.CB 8.5575 14.2625 18.5413 2.9894 Constraint (T0288)Y27.CB (T0288)A49.CB 9.3884 15.6473 20.3415 2.9894 Constraint (T0288)Y27.CB (T0288)V48.CB 9.5456 15.9094 20.6822 2.9894 Constraint (T0288)A25.CB (T0288)V48.CB 8.6321 14.3868 18.7029 2.9894 Constraint (T0288)D12.CB (T0288)Y27.CB 8.6772 14.4621 18.8007 2.9844 Constraint (T0288)K63.CB (T0288)K92.CB 7.4350 12.3917 16.1091 2.8737 Constraint (T0288)T55.CB (T0288)K92.CB 6.5752 10.9587 14.2463 2.8737 Constraint (T0288)L31.CB (T0288)K92.CB 9.2331 15.3884 20.0050 2.8737 Constraint (T0288)N39.CB (T0288)E80.CB 9.4227 15.7045 20.4158 2.8736 Constraint (T0288)S61.CB (T0288)Q89.CB 8.5692 14.2820 18.5666 2.7963 Constraint (T0288)L44.CB (T0288)Y90.CB 8.9017 14.8361 19.2869 2.7382 Constraint (T0288)R60.CB (T0288)L88.CB 8.8867 14.8112 19.2546 2.7382 Constraint (T0288)K63.CB (T0288)E76.CB 9.3279 15.5465 20.2104 2.6210 Constraint (T0288)N58.CB (T0288)Q89.CB 8.4711 14.1186 18.3542 2.6119 Constraint (T0288)Q75.CB (T0288)Y85.CB 9.0262 15.0437 19.5569 2.6118 Constraint (T0288)N58.CB (T0288)K87.CB 8.3336 13.8893 18.0560 2.6118 Constraint (T0288)D38.CB (T0288)I83.CB 9.0266 15.0444 19.5577 2.4764 Constraint (T0288)N58.CB (T0288)Y90.CB 7.0878 11.8130 15.3569 2.4383 Constraint (T0288)P41.CB (T0288)Y90.CB 8.5019 14.1699 18.4209 2.4383 Constraint (T0288)V48.CB (T0288)K92.CB 8.9445 14.9075 19.3797 2.4370 Constraint (T0288)P29.CB (T0288)Y90.CB 8.3572 13.9287 18.1073 2.4011 Constraint (T0288)D38.CB (T0288)Q75.CB 8.6932 14.4887 18.8353 2.2146 Constraint (T0288)D38.CB (T0288)I74.CB 7.8954 13.1590 17.1067 2.2146 Constraint (T0288)D38.CB (T0288)A71.CB 7.8242 13.0403 16.9524 2.2146 Constraint (T0288)D38.CB (T0288)V70.CB 8.9433 14.9054 19.3770 2.2146 Constraint (T0288)S61.CB (T0288)Y90.CB 8.6037 14.3396 18.6414 2.1013 Constraint (T0288)L31.CB (T0288)T40.CB 9.2145 15.3574 19.9647 2.1004 Constraint (T0288)T8.CB (T0288)Q89.CB 8.8621 14.7702 19.2012 2.1000 Constraint (T0288)V3.CB (T0288)L31.CB 8.7224 14.5374 18.8986 2.1000 Constraint (T0288)T8.CB (T0288)Y91.CB 8.9838 14.9730 19.4649 2.1000 Constraint (T0288)E80.CB (T0288)Y90.CB 7.0512 11.7519 15.2775 2.0372 Constraint (T0288)Y27.CB (T0288)Q75.CB 9.5302 15.8837 20.6488 2.0000 Constraint (T0288)A25.CB (T0288)K92.CB 9.1440 15.2400 19.8119 2.0000 Constraint (T0288)Q14.CB (T0288)I54.CB 9.2375 15.3958 20.0146 2.0000 Constraint (T0288)A25.CB (T0288)Q75.CB 9.5302 15.8837 20.6488 2.0000 Constraint (T0288)A25.CB (T0288)N58.CB 9.5920 15.9867 20.7828 2.0000 Constraint (T0288)A13.CB (T0288)R60.CB 9.3050 15.5084 20.1609 2.0000 Constraint (T0288)K11.CB (T0288)K87.CB 9.1048 15.1746 19.7270 2.0000 Constraint (T0288)Q35.CB (T0288)Y90.CB 9.4381 15.7302 20.4493 2.0000 Constraint (T0288)V3.CB (T0288)Y27.CB 8.5910 14.3183 18.6139 2.0000 Constraint (T0288)C28.CB (T0288)Y91.CB 9.2397 15.3996 20.0194 2.0000 Constraint (T0288)K6.CB (T0288)V93.CB 8.1606 13.6010 17.6813 2.0000 Constraint (T0288)S1.CB (T0288)Y91.CB 8.3906 13.9844 18.1797 2.0000 Constraint (T0288)V70.CB (T0288)V93.CB 9.1991 15.3318 19.9314 2.0000 Constraint (T0288)K65.CB (T0288)V93.CB 7.9070 13.1784 17.1319 2.0000 Constraint (T0288)K63.CB (T0288)V93.CB 3.6288 6.0480 7.8624 2.0000 Constraint (T0288)K63.CB (T0288)Y91.CB 6.6564 11.0940 14.4222 2.0000 Constraint (T0288)I62.CB (T0288)V93.CB 7.0288 11.7147 15.2292 2.0000 Constraint (T0288)S61.CB (T0288)V93.CB 5.7554 9.5923 12.4700 2.0000 Constraint (T0288)S61.CB (T0288)K92.CB 9.0205 15.0341 19.5443 2.0000 Constraint (T0288)S61.CB (T0288)Y91.CB 8.2477 13.7461 17.8700 2.0000 Constraint (T0288)R60.CB (T0288)V93.CB 9.0948 15.1580 19.7054 2.0000 Constraint (T0288)V57.CB (T0288)V93.CB 9.4351 15.7251 20.4426 2.0000 Constraint (T0288)L31.CB (T0288)V93.CB 7.7600 12.9333 16.8133 2.0000 Constraint (T0288)C30.CB (T0288)V93.CB 5.5899 9.3165 12.1115 2.0000 Constraint (T0288)P29.CB (T0288)K92.CB 7.6908 12.8181 16.6635 2.0000 Constraint (T0288)C28.CB (T0288)V93.CB 7.9228 13.2047 17.1661 2.0000 Constraint (T0288)C28.CB (T0288)K92.CB 8.3890 13.9816 18.1761 2.0000 Constraint (T0288)C28.CB (T0288)N58.CB 9.5284 15.8807 20.6449 2.0000 Constraint (T0288)C28.CB (T0288)A49.CB 9.3705 15.6174 20.3027 2.0000 Constraint (T0288)C28.CB (T0288)V48.CB 9.2593 15.4322 20.0618 2.0000 Constraint (T0288)V7.CB (T0288)C28.CB 9.4381 15.7301 20.4491 2.0000 Constraint (T0288)P4.CB (T0288)Y27.CB 9.2692 15.4487 20.0833 2.0000 Constraint (T0288)K6.CB (T0288)K92.CB 8.8911 14.8184 19.2640 2.0000 Constraint (T0288)N15.CB (T0288)K65.CB 9.1749 15.2915 19.8789 2.0000 Constraint (T0288)Q14.CB (T0288)R60.CB 8.9765 14.9608 19.4490 2.0000 Constraint (T0288)M2.CB (T0288)Y27.CB 7.9911 13.3185 17.3141 2.0000 Constraint (T0288)S1.CB (T0288)C28.CB 8.8493 14.7488 19.1734 2.0000 Constraint (T0288)D12.CB (T0288)H84.CB 9.1521 15.2535 19.8295 2.0000 Constraint (T0288)D38.CB (T0288)V81.CB 8.7471 14.5786 18.9521 1.9999 Constraint (T0288)T66.CB (T0288)Y85.CB 9.5428 15.9047 20.6761 1.9999 Constraint (T0288)T8.CB (T0288)A71.CB 7.3351 12.2252 15.8927 1.9940 Constraint (T0288)Q10.CB (T0288)Y32.CB 6.2821 10.4701 13.6112 1.9940 Constraint (T0288)Q14.CB (T0288)E53.CB 6.9480 11.5800 15.0540 1.9930 Constraint (T0288)Q14.CB (T0288)D52.CB 7.3644 12.2740 15.9561 1.9930 Constraint (T0288)Q14.CB (T0288)A50.CB 6.9935 11.6558 15.1526 1.9930 Constraint (T0288)Q14.CB (T0288)A49.CB 7.8887 13.1478 17.0922 1.9930 Constraint (T0288)Q14.CB (T0288)Y32.CB 7.2328 12.0546 15.6710 1.9930 Constraint (T0288)Q14.CB (T0288)C30.CB 9.0904 15.1506 19.6958 1.9930 Constraint (T0288)Q14.CB (T0288)Y27.CB 7.3293 12.2154 15.8801 1.9930 Constraint (T0288)Q14.CB (T0288)Q26.CB 6.2214 10.3691 13.4798 1.9930 Constraint (T0288)Q14.CB (T0288)A25.CB 5.0547 8.4245 10.9519 1.9930 Constraint (T0288)A13.CB (T0288)E53.CB 7.8793 13.1322 17.0718 1.9930 Constraint (T0288)A13.CB (T0288)D52.CB 9.3891 15.6485 20.3430 1.9930 Constraint (T0288)A13.CB (T0288)Y32.CB 8.7829 14.6382 19.0296 1.9930 Constraint (T0288)A13.CB (T0288)C30.CB 9.3437 15.5728 20.2447 1.9930 Constraint (T0288)A13.CB (T0288)C28.CB 8.7313 14.5521 18.9177 1.9930 Constraint (T0288)A13.CB (T0288)Q26.CB 4.0378 6.7297 8.7486 1.9930 Constraint (T0288)A13.CB (T0288)A25.CB 5.0569 8.4282 10.9567 1.9930 Constraint (T0288)L31.CB (T0288)P41.CB 9.1224 15.2039 19.7651 1.9879 Constraint (T0288)A13.CB (T0288)T66.CB 8.9692 14.9486 19.4332 1.9879 Constraint (T0288)A13.CB (T0288)P29.CB 7.9898 13.3163 17.3112 1.9879 Constraint (T0288)D12.CB (T0288)E69.CB 8.6792 14.4653 18.8048 1.9879 Constraint (T0288)D12.CB (T0288)V68.CB 8.2274 13.7123 17.8259 1.9879 Constraint (T0288)D12.CB (T0288)K67.CB 8.4641 14.1069 18.3390 1.9879 Constraint (T0288)D12.CB (T0288)T66.CB 6.5201 10.8668 14.1268 1.9879 Constraint (T0288)D12.CB (T0288)C30.CB 9.5604 15.9339 20.7141 1.9879 Constraint (T0288)D12.CB (T0288)P29.CB 6.7602 11.2671 14.6472 1.9879 Constraint (T0288)I33.CB (T0288)K92.CB 8.5273 14.2122 18.4759 1.9737 Constraint (T0288)I17.CB (T0288)N86.CB 8.2671 13.7785 17.9120 1.8736 Constraint (T0288)V70.CB (T0288)Y90.CB 9.1904 15.3174 19.9126 1.8014 Constraint (T0288)E80.CB (T0288)Q89.CB 8.4844 14.1406 18.3828 1.7382 Constraint (T0288)L44.CB (T0288)Q89.CB 7.8538 13.0896 17.0165 1.7382 Constraint (T0288)P41.CB (T0288)Q89.CB 8.0758 13.4597 17.4977 1.7382 Constraint (T0288)R60.CB (T0288)Y90.CB 8.3013 13.8356 17.9862 1.7001 Constraint (T0288)Q35.CB (T0288)N86.CB 9.1404 15.2340 19.8042 1.7000 Constraint (T0288)V70.CB (T0288)Q89.CB 9.2292 15.3819 19.9965 1.6760 Constraint (T0288)E76.CB (T0288)Y85.CB 8.7006 14.5009 18.8512 1.6119 Constraint (T0288)K72.CB (T0288)Y85.CB 8.6857 14.4762 18.8190 1.6119 Constraint (T0288)R60.CB (T0288)K87.CB 8.8352 14.7253 19.1429 1.4011 Constraint (T0288)P41.CB (T0288)K87.CB 8.8861 14.8102 19.2532 1.4011 Constraint (T0288)I74.CB (T0288)Y90.CB 8.8456 14.7427 19.1655 1.3370 Constraint (T0288)M73.CB (T0288)Y90.CB 9.2325 15.3875 20.0038 1.3370 Constraint (T0288)D45.CB (T0288)K92.CB 7.4502 12.4170 16.1421 1.3370 Constraint (T0288)F37.CB (T0288)Q89.CB 9.0669 15.1116 19.6450 1.3369 Constraint (T0288)T66.CB (T0288)H84.CB 9.5873 15.9788 20.7724 1.3310 Constraint (T0288)M73.CB (T0288)K87.CB 7.9854 13.3090 17.3017 1.2748 Constraint (T0288)E69.CB (T0288)L88.CB 8.5440 14.2401 18.5121 1.2748 Constraint (T0288)E69.CB (T0288)K87.CB 7.9652 13.2753 17.2579 1.2748 Constraint (T0288)A50.CB (T0288)K65.CB 8.7470 14.5783 18.9518 1.2035 Constraint (T0288)D45.CB (T0288)K65.CB 9.5138 15.8563 20.6131 1.2035 Constraint (T0288)A42.CB (T0288)K65.CB 8.7393 14.5654 18.9351 1.2035 Constraint (T0288)D38.CB (T0288)K65.CB 9.3344 15.5574 20.2246 1.2035 Constraint (T0288)V36.CB (T0288)K65.CB 8.6052 14.3419 18.6445 1.2035 Constraint (T0288)Q35.CB (T0288)K65.CB 7.5393 12.5654 16.3351 1.2035 Constraint (T0288)A50.CB (T0288)V93.CB 7.9265 13.2109 17.1741 1.1000 Constraint (T0288)A49.CB (T0288)V93.CB 5.4017 9.0029 11.7038 1.1000 Constraint (T0288)V48.CB (T0288)V93.CB 6.8331 11.3886 14.8051 1.1000 Constraint (T0288)T47.CB (T0288)V93.CB 6.0755 10.1258 13.1635 1.1000 Constraint (T0288)T47.CB (T0288)K92.CB 8.9436 14.9059 19.3777 1.1000 Constraint (T0288)I33.CB (T0288)V93.CB 8.1006 13.5010 17.5513 1.1000 Constraint (T0288)V34.CB (T0288)K92.CB 8.9929 14.9881 19.4846 1.1000 Constraint (T0288)D38.CB (T0288)Q89.CB 8.4992 14.1653 18.4148 1.0999 Constraint (T0288)T82.CB (T0288)Y91.CB 4.3080 7.1800 9.3340 1.0372 Constraint (T0288)V81.CB (T0288)Y91.CB 5.3617 8.9362 11.6170 1.0372 Constraint (T0288)E80.CB (T0288)Y91.CB 5.8746 9.7910 12.7282 1.0372 Constraint (T0288)I74.CB (T0288)Y91.CB 7.7887 12.9812 16.8755 1.0372 Constraint (T0288)V70.CB (T0288)Y91.CB 8.4362 14.0604 18.2785 1.0372 Constraint (T0288)R60.CB (T0288)Y91.CB 9.4543 15.7572 20.4844 1.0372 Constraint (T0288)N58.CB (T0288)Y91.CB 6.7390 11.2317 14.6012 1.0372 Constraint (T0288)V57.CB (T0288)Y91.CB 6.6900 11.1500 14.4950 1.0372 Constraint (T0288)L44.CB (T0288)Y91.CB 5.9779 9.9632 12.9522 1.0372 Constraint (T0288)P41.CB (T0288)Y91.CB 5.1956 8.6594 11.2572 1.0372 Constraint (T0288)T40.CB (T0288)Y91.CB 7.0891 11.8152 15.3598 1.0372 Constraint (T0288)F37.CB (T0288)Y91.CB 8.9489 14.9149 19.3893 1.0372 Constraint (T0288)P41.CB (T0288)I62.CB 9.3958 15.6596 20.3575 1.0111 Constraint (T0288)D38.CB (T0288)K67.CB 8.5213 14.2022 18.4628 1.0111 Constraint (T0288)F37.CB (T0288)E53.CB 9.3078 15.5130 20.1668 1.0111 Constraint (T0288)V36.CB (T0288)V68.CB 9.1651 15.2751 19.8576 1.0111 Constraint (T0288)V36.CB (T0288)T55.CB 8.5939 14.3232 18.6201 1.0111 Constraint (T0288)I83.CB (T0288)V93.CB 7.9928 13.3213 17.3177 1.0000 Constraint (T0288)D45.CB (T0288)V93.CB 8.3624 13.9373 18.1185 1.0000 Constraint (T0288)A42.CB (T0288)V93.CB 9.2237 15.3729 19.9848 1.0000 Constraint (T0288)P29.CB (T0288)T82.CB 9.3249 15.5414 20.2038 1.0000 Constraint (T0288)P29.CB (T0288)V81.CB 9.5763 15.9606 20.7487 1.0000 Constraint (T0288)P29.CB (T0288)A42.CB 9.5110 15.8517 20.6073 1.0000 Constraint (T0288)Q26.CB (T0288)A49.CB 8.3767 13.9612 18.1495 1.0000 Constraint (T0288)K11.CB (T0288)N86.CB 9.5953 15.9922 20.7898 1.0000 Constraint (T0288)K11.CB (T0288)E53.CB 9.1218 15.2031 19.7640 1.0000 Constraint (T0288)L9.CB (T0288)Q89.CB 8.9214 14.8690 19.3297 1.0000 Constraint (T0288)V7.CB (T0288)V93.CB 6.5584 10.9307 14.2099 1.0000 Constraint (T0288)Q26.CB (T0288)I83.CB 8.8005 14.6675 19.0677 1.0000 Constraint (T0288)I19.CB (T0288)Y90.CB 8.9373 14.8955 19.3641 1.0000 Constraint (T0288)I17.CB (T0288)Y90.CB 8.1398 13.5663 17.6362 1.0000 Constraint (T0288)I17.CB (T0288)Q89.CB 8.4196 14.0327 18.2425 1.0000 Constraint (T0288)Q14.CB (T0288)E69.CB 8.9663 14.9438 19.4269 1.0000 Constraint (T0288)Q14.CB (T0288)K67.CB 9.4462 15.7437 20.4668 1.0000 Constraint (T0288)L9.CB (T0288)Y91.CB 8.8604 14.7674 19.1976 1.0000 Constraint (T0288)V7.CB (T0288)E76.CB 9.4892 15.8154 20.5600 1.0000 Constraint (T0288)K6.CB (T0288)T40.CB 8.4195 14.0324 18.2422 1.0000 Constraint (T0288)K6.CB (T0288)S20.CB 9.5769 15.9615 20.7500 1.0000 Constraint (T0288)K6.CB (T0288)L16.CB 9.5081 15.8468 20.6008 1.0000 Constraint (T0288)P4.CB (T0288)A43.CB 9.3686 15.6143 20.2986 1.0000 Constraint (T0288)P4.CB (T0288)A42.CB 7.6867 12.8112 16.6545 1.0000 Constraint (T0288)P4.CB (T0288)V36.CB 9.1548 15.2580 19.8354 1.0000 Constraint (T0288)P4.CB (T0288)I19.CB 8.3746 13.9577 18.1451 1.0000 Constraint (T0288)P4.CB (T0288)I17.CB 9.5160 15.8601 20.6181 1.0000 Constraint (T0288)V3.CB (T0288)V81.CB 9.5866 15.9777 20.7710 1.0000 Constraint (T0288)V3.CB (T0288)R60.CB 9.4225 15.7041 20.4153 1.0000 Constraint (T0288)V3.CB (T0288)N58.CB 9.1449 15.2415 19.8139 1.0000 Constraint (T0288)V3.CB (T0288)V57.CB 8.3044 13.8407 17.9929 1.0000 Constraint (T0288)I21.CB (T0288)Y91.CB 9.1003 15.1672 19.7174 1.0000 Constraint (T0288)I21.CB (T0288)Y90.CB 9.2402 15.4004 20.0205 1.0000 Constraint (T0288)V3.CB (T0288)V93.CB 9.3164 15.5273 20.1855 1.0000 Constraint (T0288)Q10.CB (T0288)N86.CB 9.4883 15.8138 20.5579 1.0000 Constraint (T0288)Q10.CB (T0288)E53.CB 9.3988 15.6647 20.3641 1.0000 Constraint (T0288)L16.CB (T0288)K65.CB 9.3106 15.5177 20.1730 1.0000 Constraint (T0288)D12.CB (T0288)S61.CB 9.5801 15.9669 20.7569 1.0000 Constraint (T0288)D12.CB (T0288)R60.CB 6.8822 11.4704 14.9115 1.0000 Constraint (T0288)Q10.CB (T0288)K72.CB 9.5175 15.8625 20.6213 1.0000 Constraint (T0288)Q10.CB (T0288)S61.CB 8.9757 14.9595 19.4473 1.0000 Constraint (T0288)Q75.CB (T0288)H84.CB 9.3759 15.6264 20.3144 1.0000 Constraint (T0288)N15.CB (T0288)Y85.CB 8.8990 14.8317 19.2811 1.0000 Constraint (T0288)N15.CB (T0288)H84.CB 9.1094 15.1823 19.7370 1.0000 Constraint (T0288)S1.CB (T0288)Y27.CB 8.4541 14.0902 18.3172 1.0000 Constraint (T0288)S20.CB (T0288)Q89.CB 8.2130 13.6884 17.7949 0.9999 Constraint (T0288)S20.CB (T0288)N86.CB 9.4108 15.6847 20.3901 0.9999 Constraint (T0288)K67.CB (T0288)K78.CB 9.5584 15.9306 20.7098 0.9965 Constraint (T0288)S61.CB (T0288)K78.CB 9.4119 15.6865 20.3925 0.9965 Constraint (T0288)N15.CB (T0288)T55.CB 8.1962 13.6604 17.7585 0.9965 Constraint (T0288)N15.CB (T0288)E53.CB 4.8664 8.1107 10.5440 0.9965 Constraint (T0288)N15.CB (T0288)C30.CB 6.4422 10.7370 13.9581 0.9965 Constraint (T0288)N15.CB (T0288)P29.CB 7.8883 13.1471 17.0912 0.9965 Constraint (T0288)N15.CB (T0288)C28.CB 7.4825 12.4709 16.2121 0.9965 Constraint (T0288)N15.CB (T0288)Y27.CB 4.6940 7.8234 10.1704 0.9965 Constraint (T0288)N15.CB (T0288)Q26.CB 4.7324 7.8873 10.2535 0.9965 Constraint (T0288)N15.CB (T0288)A25.CB 3.3744 5.6240 7.3112 0.9965 Constraint (T0288)Q14.CB (T0288)Y90.CB 8.5626 14.2711 18.5524 0.9965 Constraint (T0288)Q14.CB (T0288)Q89.CB 6.6040 11.0067 14.3087 0.9965 Constraint (T0288)Q14.CB (T0288)L88.CB 4.2279 7.0466 9.1605 0.9965 Constraint (T0288)Q14.CB (T0288)K87.CB 6.4827 10.8045 14.0458 0.9965 Constraint (T0288)Q14.CB (T0288)N86.CB 7.2134 12.0223 15.6289 0.9965 Constraint (T0288)Q14.CB (T0288)Y85.CB 9.0394 15.0656 19.5853 0.9965 Constraint (T0288)A13.CB (T0288)Y90.CB 8.8339 14.7232 19.1402 0.9965 Constraint (T0288)A13.CB (T0288)Q89.CB 6.0497 10.0828 13.1077 0.9965 Constraint (T0288)A13.CB (T0288)L88.CB 5.0905 8.4842 11.0294 0.9965 Constraint (T0288)A13.CB (T0288)K87.CB 8.1060 13.5100 17.5630 0.9965 Constraint (T0288)A13.CB (T0288)N86.CB 7.5346 12.5577 16.3250 0.9965 Constraint (T0288)D12.CB (T0288)E53.CB 8.8164 14.6939 19.1021 0.9965 Constraint (T0288)D12.CB (T0288)A50.CB 9.0188 15.0314 19.5408 0.9965 Constraint (T0288)D12.CB (T0288)Y32.CB 8.6085 14.3476 18.6519 0.9965 Constraint (T0288)D12.CB (T0288)Q26.CB 6.9730 11.6217 15.1082 0.9965 Constraint (T0288)D12.CB (T0288)A25.CB 6.8042 11.3403 14.7424 0.9965 Constraint (T0288)K11.CB (T0288)E69.CB 6.0037 10.0061 13.0079 0.9940 Constraint (T0288)K11.CB (T0288)V68.CB 5.4389 9.0649 11.7843 0.9940 Constraint (T0288)K11.CB (T0288)K67.CB 3.2048 5.3413 6.9437 0.9940 Constraint (T0288)K11.CB (T0288)T66.CB 3.6048 6.0080 7.8104 0.9940 Constraint (T0288)K11.CB (T0288)C30.CB 4.2640 7.1066 9.2386 0.9940 Constraint (T0288)K11.CB (T0288)P29.CB 3.7051 6.1751 8.0276 0.9940 Constraint (T0288)K11.CB (T0288)C28.CB 6.8055 11.3426 14.7453 0.9940 Constraint (T0288)K11.CB (T0288)Y27.CB 7.4867 12.4779 16.2212 0.9940 Constraint (T0288)Q10.CB (T0288)E69.CB 8.2732 13.7887 17.9253 0.9940 Constraint (T0288)Q10.CB (T0288)V68.CB 6.6470 11.0784 14.4019 0.9940 Constraint (T0288)Q10.CB (T0288)K67.CB 3.8915 6.4859 8.4316 0.9940 Constraint (T0288)Q10.CB (T0288)T66.CB 6.3378 10.5630 13.7319 0.9940 Constraint (T0288)Q10.CB (T0288)C30.CB 6.0069 10.0115 13.0149 0.9940 Constraint (T0288)Q10.CB (T0288)P29.CB 6.7663 11.2771 14.6602 0.9940 Constraint (T0288)Q10.CB (T0288)C28.CB 9.3214 15.5357 20.1964 0.9940 Constraint (T0288)L9.CB (T0288)E69.CB 7.8700 13.1167 17.0518 0.9940 Constraint (T0288)L9.CB (T0288)V68.CB 6.8958 11.4930 14.9409 0.9940 Constraint (T0288)L9.CB (T0288)K67.CB 3.8822 6.4704 8.4115 0.9940 Constraint (T0288)L9.CB (T0288)T66.CB 6.7822 11.3037 14.6948 0.9940 Constraint (T0288)L9.CB (T0288)C30.CB 5.5225 9.2041 11.9653 0.9940 Constraint (T0288)L9.CB (T0288)P29.CB 7.4167 12.3612 16.0695 0.9940 Constraint (T0288)L9.CB (T0288)C28.CB 9.3222 15.5370 20.1980 0.9940 Constraint (T0288)T8.CB (T0288)K72.CB 8.9897 14.9828 19.4777 0.9940 Constraint (T0288)T8.CB (T0288)E69.CB 9.2817 15.4694 20.1103 0.9940 Constraint (T0288)T8.CB (T0288)V68.CB 7.4683 12.4471 16.1813 0.9940 Constraint (T0288)T8.CB (T0288)K67.CB 5.3373 8.8955 11.5642 0.9940 Constraint (T0288)T8.CB (T0288)T66.CB 8.7031 14.5052 18.8568 0.9940 Constraint (T0288)T8.CB (T0288)D38.CB 7.3406 12.2343 15.9046 0.9940 Constraint (T0288)A71.CB (T0288)K87.CB 9.1143 15.1906 19.7477 0.8737 Constraint (T0288)K67.CB (T0288)K87.CB 7.6833 12.8056 16.6473 0.8737 Constraint (T0288)I62.CB (T0288)K92.CB 8.9981 14.9969 19.4959 0.8737 Constraint (T0288)K65.CB (T0288)K87.CB 8.6369 14.3948 18.7132 0.8023 Constraint (T0288)Q26.CB (T0288)Q35.CB 7.5554 12.5923 16.3699 0.8001 Constraint (T0288)I74.CB (T0288)Q89.CB 8.9918 14.9863 19.4821 0.7382 Constraint (T0288)P41.CB (T0288)L88.CB 9.0167 15.0279 19.5363 0.7382 Constraint (T0288)P41.CB (T0288)N86.CB 9.4640 15.7733 20.5052 0.7382 Constraint (T0288)D38.CB (T0288)Y85.CB 9.1463 15.2438 19.8169 0.7382 Constraint (T0288)A43.CB (T0288)K92.CB 7.1879 11.9798 15.5738 0.4370 Constraint (T0288)A42.CB (T0288)K92.CB 6.7740 11.2900 14.6770 0.4370 Constraint (T0288)D38.CB (T0288)K92.CB 8.6311 14.3852 18.7007 0.4370 Constraint (T0288)D38.CB (T0288)Y91.CB 7.9611 13.2685 17.2490 0.4370 Constraint (T0288)V36.CB (T0288)K92.CB 8.4502 14.0836 18.3087 0.4370 Constraint (T0288)I74.CB (T0288)L88.CB 9.5738 15.9564 20.7433 0.4012 Constraint (T0288)M73.CB (T0288)Q89.CB 9.5350 15.8917 20.6591 0.4012 Constraint (T0288)V68.CB (T0288)Y85.CB 9.0017 15.0028 19.5036 0.4012 Constraint (T0288)K65.CB (T0288)Q89.CB 9.4180 15.6967 20.4057 0.4012 Constraint (T0288)R60.CB (T0288)Q89.CB 8.3839 13.9732 18.1651 0.4012 Constraint (T0288)L44.CB (T0288)L88.CB 8.3609 13.9348 18.1153 0.4012 Constraint (T0288)Y27.CB (T0288)Y91.CB 7.0281 11.7135 15.2276 0.4012 Constraint (T0288)Q26.CB (T0288)Y91.CB 8.7295 14.5492 18.9140 0.4012 Constraint (T0288)I83.CB (T0288)K92.CB 6.6053 11.0088 14.3114 0.3370 Constraint (T0288)T82.CB (T0288)K92.CB 6.8206 11.3676 14.7779 0.3370 Constraint (T0288)V81.CB (T0288)K92.CB 4.9476 8.2460 10.7198 0.3370 Constraint (T0288)E80.CB (T0288)K92.CB 2.9601 4.9334 6.4135 0.3370 Constraint (T0288)K78.CB (T0288)K92.CB 3.8313 6.3854 8.3011 0.3370 Constraint (T0288)K78.CB (T0288)Y91.CB 6.7962 11.3270 14.7251 0.3370 Constraint (T0288)K78.CB (T0288)Y90.CB 7.6464 12.7439 16.5671 0.3370 Constraint (T0288)V77.CB (T0288)K92.CB 6.0049 10.0081 13.0105 0.3370 Constraint (T0288)V77.CB (T0288)Y91.CB 6.0270 10.0450 13.0585 0.3370 Constraint (T0288)V77.CB (T0288)Y90.CB 7.6690 12.7817 16.6163 0.3370 Constraint (T0288)E76.CB (T0288)K92.CB 9.3077 15.5128 20.1667 0.3370 Constraint (T0288)E76.CB (T0288)Y91.CB 9.1398 15.2330 19.8029 0.3370 Constraint (T0288)Q75.CB (T0288)K92.CB 9.1467 15.2445 19.8179 0.3370 Constraint (T0288)Q75.CB (T0288)Y91.CB 8.6873 14.4789 18.8226 0.3370 Constraint (T0288)I74.CB (T0288)K92.CB 7.1772 11.9621 15.5507 0.3370 Constraint (T0288)M73.CB (T0288)K92.CB 9.3095 15.5159 20.1707 0.3370 Constraint (T0288)M73.CB (T0288)Y91.CB 7.8424 13.0706 16.9918 0.3370 Constraint (T0288)A71.CB (T0288)Y91.CB 8.2938 13.8231 17.9700 0.3370 Constraint (T0288)K67.CB (T0288)Y91.CB 9.5224 15.8707 20.6319 0.3370 Constraint (T0288)N58.CB (T0288)K92.CB 7.4717 12.4528 16.1886 0.3370 Constraint (T0288)V57.CB (T0288)K92.CB 8.8369 14.7281 19.1466 0.3370 Constraint (T0288)L44.CB (T0288)K92.CB 4.6590 7.7650 10.0945 0.3370 Constraint (T0288)P41.CB (T0288)K92.CB 3.4212 5.7020 7.4126 0.3370 Constraint (T0288)P41.CB (T0288)K67.CB 9.4819 15.8032 20.5442 0.3370 Constraint (T0288)T40.CB (T0288)K92.CB 5.7080 9.5134 12.3674 0.3370 Constraint (T0288)T40.CB (T0288)Y90.CB 8.7955 14.6591 19.0569 0.3370 Constraint (T0288)T40.CB (T0288)Q89.CB 8.7915 14.6525 19.0482 0.3370 Constraint (T0288)N39.CB (T0288)K92.CB 8.1717 13.6195 17.7054 0.3370 Constraint (T0288)N39.CB (T0288)Y91.CB 7.7132 12.8553 16.7118 0.3370 Constraint (T0288)N39.CB (T0288)Q89.CB 9.5176 15.8627 20.6215 0.3370 Constraint (T0288)V36.CB (T0288)T66.CB 9.3410 15.5684 20.2389 0.3370 Constraint (T0288)Q35.CB (T0288)T66.CB 9.2465 15.4109 20.0341 0.3370 Constraint (T0288)A43.CB (T0288)V93.CB 8.6167 14.3612 18.6696 0.1000 Constraint (T0288)D38.CB (T0288)V93.CB 8.3700 13.9500 18.1350 0.1000 Constraint (T0288)F37.CB (T0288)K92.CB 8.7743 14.6238 19.0109 0.1000 Constraint (T0288)V36.CB (T0288)V93.CB 7.3882 12.3137 16.0078 0.1000 Constraint (T0288)Q35.CB (T0288)V93.CB 7.8051 13.0085 16.9110 0.1000 Constraint (T0288)Q35.CB (T0288)K92.CB 5.9971 9.9952 12.9938 0.1000 Constraint (T0288)Q35.CB (T0288)Y91.CB 7.9616 13.2694 17.2502 0.1000 Constraint (T0288)V34.CB (T0288)V93.CB 8.9247 14.8745 19.3368 0.1000 Constraint (T0288)I21.CB (T0288)K92.CB 9.1595 15.2659 19.8456 0.1000 Constraint (T0288)S20.CB (T0288)K92.CB 8.3450 13.9083 18.0808 0.1000 Constraint (T0288)I19.CB (T0288)K92.CB 7.9958 13.3263 17.3242 0.1000 Constraint (T0288)I19.CB (T0288)Y91.CB 8.6286 14.3810 18.6953 0.1000 Constraint (T0288)K92.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: