parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 12.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint (T0288)N58.CB (T0288)M73.CB 4.5610 7.6017 9.8822 100.2126 Constraint (T0288)V57.CB (T0288)M73.CB 3.2260 5.3766 6.9896 100.2126 Constraint (T0288)V57.CB (T0288)V70.CB 4.3155 7.1925 9.3503 100.2126 Constraint (T0288)V36.CB (T0288)A50.CB 3.7444 6.2407 8.1129 100.2126 Constraint (T0288)V36.CB (T0288)A49.CB 4.2283 7.0472 9.1613 100.2126 Constraint (T0288)I33.CB (T0288)I54.CB 4.0383 6.7306 8.7497 100.2126 Constraint (T0288)I33.CB (T0288)A50.CB 3.4221 5.7035 7.4146 100.2126 Constraint (T0288)I33.CB (T0288)A49.CB 4.2069 7.0114 9.1148 100.2126 Constraint (T0288)Y32.CB (T0288)T55.CB 6.5083 10.8471 14.1013 100.2126 Constraint (T0288)Y32.CB (T0288)I54.CB 4.4106 7.3509 9.5562 100.2126 Constraint (T0288)Y32.CB (T0288)A50.CB 4.9894 8.3157 10.8104 100.2126 Constraint (T0288)N58.CB (T0288)T82.CB 3.3554 5.5924 7.2701 99.5125 Constraint (T0288)N58.CB (T0288)V81.CB 3.7480 6.2467 8.1208 99.5125 Constraint (T0288)N58.CB (T0288)I74.CB 5.5024 9.1707 11.9219 99.5125 Constraint (T0288)V57.CB (T0288)I74.CB 3.8576 6.4293 8.3581 99.5125 Constraint (T0288)I54.CB (T0288)I74.CB 5.4653 9.1088 11.8415 99.5125 Constraint (T0288)V57.CB (T0288)T82.CB 4.4846 7.4743 9.7166 98.7743 Constraint (T0288)I62.CB (T0288)M73.CB 4.4048 7.3413 9.5437 98.2247 Constraint (T0288)V36.CB (T0288)D52.CB 5.6027 9.3379 12.1392 98.2247 Constraint (T0288)Q35.CB (T0288)A50.CB 3.7948 6.3247 8.2221 98.2247 Constraint (T0288)V34.CB (T0288)D52.CB 5.9527 9.9212 12.8975 98.2247 Constraint (T0288)V34.CB (T0288)A50.CB 3.8941 6.4902 8.4373 98.2247 Constraint (T0288)I33.CB (T0288)E53.CB 4.7180 7.8633 10.2223 98.2247 Constraint (T0288)I33.CB (T0288)D52.CB 2.8733 4.7888 6.2254 98.2247 Constraint (T0288)Y32.CB (T0288)E53.CB 3.3719 5.6199 7.3058 98.2247 Constraint (T0288)Y32.CB (T0288)D52.CB 4.1767 6.9611 9.0495 98.2247 Constraint (T0288)V57.CB (T0288)V81.CB 3.9892 6.6487 8.6433 98.1755 Constraint (T0288)S61.CB (T0288)V70.CB 6.2832 10.4720 13.6136 97.5916 Constraint (T0288)R60.CB (T0288)M73.CB 3.8160 6.3601 8.2681 97.5916 Constraint (T0288)R60.CB (T0288)V70.CB 5.6060 9.3433 12.1463 97.5916 Constraint (T0288)R60.CB (T0288)E69.CB 5.6925 9.4874 12.3337 97.5916 Constraint (T0288)V36.CB (T0288)V48.CB 3.5279 5.8799 7.6438 97.5916 Constraint (T0288)I33.CB (T0288)V48.CB 3.6941 6.1569 8.0039 97.5916 Constraint (T0288)I62.CB (T0288)I74.CB 5.6578 9.4296 12.2585 97.5246 Constraint (T0288)F37.CB (T0288)A50.CB 6.6450 11.0750 14.3974 97.2128 Constraint (T0288)I54.CB (T0288)V70.CB 4.2366 7.0610 9.1793 97.2127 Constraint (T0288)I33.CB (T0288)A42.CB 4.7090 7.8484 10.2029 97.2127 Constraint (T0288)V57.CB (T0288)A71.CB 6.2058 10.3430 13.4459 97.2126 Constraint (T0288)Y32.CB (T0288)A49.CB 6.3304 10.5507 13.7159 96.9087 Constraint (T0288)P41.CB (T0288)V81.CB 5.3504 8.9173 11.5925 96.8915 Constraint (T0288)V34.CB (T0288)I54.CB 6.6406 11.0677 14.3881 96.1243 Constraint (T0288)Y32.CB (T0288)K67.CB 5.9450 9.9083 12.8808 96.0091 Constraint (T0288)Q35.CB (T0288)V48.CB 6.2067 10.3446 13.4480 95.6037 Constraint (T0288)V57.CB (T0288)Q75.CB 6.4249 10.7082 13.9206 95.5126 Constraint (T0288)E53.CB (T0288)I62.CB 5.4441 9.0735 11.7956 95.2248 Constraint (T0288)A42.CB (T0288)D52.CB 5.9058 9.8430 12.7959 95.2247 Constraint (T0288)Q35.CB (T0288)A49.CB 6.1951 10.3252 13.4227 95.2247 Constraint (T0288)I54.CB (T0288)K63.CB 5.6447 9.4078 12.2302 95.2247 Constraint (T0288)I62.CB (T0288)A71.CB 6.2223 10.3705 13.4816 95.2247 Constraint (T0288)R60.CB (T0288)T82.CB 6.1395 10.2326 13.3023 95.1533 Constraint (T0288)T55.CB (T0288)V70.CB 6.4539 10.7565 13.9835 94.2129 Constraint (T0288)I54.CB (T0288)M73.CB 5.8905 9.8174 12.7627 94.2128 Constraint (T0288)V57.CB (T0288)K72.CB 6.1022 10.1703 13.2214 94.2127 Constraint (T0288)V57.CB (T0288)E69.CB 5.9449 9.9081 12.8806 94.2127 Constraint (T0288)A42.CB (T0288)I54.CB 6.5592 10.9320 14.2116 94.2127 Constraint (T0288)L31.CB (T0288)A71.CB 5.4938 9.1564 11.9033 94.2126 Constraint (T0288)L31.CB (T0288)V70.CB 3.1404 5.2340 6.8042 94.2126 Constraint (T0288)L31.CB (T0288)V57.CB 5.5107 9.1845 11.9399 94.2126 Constraint (T0288)L31.CB (T0288)T55.CB 5.0844 8.4739 11.0161 94.2126 Constraint (T0288)L31.CB (T0288)I54.CB 2.9331 4.8885 6.3551 94.2126 Constraint (T0288)N58.CB (T0288)V77.CB 3.7692 6.2819 8.1665 94.1158 Constraint (T0288)V57.CB (T0288)V77.CB 4.3125 7.1875 9.3437 94.1158 Constraint (T0288)I54.CB (T0288)V81.CB 6.3248 10.5413 13.7036 93.9007 Constraint (T0288)S61.CB (T0288)M73.CB 6.1914 10.3191 13.4148 93.5917 Constraint (T0288)I74.CB (T0288)I83.CB 5.3859 8.9765 11.6694 93.5125 Constraint (T0288)N58.CB (T0288)I83.CB 4.7773 7.9622 10.3509 93.5125 Constraint (T0288)V57.CB (T0288)I83.CB 3.4609 5.7681 7.4985 93.5125 Constraint (T0288)I54.CB (T0288)I83.CB 3.6085 6.0142 7.8184 93.5125 Constraint (T0288)A42.CB (T0288)V81.CB 5.8295 9.7159 12.6307 93.0984 Constraint (T0288)I54.CB (T0288)K67.CB 6.3663 10.6105 13.7936 93.0092 Constraint (T0288)L31.CB (T0288)K67.CB 3.9542 6.5903 8.5674 93.0091 Constraint (T0288)N58.CB (T0288)E76.CB 5.6332 9.3887 12.2053 92.9089 Constraint (T0288)V36.CB (T0288)D45.CB 5.7708 9.6181 12.5035 92.6037 Constraint (T0288)V34.CB (T0288)A49.CB 6.5064 10.8440 14.0972 92.2248 Constraint (T0288)L31.CB (T0288)I62.CB 3.3128 5.5213 7.1777 92.2247 Constraint (T0288)L31.CB (T0288)E53.CB 4.1998 6.9997 9.0996 92.2247 Constraint (T0288)V57.CB (T0288)E76.CB 5.7807 9.6346 12.5249 92.1123 Constraint (T0288)N58.CB (T0288)E80.CB 5.0622 8.4370 10.9681 91.9008 Constraint (T0288)I54.CB (T0288)T82.CB 6.6061 11.0102 14.3132 91.9007 Constraint (T0288)I17.CB (T0288)V57.CB 6.0699 10.1165 13.1514 91.6204 Constraint (T0288)I17.CB (T0288)F37.CB 5.2759 8.7932 11.4312 91.6204 Constraint (T0288)I17.CB (T0288)V36.CB 5.7422 9.5704 12.4415 91.6204 Constraint (T0288)I17.CB (T0288)I33.CB 6.0827 10.1378 13.1791 91.6204 Constraint (T0288)V34.CB (T0288)V48.CB 6.7929 11.3214 14.7178 91.5927 Constraint (T0288)F37.CB (T0288)V48.CB 6.1598 10.2664 13.3463 91.5916 Constraint (T0288)Y32.CB (T0288)V70.CB 6.1811 10.3018 13.3923 91.2249 Constraint (T0288)L31.CB (T0288)M73.CB 6.0534 10.0891 13.1158 91.2127 Constraint (T0288)I33.CB (T0288)A43.CB 6.5969 10.9949 14.2933 91.0212 Constraint (T0288)I21.CB (T0288)I74.CB 4.6689 7.7814 10.1159 90.9203 Constraint (T0288)I21.CB (T0288)A71.CB 4.2609 7.1015 9.2319 90.9203 Constraint (T0288)I21.CB (T0288)V70.CB 3.8560 6.4266 8.3546 90.9203 Constraint (T0288)I21.CB (T0288)K67.CB 4.1570 6.9284 9.0069 90.9203 Constraint (T0288)I21.CB (T0288)I62.CB 5.6943 9.4905 12.3377 90.9203 Constraint (T0288)I21.CB (T0288)I54.CB 4.1369 6.8948 8.9633 90.9203 Constraint (T0288)I21.CB (T0288)E53.CB 6.0434 10.0724 13.0941 90.9203 Constraint (T0288)I21.CB (T0288)D52.CB 5.9513 9.9188 12.8944 90.9203 Constraint (T0288)I21.CB (T0288)A50.CB 6.4091 10.6818 13.8863 90.9203 Constraint (T0288)I21.CB (T0288)V36.CB 6.4855 10.8091 14.0519 90.9203 Constraint (T0288)I21.CB (T0288)Q35.CB 5.3809 8.9682 11.6587 90.9203 Constraint (T0288)I21.CB (T0288)V34.CB 3.8070 6.3450 8.2485 90.9203 Constraint (T0288)I21.CB (T0288)I33.CB 3.6511 6.0851 7.9107 90.9203 Constraint (T0288)I21.CB (T0288)Y32.CB 3.9681 6.6135 8.5976 90.9203 Constraint (T0288)S20.CB (T0288)A50.CB 5.4928 9.1547 11.9012 90.9203 Constraint (T0288)S20.CB (T0288)F37.CB 4.7892 7.9820 10.3766 90.9203 Constraint (T0288)S20.CB (T0288)V36.CB 4.7517 7.9196 10.2954 90.9203 Constraint (T0288)S20.CB (T0288)Q35.CB 2.6305 4.3842 5.6995 90.9203 Constraint (T0288)S20.CB (T0288)V34.CB 2.8756 4.7927 6.2305 90.9203 Constraint (T0288)S20.CB (T0288)I33.CB 4.2595 7.0992 9.2289 90.9203 Constraint (T0288)S20.CB (T0288)Y32.CB 5.7347 9.5578 12.4251 90.9203 Constraint (T0288)I19.CB (T0288)I54.CB 5.5098 9.1830 11.9379 90.9203 Constraint (T0288)I19.CB (T0288)D52.CB 5.5074 9.1791 11.9328 90.9203 Constraint (T0288)I19.CB (T0288)A50.CB 5.2735 8.7892 11.4260 90.9203 Constraint (T0288)I19.CB (T0288)A49.CB 5.8772 9.7953 12.7339 90.9203 Constraint (T0288)I19.CB (T0288)F37.CB 4.1038 6.8397 8.8916 90.9203 Constraint (T0288)I19.CB (T0288)V36.CB 3.1530 5.2550 6.8315 90.9203 Constraint (T0288)I19.CB (T0288)Q35.CB 4.0104 6.6840 8.6891 90.9203 Constraint (T0288)I19.CB (T0288)V34.CB 4.8079 8.0132 10.4172 90.9203 Constraint (T0288)I19.CB (T0288)I33.CB 3.2217 5.3695 6.9803 90.9203 Constraint (T0288)I19.CB (T0288)Y32.CB 6.1508 10.2513 13.3267 90.9203 Constraint (T0288)I17.CB (T0288)V81.CB 3.8817 6.4696 8.4104 90.9203 Constraint (T0288)I17.CB (T0288)V77.CB 5.0569 8.4282 10.9567 90.9203 Constraint (T0288)I17.CB (T0288)I74.CB 4.0678 6.7797 8.8137 90.9203 Constraint (T0288)T55.CB (T0288)I83.CB 5.0250 8.3750 10.8874 90.9007 Constraint (T0288)I33.CB (T0288)I83.CB 5.6096 9.3493 12.1540 90.9007 Constraint (T0288)I62.CB (T0288)I83.CB 5.4945 9.1574 11.9047 90.5246 Constraint (T0288)N58.CB (T0288)H84.CB 5.6277 9.3795 12.1934 90.5127 Constraint (T0288)V57.CB (T0288)H84.CB 4.7223 7.8705 10.2317 90.5127 Constraint (T0288)L31.CB (T0288)I74.CB 5.8239 9.7066 12.6185 90.5126 Constraint (T0288)Y32.CB (T0288)V48.CB 6.7364 11.2273 14.5955 90.2766 Constraint (T0288)C30.CB (T0288)T55.CB 4.8316 8.0527 10.4686 90.2016 Constraint (T0288)C30.CB (T0288)I54.CB 4.6613 7.7688 10.0994 90.2016 Constraint (T0288)T55.CB (T0288)H84.CB 2.9801 4.9668 6.4569 90.1116 Constraint (T0288)A42.CB (T0288)I83.CB 5.4293 9.0488 11.7634 90.1114 Constraint (T0288)I54.CB (T0288)H84.CB 4.4481 7.4135 9.6376 89.5128 Constraint (T0288)T55.CB (T0288)K65.CB 6.1976 10.3293 13.4281 89.5028 Constraint (T0288)V48.CB (T0288)I83.CB 4.6085 7.6808 9.9850 89.4903 Constraint (T0288)R60.CB (T0288)I74.CB 6.0818 10.1364 13.1773 89.2873 Constraint (T0288)L31.CB (T0288)D52.CB 5.7402 9.5670 12.4371 89.2248 Constraint (T0288)V34.CB (T0288)E53.CB 6.7452 11.2420 14.6146 89.2248 Constraint (T0288)Y32.CB (T0288)I62.CB 6.3821 10.6368 13.8279 89.2247 Constraint (T0288)L31.CB (T0288)K63.CB 5.1065 8.5109 11.0642 89.2247 Constraint (T0288)R60.CB (T0288)V81.CB 6.5956 10.9927 14.2905 89.1639 Constraint (T0288)I17.CB (T0288)V48.CB 5.3501 8.9169 11.5920 88.9994 Constraint (T0288)I17.CB (T0288)P41.CB 3.3610 5.6016 7.2821 88.9994 Constraint (T0288)I17.CB (T0288)T40.CB 4.3161 7.1935 9.3516 88.9994 Constraint (T0288)E53.CB (T0288)I83.CB 6.2064 10.3439 13.4471 88.9127 Constraint (T0288)T55.CB (T0288)T82.CB 6.8400 11.4000 14.8200 88.6982 Constraint (T0288)I17.CB (T0288)A42.CB 3.3938 5.6564 7.3533 88.6205 Constraint (T0288)L31.CB (T0288)S61.CB 6.4171 10.6952 13.9038 88.5917 Constraint (T0288)I21.CB (T0288)V57.CB 6.1562 10.2604 13.3385 88.2993 Constraint (T0288)I19.CB (T0288)V48.CB 3.7648 6.2746 8.1570 88.2993 Constraint (T0288)I19.CB (T0288)P41.CB 5.0755 8.4591 10.9969 88.2993 Constraint (T0288)I19.CB (T0288)T40.CB 4.4237 7.3728 9.5847 88.2993 Constraint (T0288)E53.CB (T0288)K63.CB 5.5185 9.1976 11.9568 88.2137 Constraint (T0288)C30.CB (T0288)I62.CB 4.7234 7.8723 10.2340 88.2136 Constraint (T0288)C30.CB (T0288)E53.CB 3.3897 5.6495 7.3443 88.2136 Constraint (T0288)I54.CB (T0288)A71.CB 6.5833 10.9721 14.2638 88.2130 Constraint (T0288)I21.CB (T0288)M73.CB 6.3881 10.6469 13.8409 87.9204 Constraint (T0288)I19.CB (T0288)I74.CB 5.2880 8.8133 11.4573 87.9204 Constraint (T0288)S20.CB (T0288)A42.CB 5.7826 9.6377 12.5290 87.9203 Constraint (T0288)I19.CB (T0288)A42.CB 2.6955 4.4925 5.8402 87.9203 Constraint (T0288)S20.CB (T0288)A71.CB 5.9923 9.9872 12.9833 87.9203 Constraint (T0288)R60.CB (T0288)I83.CB 6.3493 10.5822 13.7568 87.9020 Constraint (T0288)R60.CB (T0288)H84.CB 6.0382 10.0637 13.0829 87.8917 Constraint (T0288)S20.CB (T0288)I54.CB 6.8611 11.4352 14.8657 87.2994 Constraint (T0288)R60.CB (T0288)V77.CB 5.8735 9.7891 12.7259 87.2872 Constraint (T0288)I33.CB (T0288)V70.CB 6.4849 10.8082 14.0507 87.2129 Constraint (T0288)L31.CB (T0288)E69.CB 5.4784 9.1307 11.8699 87.2129 Constraint (T0288)L31.CB (T0288)V68.CB 6.3086 10.5143 13.6686 87.2129 Constraint (T0288)I62.CB (T0288)H84.CB 5.2981 8.8302 11.4793 87.1878 Constraint (T0288)S61.CB (T0288)H84.CB 5.2958 8.8264 11.4743 87.1535 Constraint (T0288)I21.CB (T0288)V68.CB 6.3843 10.6405 13.8326 86.9204 Constraint (T0288)D52.CB (T0288)I83.CB 5.2408 8.7347 11.3552 86.9128 Constraint (T0288)I54.CB (T0288)K65.CB 5.5484 9.2473 12.0215 86.5029 Constraint (T0288)Q35.CB (T0288)D52.CB 6.7388 11.2313 14.6006 86.2247 Constraint (T0288)I17.CB (T0288)D45.CB 5.8473 9.7456 12.6692 85.9994 Constraint (T0288)C30.CB (T0288)K67.CB 5.8509 9.7514 12.6769 85.9981 Constraint (T0288)E53.CB (T0288)H84.CB 5.6601 9.4334 12.2634 85.9130 Constraint (T0288)I17.CB (T0288)A43.CB 6.0538 10.0896 13.1165 85.6205 Constraint (T0288)I19.CB (T0288)D45.CB 6.1345 10.2241 13.2914 85.2993 Constraint (T0288)I21.CB (T0288)V48.CB 6.5274 10.8790 14.1427 85.2993 Constraint (T0288)S20.CB (T0288)V48.CB 6.5672 10.9454 14.2290 85.2993 Constraint (T0288)I62.CB (T0288)K72.CB 6.4184 10.6973 13.9065 85.2251 Constraint (T0288)V48.CB (T0288)V81.CB 6.4869 10.8115 14.0549 84.9628 Constraint (T0288)I21.CB (T0288)A42.CB 6.4664 10.7773 14.0105 84.9203 Constraint (T0288)I19.CB (T0288)A43.CB 5.0241 8.3735 10.8856 84.9203 Constraint (T0288)I21.CB (T0288)L31.CB 3.1659 5.2764 6.8594 84.9203 Constraint (T0288)S20.CB (T0288)L31.CB 6.4079 10.6798 13.8837 84.9203 Constraint (T0288)I17.CB (T0288)Q75.CB 5.6271 9.3785 12.1920 84.9203 Constraint (T0288)I19.CB (T0288)D38.CB 6.6621 11.1034 14.4345 84.9203 Constraint (T0288)I17.CB (T0288)I83.CB 5.2830 8.8051 11.4466 84.9203 Constraint (T0288)L31.CB (T0288)I83.CB 6.2123 10.3539 13.4601 84.9007 Constraint (T0288)P41.CB (T0288)E80.CB 6.1055 10.1758 13.2285 84.8916 Constraint (T0288)I19.CB (T0288)V81.CB 6.1580 10.2633 13.3422 84.2995 Constraint (T0288)I33.CB (T0288)T55.CB 6.9569 11.5948 15.0733 84.2129 Constraint (T0288)C30.CB (T0288)V70.CB 5.6454 9.4091 12.2318 84.2017 Constraint (T0288)D45.CB (T0288)V81.CB 6.1437 10.2395 13.3114 84.1654 Constraint (T0288)D52.CB (T0288)H84.CB 5.9863 9.9772 12.9703 83.9130 Constraint (T0288)L31.CB (T0288)K65.CB 4.1818 6.9696 9.0605 83.5028 Constraint (T0288)Q10.CB (T0288)V81.CB 4.3782 7.2970 9.4861 83.2993 Constraint (T0288)Q10.CB (T0288)P41.CB 3.8415 6.4025 8.3232 83.2993 Constraint (T0288)L9.CB (T0288)T82.CB 4.4724 7.4540 9.6902 83.2993 Constraint (T0288)L9.CB (T0288)V81.CB 3.1716 5.2860 6.8718 83.2993 Constraint (T0288)T8.CB (T0288)T82.CB 3.2353 5.3922 7.0099 83.2993 Constraint (T0288)T8.CB (T0288)V81.CB 4.4495 7.4159 9.6407 83.2993 Constraint (T0288)V7.CB (T0288)T82.CB 4.3451 7.2418 9.4143 83.2993 Constraint (T0288)L9.CB (T0288)V57.CB 6.2287 10.3812 13.4955 83.2932 Constraint (T0288)L9.CB (T0288)V48.CB 4.9755 8.2924 10.7802 83.2932 Constraint (T0288)I21.CB (T0288)I83.CB 6.3718 10.6197 13.8056 83.0466 Constraint (T0288)I19.CB (T0288)I83.CB 5.6066 9.3444 12.1477 83.0466 Constraint (T0288)I17.CB (T0288)L44.CB 6.4324 10.7207 13.9369 82.9994 Constraint (T0288)I17.CB (T0288)I54.CB 6.5113 10.8522 14.1079 82.6204 Constraint (T0288)M73.CB (T0288)I83.CB 6.1067 10.1779 13.2313 82.5126 Constraint (T0288)K65.CB (T0288)I74.CB 6.3032 10.5054 13.6570 82.5029 Constraint (T0288)V57.CB (T0288)E80.CB 6.7032 11.1720 14.5235 82.4364 Constraint (T0288)S20.CB (T0288)I74.CB 6.3094 10.5156 13.6703 82.2994 Constraint (T0288)V7.CB (T0288)V48.CB 4.2024 7.0040 9.1052 82.2993 Constraint (T0288)Q10.CB (T0288)T82.CB 5.8609 9.7682 12.6987 82.2993 Constraint (T0288)L9.CB (T0288)N58.CB 6.2613 10.4356 13.5662 82.2993 Constraint (T0288)K6.CB (T0288)T55.CB 6.0300 10.0500 13.0650 82.2993 Constraint (T0288)L9.CB (T0288)P41.CB 3.5401 5.9001 7.6702 82.2993 Constraint (T0288)C30.CB (T0288)K63.CB 4.3258 7.2097 9.3726 82.2136 Constraint (T0288)I19.CB (T0288)L31.CB 6.4562 10.7604 13.9885 81.9204 Constraint (T0288)I21.CB (T0288)C30.CB 5.9905 9.9841 12.9793 81.9203 Constraint (T0288)D45.CB (T0288)I83.CB 5.6179 9.3631 12.1721 81.9036 Constraint (T0288)L31.CB (T0288)T66.CB 5.4438 9.0730 11.7949 81.6243 Constraint (T0288)A42.CB (T0288)I74.CB 6.4730 10.7884 14.0249 81.5127 Constraint (T0288)L9.CB (T0288)D45.CB 3.8241 6.3735 8.2855 81.2993 Constraint (T0288)T8.CB (T0288)N58.CB 6.0593 10.0989 13.1285 81.2993 Constraint (T0288)Q10.CB (T0288)V77.CB 6.2170 10.3617 13.4702 81.2993 Constraint (T0288)V7.CB (T0288)I54.CB 5.9534 9.9223 12.8990 81.2993 Constraint (T0288)L9.CB (T0288)V77.CB 5.7158 9.5263 12.3842 81.1993 Constraint (T0288)V7.CB (T0288)V81.CB 5.3475 8.9124 11.5861 80.2993 Constraint (T0288)K6.CB (T0288)T82.CB 4.2715 7.1192 9.2550 80.2993 Constraint (T0288)Q10.CB (T0288)A42.CB 5.9645 9.9408 12.9231 80.2993 Constraint (T0288)V7.CB (T0288)V57.CB 6.3689 10.6148 13.7992 80.2993 Constraint (T0288)T8.CB (T0288)V48.CB 6.1284 10.2140 13.2781 80.2993 Constraint (T0288)Q10.CB (T0288)E80.CB 3.5631 5.9385 7.7201 80.2993 Constraint (T0288)T8.CB (T0288)D45.CB 4.5597 7.5996 9.8794 80.2993 Constraint (T0288)L9.CB (T0288)A42.CB 4.1537 6.9229 8.9998 80.2932 Constraint (T0288)R60.CB (T0288)E76.CB 6.0207 10.0345 13.0448 80.2873 Constraint (T0288)S20.CB (T0288)T40.CB 6.2532 10.4220 13.5486 79.2994 Constraint (T0288)Q10.CB (T0288)D45.CB 5.1007 8.5011 11.0515 79.2993 Constraint (T0288)V7.CB (T0288)D45.CB 4.0402 6.7337 8.7538 79.2993 Constraint (T0288)L9.CB (T0288)E80.CB 4.2267 7.0446 9.1579 78.2993 Constraint (T0288)V7.CB (T0288)T55.CB 6.5904 10.9840 14.2792 78.2993 Constraint (T0288)K11.CB (T0288)P41.CB 3.8415 6.4024 8.3231 78.2993 Constraint (T0288)T8.CB (T0288)V57.CB 6.6802 11.1336 14.4737 78.2993 Constraint (T0288)L9.CB (T0288)I83.CB 4.2742 7.1237 9.2608 78.2932 Constraint (T0288)V34.CB (T0288)K67.CB 6.2790 10.4649 13.6044 78.0215 Constraint (T0288)P41.CB (T0288)I83.CB 6.4711 10.7851 14.0207 77.8917 Constraint (T0288)K6.CB (T0288)I54.CB 6.8276 11.3793 14.7932 77.2994 Constraint (T0288)T8.CB (T0288)E80.CB 4.1232 6.8720 8.9336 77.2993 Constraint (T0288)V7.CB (T0288)D52.CB 5.5670 9.2784 12.0619 77.2993 Constraint (T0288)K11.CB (T0288)V81.CB 4.0215 6.7025 8.7133 77.2993 Constraint (T0288)D12.CB (T0288)P41.CB 4.2256 7.0427 9.1555 77.2993 Constraint (T0288)T8.CB (T0288)I83.CB 4.4130 7.3551 9.5616 77.2993 Constraint (T0288)V7.CB (T0288)I83.CB 3.2503 5.4171 7.0422 77.2993 Constraint (T0288)N58.CB (T0288)K78.CB 5.4143 9.0238 11.7309 77.2958 Constraint (T0288)R60.CB (T0288)K72.CB 6.2703 10.4505 13.5857 77.2770 Constraint (T0288)K11.CB (T0288)V77.CB 4.7773 7.9621 10.3507 77.1993 Constraint (T0288)K6.CB (T0288)I83.CB 4.5084 7.5139 9.7681 76.2993 Constraint (T0288)C30.CB (T0288)D52.CB 6.0329 10.0548 13.0713 76.2138 Constraint (T0288)E53.CB (T0288)N86.CB 3.2729 5.4548 7.0913 75.9804 Constraint (T0288)D52.CB (T0288)Y85.CB 3.0154 5.0257 6.5334 75.8807 Constraint (T0288)E53.CB (T0288)Y85.CB 3.9559 6.5932 8.5712 75.8806 Constraint (T0288)A49.CB (T0288)Y85.CB 5.1003 8.5006 11.0507 75.4674 Constraint (T0288)T8.CB (T0288)P41.CB 5.9217 9.8695 12.8303 75.2994 Constraint (T0288)E53.CB (T0288)V70.CB 6.5950 10.9916 14.2891 75.2141 Constraint (T0288)S20.CB (T0288)K67.CB 6.2885 10.4808 13.6251 74.9206 Constraint (T0288)I54.CB (T0288)Y85.CB 3.8736 6.4559 8.3927 74.8686 Constraint (T0288)V70.CB (T0288)I83.CB 6.0676 10.1127 13.1466 74.5128 Constraint (T0288)I33.CB (T0288)I74.CB 6.6073 11.0122 14.3159 74.5029 Constraint (T0288)T8.CB (T0288)H84.CB 5.9776 9.9626 12.9514 74.2995 Constraint (T0288)V7.CB (T0288)H84.CB 4.4785 7.4642 9.7035 74.2995 Constraint (T0288)N15.CB (T0288)P41.CB 4.9434 8.2389 10.7106 74.2994 Constraint (T0288)K11.CB (T0288)A42.CB 5.9123 9.8538 12.8099 74.2993 Constraint (T0288)K11.CB (T0288)K78.CB 4.9597 8.2661 10.7459 74.2993 Constraint (T0288)K11.CB (T0288)E80.CB 4.3606 7.2677 9.4481 74.2993 Constraint (T0288)Q10.CB (T0288)L44.CB 5.5413 9.2355 12.0061 74.2993 Constraint (T0288)Q10.CB (T0288)K78.CB 5.8936 9.8227 12.7695 74.1993 Constraint (T0288)L9.CB (T0288)L44.CB 5.3419 8.9031 11.5740 74.1993 Constraint (T0288)I33.CB (T0288)Y85.CB 4.8062 8.0103 10.4134 73.8686 Constraint (T0288)K6.CB (T0288)H84.CB 3.4547 5.7578 7.4851 73.2995 Constraint (T0288)I17.CB (T0288)E80.CB 6.1170 10.1951 13.2536 73.2994 Constraint (T0288)Y32.CB (T0288)Y85.CB 5.7977 9.6628 12.5617 73.2567 Constraint (T0288)D52.CB (T0288)K87.CB 3.8470 6.4116 8.3351 73.1068 Constraint (T0288)T55.CB (T0288)Y85.CB 4.2853 7.1422 9.2849 72.8686 Constraint (T0288)I21.CB (T0288)K65.CB 6.1500 10.2501 13.3251 72.2995 Constraint (T0288)I17.CB (T0288)T82.CB 6.7703 11.2838 14.6689 72.2994 Constraint (T0288)T8.CB (T0288)A42.CB 6.3397 10.5661 13.7360 72.2934 Constraint (T0288)E53.CB (T0288)K87.CB 4.6895 7.8159 10.1606 72.2686 Constraint (T0288)V48.CB (T0288)Y85.CB 4.4481 7.4135 9.6375 72.1212 Constraint (T0288)D52.CB (T0288)N86.CB 4.2627 7.1045 9.2359 71.9805 Constraint (T0288)L9.CB (T0288)I19.CB 5.3331 8.8884 11.5549 71.5363 Constraint (T0288)T55.CB (T0288)N86.CB 3.7347 6.2246 8.0919 71.4733 Constraint (T0288)V48.CB (T0288)H84.CB 6.8088 11.3480 14.7524 70.6885 Constraint (T0288)I17.CB (T0288)A71.CB 6.4002 10.6670 13.8670 70.6205 Constraint (T0288)C30.CB (T0288)K65.CB 5.2022 8.6703 11.2715 70.5030 Constraint (T0288)I54.CB (T0288)N86.CB 5.0699 8.4499 10.9848 70.4733 Constraint (T0288)K11.CB (T0288)T40.CB 5.8192 9.6987 12.6083 70.2995 Constraint (T0288)A13.CB (T0288)P41.CB 5.5745 9.2908 12.0780 70.2994 Constraint (T0288)T8.CB (T0288)I17.CB 6.4707 10.7844 14.0198 70.2994 Constraint (T0288)I19.CB (T0288)L44.CB 6.8196 11.3660 14.7758 70.2993 Constraint (T0288)I21.CB (T0288)Q75.CB 6.6058 11.0097 14.3126 70.2993 Constraint (T0288)V7.CB (T0288)N58.CB 6.8647 11.4411 14.8735 70.2993 Constraint (T0288)V7.CB (T0288)I33.CB 6.4058 10.6763 13.8792 70.1993 Constraint (T0288)L9.CB (T0288)T40.CB 5.5211 9.2019 11.9625 70.1993 Constraint (T0288)A49.CB (T0288)K87.CB 4.6892 7.8153 10.1599 69.9995 Constraint (T0288)I17.CB (T0288)Q35.CB 6.8682 11.4470 14.8811 69.9204 Constraint (T0288)L16.CB (T0288)F37.CB 4.8479 8.0798 10.5038 69.4205 Constraint (T0288)P4.CB (T0288)T55.CB 4.5882 7.6470 9.9411 69.2996 Constraint (T0288)K63.CB (T0288)H84.CB 6.0809 10.1348 13.1752 69.2995 Constraint (T0288)I21.CB (T0288)T66.CB 6.5729 10.9548 14.2413 69.2995 Constraint (T0288)D12.CB (T0288)V81.CB 6.0722 10.1204 13.1565 69.2993 Constraint (T0288)K6.CB (T0288)V81.CB 6.6760 11.1267 14.4647 69.1993 Constraint (T0288)L9.CB (T0288)A43.CB 6.1149 10.1916 13.2490 69.1993 Constraint (T0288)I21.CB (T0288)E69.CB 6.5080 10.8467 14.1007 68.9206 Constraint (T0288)S20.CB (T0288)V70.CB 6.7072 11.1786 14.5322 68.9206 Constraint (T0288)L31.CB (T0288)H84.CB 6.7841 11.3069 14.6989 68.9011 Constraint (T0288)T55.CB (T0288)K87.CB 6.4369 10.7282 13.9467 68.8997 Constraint (T0288)L16.CB (T0288)I74.CB 5.5054 9.1757 11.9284 68.7203 Constraint (T0288)L16.CB (T0288)A42.CB 5.4330 9.0550 11.7716 68.4205 Constraint (T0288)Q14.CB (T0288)P41.CB 5.6566 9.4277 12.2560 68.2994 Constraint (T0288)Y32.CB (T0288)N86.CB 5.9361 9.8936 12.8616 68.2613 Constraint (T0288)V7.CB (T0288)A42.CB 5.0642 8.4403 10.9724 68.1993 Constraint (T0288)K6.CB (T0288)V57.CB 6.7214 11.2024 14.5631 68.1993 Constraint (T0288)A49.CB (T0288)N86.CB 6.5900 10.9833 14.2783 67.8541 Constraint (T0288)K6.CB (T0288)N58.CB 6.6531 11.0885 14.4151 67.1994 Constraint (T0288)A50.CB (T0288)Y85.CB 6.5771 10.9618 14.2504 67.1555 Constraint (T0288)I17.CB (T0288)K78.CB 6.6303 11.0504 14.3656 66.9998 Constraint (T0288)I19.CB (T0288)A71.CB 6.4838 10.8063 14.0482 66.9204 Constraint (T0288)L16.CB (T0288)T40.CB 4.4855 7.4758 9.7185 66.7994 Constraint (T0288)Q10.CB (T0288)T40.CB 6.1063 10.1772 13.2304 66.2994 Constraint (T0288)V7.CB (T0288)P41.CB 6.0599 10.0998 13.1297 66.1994 Constraint (T0288)K11.CB (T0288)I74.CB 5.8953 9.8254 12.7730 66.1993 Constraint (T0288)L16.CB (T0288)P41.CB 4.5426 7.5710 9.8422 65.7995 Constraint (T0288)P4.CB (T0288)E53.CB 5.7371 9.5619 12.4304 65.2996 Constraint (T0288)V7.CB (T0288)E80.CB 6.4882 10.8137 14.0578 65.2994 Constraint (T0288)I33.CB (T0288)N86.CB 6.4310 10.7184 13.9339 65.2985 Constraint (T0288)V7.CB (T0288)I19.CB 6.3770 10.6283 13.8167 65.1994 Constraint (T0288)V7.CB (T0288)I17.CB 6.2416 10.4027 13.5235 65.1994 Constraint (T0288)V7.CB (T0288)A49.CB 6.1029 10.1715 13.2230 65.1994 Constraint (T0288)D12.CB (T0288)E80.CB 5.7485 9.5809 12.4552 65.0993 Constraint (T0288)Y32.CB (T0288)K87.CB 6.4353 10.7254 13.9430 64.8624 Constraint (T0288)V57.CB (T0288)Y85.CB 5.9944 9.9907 12.9879 64.7735 Constraint (T0288)L16.CB (T0288)V81.CB 6.0881 10.1468 13.1908 64.7205 Constraint (T0288)I17.CB (T0288)M73.CB 6.7401 11.2335 14.6036 64.6208 Constraint (T0288)P4.CB (T0288)H84.CB 4.0868 6.8113 8.8547 64.2996 Constraint (T0288)C30.CB (T0288)S61.CB 6.3604 10.6006 13.7808 63.5808 Constraint (T0288)I62.CB (T0288)Y85.CB 6.2011 10.3352 13.4357 63.4797 Constraint (T0288)L9.CB (T0288)I74.CB 6.0087 10.0145 13.0189 63.1993 Constraint (T0288)I19.CB (T0288)V70.CB 6.5711 10.9518 14.2373 62.9206 Constraint (T0288)I21.CB (T0288)K72.CB 6.7826 11.3044 14.6957 62.9205 Constraint (T0288)L31.CB (T0288)N86.CB 6.5040 10.8400 14.0921 62.7733 Constraint (T0288)L16.CB (T0288)Q75.CB 5.5906 9.3177 12.1130 62.7203 Constraint (T0288)I33.CB (T0288)K87.CB 6.0763 10.1272 13.1654 62.5625 Constraint (T0288)L31.CB (T0288)Y85.CB 6.0524 10.0873 13.1134 62.4737 Constraint (T0288)K6.CB (T0288)V48.CB 6.4737 10.7895 14.0263 62.2998 Constraint (T0288)N15.CB (T0288)F37.CB 5.3971 8.9952 11.6937 62.2996 Constraint (T0288)K6.CB (T0288)D45.CB 6.2891 10.4818 13.6263 62.2995 Constraint (T0288)A50.CB (T0288)K87.CB 6.2170 10.3616 13.4701 62.1614 Constraint (T0288)M73.CB (T0288)T82.CB 6.6657 11.1095 14.4423 61.7364 Constraint (T0288)N58.CB (T0288)V70.CB 6.5349 10.8915 14.1590 61.7096 Constraint (T0288)E53.CB (T0288)L88.CB 4.5470 7.5784 9.8519 61.6698 Constraint (T0288)P4.CB (T0288)D52.CB 6.0681 10.1135 13.1475 61.2996 Constraint (T0288)D12.CB (T0288)T40.CB 5.1282 8.5470 11.1112 61.2994 Constraint (T0288)D45.CB (T0288)T82.CB 6.2794 10.4657 13.6055 60.9039 Constraint (T0288)A42.CB (T0288)Y85.CB 6.2396 10.3993 13.5190 60.7736 Constraint (T0288)I54.CB (T0288)K87.CB 6.5344 10.8906 14.1578 59.8997 Constraint (T0288)D52.CB (T0288)L88.CB 4.6416 7.7359 10.0567 59.7699 Constraint (T0288)N15.CB (T0288)T40.CB 4.5531 7.5884 9.8650 59.2997 Constraint (T0288)P29.CB (T0288)E53.CB 5.7533 9.5888 12.4654 59.2904 Constraint (T0288)C30.CB (T0288)T66.CB 6.1370 10.2284 13.2969 59.2875 Constraint (T0288)P4.CB (T0288)I54.CB 6.5812 10.9686 14.2592 59.1996 Constraint (T0288)L9.CB (T0288)V36.CB 6.5594 10.9324 14.2121 59.1934 Constraint (T0288)P29.CB (T0288)K67.CB 5.8018 9.6696 12.5705 58.9877 Constraint (T0288)I19.CB (T0288)Y85.CB 6.3636 10.6061 13.7879 58.9471 Constraint (T0288)I62.CB (T0288)N86.CB 6.6300 11.0500 14.3651 58.7794 Constraint (T0288)C30.CB (T0288)Y85.CB 6.3331 10.5551 13.7217 57.5318 Constraint (T0288)S61.CB (T0288)I83.CB 6.9057 11.5095 14.9623 57.4794 Constraint (T0288)S20.CB (T0288)D52.CB 6.9387 11.5646 15.0339 57.2996 Constraint (T0288)I54.CB (T0288)E69.CB 6.5734 10.9557 14.2424 57.2142 Constraint (T0288)V7.CB (T0288)Y85.CB 4.0933 6.8221 8.8688 57.1996 Constraint (T0288)C30.CB (T0288)N86.CB 5.3128 8.8546 11.5110 56.1363 Constraint (T0288)A25.CB (T0288)K67.CB 4.7236 7.8727 10.2345 55.9998 Constraint (T0288)T8.CB (T0288)V77.CB 6.6216 11.0361 14.3469 55.9996 Constraint (T0288)L16.CB (T0288)V77.CB 6.0224 10.0373 13.0485 55.7205 Constraint (T0288)V36.CB (T0288)T47.CB 6.3272 10.5454 13.7090 55.2996 Constraint (T0288)I33.CB (T0288)T47.CB 6.6779 11.1298 14.4687 55.2996 Constraint (T0288)K6.CB (T0288)Y85.CB 4.4806 7.4677 9.7081 55.1997 Constraint (T0288)P4.CB (T0288)I83.CB 6.3531 10.5884 13.7650 55.1996 Constraint (T0288)K6.CB (T0288)N86.CB 6.0381 10.0635 13.0825 55.1996 Constraint (T0288)V7.CB (T0288)L44.CB 6.3430 10.5717 13.7432 55.1995 Constraint (T0288)K11.CB (T0288)Q75.CB 6.1647 10.2745 13.3569 55.1993 Constraint (T0288)V48.CB (T0288)K87.CB 5.8175 9.6959 12.6047 55.0261 Constraint (T0288)L9.CB (T0288)K78.CB 6.5621 10.9368 14.2178 54.9995 Constraint (T0288)P41.CB (T0288)I74.CB 6.6924 11.1540 14.5002 54.5917 Constraint (T0288)P41.CB (T0288)V77.CB 6.7833 11.3055 14.6971 54.4000 Constraint (T0288)N15.CB (T0288)A42.CB 6.0441 10.0735 13.0955 54.2998 Constraint (T0288)T8.CB (T0288)T47.CB 4.9993 8.3322 10.8318 54.2996 Constraint (T0288)V7.CB (T0288)T47.CB 3.4711 5.7851 7.5207 54.2996 Constraint (T0288)Q14.CB (T0288)T40.CB 5.4314 9.0523 11.7680 54.2995 Constraint (T0288)P29.CB (T0288)I62.CB 5.9224 9.8706 12.8318 54.2904 Constraint (T0288)L31.CB (T0288)K72.CB 6.9340 11.5567 15.0237 54.2141 Constraint (T0288)L9.CB (T0288)I33.CB 6.8043 11.3406 14.7427 54.1934 Constraint (T0288)P29.CB (T0288)T66.CB 5.7116 9.5194 12.3752 54.1876 Constraint (T0288)D12.CB (T0288)K78.CB 5.6082 9.3471 12.1512 54.0995 Constraint (T0288)L16.CB (T0288)V36.CB 6.7090 11.1817 14.5362 53.3205 Constraint (T0288)L9.CB (T0288)T47.CB 5.0316 8.3861 10.9019 53.2996 Constraint (T0288)K6.CB (T0288)T47.CB 5.4821 9.1369 11.8780 53.2996 Constraint (T0288)I33.CB (T0288)I62.CB 6.8228 11.3713 14.7826 53.2248 Constraint (T0288)P4.CB (T0288)Y85.CB 4.7497 7.9161 10.2909 53.1996 Constraint (T0288)K11.CB (T0288)T82.CB 6.5910 10.9850 14.2805 53.0995 Constraint (T0288)A13.CB (T0288)K78.CB 5.3796 8.9660 11.6558 52.9995 Constraint (T0288)D45.CB (T0288)E80.CB 6.4838 10.8064 14.0483 52.3634 Constraint (T0288)L9.CB (T0288)Y85.CB 6.5217 10.8695 14.1303 52.1998 Constraint (T0288)V70.CB (T0288)V81.CB 6.5458 10.9097 14.1826 51.6010 Constraint (T0288)A49.CB (T0288)L88.CB 5.4426 9.0710 11.7923 51.5613 Constraint (T0288)K11.CB (T0288)D45.CB 6.0731 10.1218 13.1583 51.2997 Constraint (T0288)C28.CB (T0288)K63.CB 5.0705 8.4508 10.9861 51.2904 Constraint (T0288)T8.CB (T0288)Y85.CB 6.0464 10.0773 13.1005 51.1998 Constraint (T0288)V7.CB (T0288)N86.CB 6.5355 10.8925 14.1602 51.1996 Constraint (T0288)I21.CB (T0288)Y85.CB 6.6646 11.1077 14.4399 50.9472 Constraint (T0288)P4.CB (T0288)N86.CB 3.6252 6.0420 7.8545 50.2997 Constraint (T0288)D12.CB (T0288)L44.CB 6.0873 10.1456 13.1892 50.2996 Constraint (T0288)L9.CB (T0288)I54.CB 6.6749 11.1248 14.4623 50.1934 Constraint (T0288)Q26.CB (T0288)K67.CB 5.4427 9.0711 11.7925 49.9997 Constraint (T0288)N15.CB (T0288)N39.CB 6.1361 10.2269 13.2950 49.2999 Constraint (T0288)K6.CB (T0288)D52.CB 6.5303 10.8838 14.1489 49.2997 Constraint (T0288)P4.CB (T0288)K87.CB 4.8439 8.0731 10.4951 49.1998 Constraint (T0288)N15.CB (T0288)V81.CB 6.1255 10.2091 13.2719 49.1996 Constraint (T0288)T47.CB (T0288)I83.CB 5.3292 8.8820 11.5467 48.2997 Constraint (T0288)K11.CB (T0288)L44.CB 6.1185 10.1975 13.2568 48.2996 Constraint (T0288)K63.CB (T0288)N86.CB 5.9790 9.9651 12.9546 48.1998 Constraint (T0288)N15.CB (T0288)Q75.CB 4.8284 8.0474 10.4616 48.1993 Constraint (T0288)P29.CB (T0288)K63.CB 4.6821 7.8035 10.1445 48.0904 Constraint (T0288)D45.CB (T0288)Y85.CB 6.2157 10.3595 13.4673 48.0322 Constraint (T0288)Y32.CB (T0288)L88.CB 5.3437 8.9062 11.5781 47.4744 Constraint (T0288)A25.CB (T0288)T66.CB 3.8108 6.3513 8.2567 47.2997 Constraint (T0288)D12.CB (T0288)A42.CB 5.9770 9.9616 12.9501 47.2996 Constraint (T0288)P29.CB (T0288)K65.CB 5.4276 9.0460 11.7598 47.1996 Constraint (T0288)N15.CB (T0288)V77.CB 5.5022 9.1703 11.9213 47.1996 Constraint (T0288)Q26.CB (T0288)T66.CB 4.6476 7.7460 10.0698 47.1996 Constraint (T0288)N15.CB (T0288)I74.CB 5.4082 9.0137 11.7178 47.1993 Constraint (T0288)V48.CB (T0288)N86.CB 6.8671 11.4452 14.8788 47.1251 Constraint (T0288)T8.CB (T0288)L44.CB 6.3057 10.5095 13.6624 47.0995 Constraint (T0288)N58.CB (T0288)Q75.CB 6.7505 11.2509 14.6262 46.9876 Constraint (T0288)A25.CB (T0288)K65.CB 5.2299 8.7165 11.3315 46.2996 Constraint (T0288)V57.CB (T0288)K78.CB 6.4376 10.7293 13.9481 46.2963 Constraint (T0288)Q26.CB (T0288)K65.CB 6.1945 10.3241 13.4214 46.1996 Constraint (T0288)I33.CB (T0288)D45.CB 6.8077 11.3461 14.7500 46.1925 Constraint (T0288)Y32.CB (T0288)K63.CB 6.8483 11.4138 14.8379 45.9357 Constraint (T0288)A49.CB (T0288)I83.CB 6.7994 11.3323 14.7320 45.7106 Constraint (T0288)Q14.CB (T0288)F37.CB 6.0224 10.0374 13.0486 45.1995 Constraint (T0288)P29.CB (T0288)V70.CB 6.3891 10.6485 13.8431 45.1876 Constraint (T0288)L31.CB (T0288)R60.CB 6.7230 11.2049 14.5664 44.9996 Constraint (T0288)I19.CB (T0288)V57.CB 6.5907 10.9844 14.2798 44.9996 Constraint (T0288)A13.CB (T0288)T40.CB 6.0534 10.0891 13.1158 44.2998 Constraint (T0288)C28.CB (T0288)K67.CB 6.1799 10.2998 13.3897 44.2998 Constraint (T0288)Q10.CB (T0288)I83.CB 6.1020 10.1700 13.2211 44.0995 Constraint (T0288)P29.CB (T0288)I54.CB 6.4315 10.7192 13.9350 43.8774 Constraint (T0288)L16.CB (T0288)A43.CB 6.7158 11.1930 14.5509 43.3209 Constraint (T0288)A25.CB (T0288)V70.CB 6.0533 10.0888 13.1154 43.2998 Constraint (T0288)C28.CB (T0288)T66.CB 5.9127 9.8546 12.8109 43.2998 Constraint (T0288)I17.CB (T0288)V70.CB 6.7106 11.1843 14.5396 42.6210 Constraint (T0288)I19.CB (T0288)T47.CB 6.5266 10.8776 14.1409 42.2998 Constraint (T0288)A50.CB (T0288)L88.CB 5.7744 9.6241 12.5113 42.2995 Constraint (T0288)L9.CB (T0288)H84.CB 6.7171 11.1951 14.5536 42.0998 Constraint (T0288)C28.CB (T0288)E53.CB 5.7133 9.5222 12.3788 42.0905 Constraint (T0288)I17.CB (T0288)E76.CB 6.8972 11.4954 14.9440 41.9208 Constraint (T0288)V36.CB (T0288)Y85.CB 6.8966 11.4943 14.9426 41.3724 Constraint (T0288)A25.CB (T0288)V68.CB 5.7155 9.5259 12.3837 41.2998 Constraint (T0288)V3.CB (T0288)H84.CB 6.4880 10.8134 14.0574 41.1998 Constraint (T0288)T47.CB (T0288)Y85.CB 5.1385 8.5642 11.1335 41.1997 Constraint (T0288)V3.CB (T0288)T55.CB 6.6799 11.1331 14.4731 40.2998 Constraint (T0288)I33.CB (T0288)L88.CB 5.9899 9.9832 12.9782 39.8756 Constraint (T0288)D38.CB (T0288)V48.CB 6.7126 11.1877 14.5440 39.2919 Constraint (T0288)D12.CB (T0288)V77.CB 6.0683 10.1138 13.1480 39.0997 Constraint (T0288)I62.CB (T0288)T82.CB 6.9738 11.6230 15.1099 38.5391 Constraint (T0288)L16.CB (T0288)N39.CB 6.5700 10.9500 14.2350 38.3207 Constraint (T0288)V3.CB (T0288)N86.CB 4.5127 7.5211 9.7774 38.2998 Constraint (T0288)V3.CB (T0288)Y85.CB 5.8386 9.7311 12.6504 38.1998 Constraint (T0288)V7.CB (T0288)A43.CB 6.6355 11.0592 14.3769 38.1996 Constraint (T0288)N15.CB (T0288)K78.CB 6.0868 10.1447 13.1881 37.9995 Constraint (T0288)I62.CB (T0288)V81.CB 6.7438 11.2396 14.6115 37.6133 Constraint (T0288)E53.CB (T0288)K65.CB 6.5741 10.9568 14.2438 37.5033 Constraint (T0288)Q14.CB (T0288)N39.CB 6.0432 10.0720 13.0936 37.2999 Constraint (T0288)T47.CB (T0288)T82.CB 6.7865 11.3108 14.7040 37.2998 Constraint (T0288)D52.CB (T0288)I62.CB 6.9705 11.6175 15.1028 37.2245 Constraint (T0288)K11.CB (T0288)I83.CB 6.5988 10.9979 14.2973 36.9996 Constraint (T0288)C28.CB (T0288)I62.CB 6.3617 10.6028 13.7836 36.9892 Constraint (T0288)D38.CB (T0288)A50.CB 6.9042 11.5069 14.9590 36.6092 Constraint (T0288)I62.CB (T0288)V77.CB 6.7695 11.2825 14.6672 36.2998 Constraint (T0288)A13.CB (T0288)E80.CB 5.8156 9.6926 12.6004 35.9998 Constraint (T0288)I17.CB (T0288)N58.CB 6.5983 10.9972 14.2963 35.9997 Constraint (T0288)L9.CB (T0288)F37.CB 6.8516 11.4193 14.8451 35.9934 Constraint (T0288)V3.CB (T0288)K87.CB 4.2203 7.0338 9.1439 35.2998 Constraint (T0288)V7.CB (T0288)K87.CB 6.0545 10.0908 13.1181 35.1997 Constraint (T0288)D52.CB (T0288)Q89.CB 6.0331 10.0552 13.0718 35.1141 Constraint (T0288)Q14.CB (T0288)K78.CB 5.7918 9.6530 12.5489 34.9997 Constraint (T0288)L16.CB (T0288)A71.CB 6.3820 10.6366 13.8276 34.4210 Constraint (T0288)Y27.CB (T0288)K67.CB 5.3724 8.9540 11.6403 34.2999 Constraint (T0288)V3.CB (T0288)D52.CB 6.3768 10.6280 13.8164 34.2998 Constraint (T0288)Y32.CB (T0288)K65.CB 6.6758 11.1263 14.4641 34.2031 Constraint (T0288)T47.CB (T0288)K87.CB 6.0075 10.0126 13.0163 34.1999 Constraint (T0288)D12.CB (T0288)A43.CB 6.7374 11.2290 14.5977 34.1996 Constraint (T0288)D12.CB (T0288)F37.CB 6.0979 10.1632 13.2121 34.1996 Constraint (T0288)Y27.CB (T0288)T66.CB 4.9919 8.3199 10.8158 34.0999 Constraint (T0288)K63.CB (T0288)Y85.CB 6.9054 11.5090 14.9617 33.9998 Constraint (T0288)S20.CB (T0288)A43.CB 6.9817 11.6361 15.1270 33.9997 Constraint (T0288)Q14.CB (T0288)Q75.CB 6.0916 10.1526 13.1984 33.9996 Constraint (T0288)I19.CB (T0288)Q75.CB 6.9670 11.6116 15.0951 33.9994 Constraint (T0288)E53.CB (T0288)Q89.CB 5.7327 9.5544 12.4208 33.6678 Constraint (T0288)A25.CB (T0288)E69.CB 5.5192 9.1987 11.9583 33.2999 Constraint (T0288)M2.CB (T0288)E53.CB 6.0500 10.0833 13.1083 33.1998 Constraint (T0288)D12.CB (T0288)N39.CB 5.8927 9.8212 12.7675 33.1996 Constraint (T0288)N15.CB (T0288)L44.CB 6.4614 10.7690 13.9997 33.0998 Constraint (T0288)N58.CB (T0288)K72.CB 6.7138 11.1896 14.5465 32.9893 Constraint (T0288)V7.CB (T0288)V36.CB 6.6543 11.0905 14.4176 32.1998 Constraint (T0288)K11.CB (T0288)E76.CB 6.3797 10.6329 13.8227 32.1995 Constraint (T0288)P29.CB (T0288)T55.CB 5.6803 9.4672 12.3074 32.0783 Constraint (T0288)I33.CB (T0288)K67.CB 6.4192 10.6987 13.9083 31.7095 Constraint (T0288)A25.CB (T0288)K63.CB 5.6969 9.4948 12.3433 31.2996 Constraint (T0288)M2.CB (T0288)D52.CB 6.4013 10.6688 13.8694 31.1998 Constraint (T0288)P4.CB (T0288)L88.CB 6.2177 10.3629 13.4718 31.1998 Constraint (T0288)P4.CB (T0288)K63.CB 6.5955 10.9925 14.2902 30.9998 Constraint (T0288)A13.CB (T0288)V77.CB 6.1678 10.2797 13.3636 30.9997 Constraint (T0288)Q14.CB (T0288)V77.CB 6.2306 10.3844 13.4997 30.9997 Constraint (T0288)C30.CB (T0288)E69.CB 5.9981 9.9969 12.9960 30.9142 Constraint (T0288)C28.CB (T0288)K65.CB 5.4572 9.0954 11.8240 30.6009 Constraint (T0288)I54.CB (T0288)V77.CB 6.7336 11.2227 14.5895 30.2998 Constraint (T0288)V3.CB (T0288)E53.CB 6.2432 10.4054 13.5270 30.2997 Constraint (T0288)Y27.CB (T0288)K65.CB 5.5719 9.2865 12.0725 30.0999 Constraint (T0288)I54.CB (T0288)L88.CB 6.3127 10.5212 13.6776 30.0128 Constraint (T0288)T47.CB (T0288)H84.CB 6.8747 11.4578 14.8951 29.9998 Constraint (T0288)K6.CB (T0288)K87.CB 5.6783 9.4638 12.3029 29.1999 Constraint (T0288)N15.CB (T0288)A71.CB 6.2852 10.4754 13.6180 29.1997 Constraint (T0288)A13.CB (T0288)V81.CB 6.0350 10.0584 13.0759 29.0998 Constraint (T0288)V57.CB (T0288)K67.CB 6.8969 11.4948 14.9432 29.0887 Constraint (T0288)Y27.CB (T0288)K63.CB 5.2091 8.6819 11.2865 28.6894 Constraint (T0288)A25.CB (T0288)I62.CB 5.7287 9.5478 12.4122 28.2996 Constraint (T0288)K63.CB (T0288)M73.CB 6.9872 11.6454 15.1390 28.2358 Constraint (T0288)M2.CB (T0288)N86.CB 4.2719 7.1199 9.2558 28.1998 Constraint (T0288)T55.CB (T0288)M73.CB 7.0381 11.7301 15.2492 28.1245 Constraint (T0288)M2.CB (T0288)Y85.CB 6.1044 10.1740 13.2262 28.0998 Constraint (T0288)Q26.CB (T0288)E53.CB 6.1789 10.2981 13.3875 28.0903 Constraint (T0288)K11.CB (T0288)N58.CB 6.2346 10.3910 13.5082 27.9997 Constraint (T0288)T55.CB (T0288)L88.CB 6.0035 10.0059 13.0076 27.7071 Constraint (T0288)C30.CB (T0288)L88.CB 5.6544 9.4240 12.2512 27.2748 Constraint (T0288)M2.CB (T0288)K87.CB 4.0359 6.7265 8.7445 27.1998 Constraint (T0288)Q26.CB (T0288)K63.CB 5.8201 9.7002 12.6102 26.9996 Constraint (T0288)I33.CB (T0288)V57.CB 6.8911 11.4852 14.9308 26.9986 Constraint (T0288)A71.CB (T0288)V81.CB 6.8494 11.4157 14.8404 26.9893 Constraint (T0288)C30.CB (T0288)H84.CB 6.4729 10.7882 14.0247 25.9273 Constraint (T0288)V48.CB (T0288)T82.CB 6.9235 11.5391 15.0008 24.9739 Constraint (T0288)D12.CB (T0288)D45.CB 6.3130 10.5216 13.6781 24.3000 Constraint (T0288)N15.CB (T0288)E76.CB 5.9725 9.9541 12.9404 24.1996 Constraint (T0288)C28.CB (T0288)T55.CB 5.8125 9.6875 12.5938 24.0786 Constraint (T0288)P29.CB (T0288)S61.CB 5.6760 9.4600 12.2980 24.0785 Constraint (T0288)T40.CB (T0288)V81.CB 6.8313 11.3855 14.8012 23.9999 Constraint (T0288)V34.CB (T0288)A71.CB 6.6836 11.1394 14.4812 23.9996 Constraint (T0288)A43.CB (T0288)D52.CB 6.7954 11.3257 14.7234 23.9889 Constraint (T0288)V36.CB (T0288)I54.CB 6.7614 11.2690 14.6497 23.9236 Constraint (T0288)V36.CB (T0288)I83.CB 6.9937 11.6561 15.1530 23.7213 Constraint (T0288)N15.CB (T0288)A43.CB 6.3566 10.5943 13.7725 23.2999 Constraint (T0288)V3.CB (T0288)L88.CB 5.7132 9.5220 12.3786 23.2998 Constraint (T0288)Q14.CB (T0288)A42.CB 6.2543 10.4239 13.5511 23.2000 Constraint (T0288)N15.CB (T0288)V36.CB 6.7945 11.3242 14.7215 23.1999 Constraint (T0288)K6.CB (T0288)E80.CB 6.9099 11.5165 14.9714 23.1997 Constraint (T0288)Y27.CB (T0288)V70.CB 6.5529 10.9215 14.1980 23.1000 Constraint (T0288)Y27.CB (T0288)E69.CB 6.5275 10.8792 14.1430 23.1000 Constraint (T0288)L16.CB (T0288)Q35.CB 6.8167 11.3612 14.7695 22.9996 Constraint (T0288)A49.CB (T0288)Q89.CB 6.1062 10.1770 13.2301 22.7380 Constraint (T0288)P29.CB (T0288)E69.CB 6.4854 10.8090 14.0516 22.6774 Constraint (T0288)A25.CB (T0288)E53.CB 5.9328 9.8881 12.8545 22.3904 Constraint (T0288)F37.CB (T0288)A49.CB 6.9037 11.5062 14.9581 22.3042 Constraint (T0288)Q26.CB (T0288)V68.CB 5.4204 9.0340 11.7442 22.2000 Constraint (T0288)Q26.CB (T0288)E69.CB 6.0401 10.0669 13.0869 22.1998 Constraint (T0288)Q14.CB (T0288)V81.CB 6.3856 10.6426 13.8354 21.9999 Constraint (T0288)T8.CB (T0288)K78.CB 6.5246 10.8743 14.1366 21.9998 Constraint (T0288)T47.CB (T0288)V81.CB 6.4630 10.7716 14.0031 21.9998 Constraint (T0288)K11.CB (T0288)V57.CB 6.4251 10.7085 13.9211 21.9997 Constraint (T0288)Q10.CB (T0288)T47.CB 5.6144 9.3573 12.1645 21.0999 Constraint (T0288)V7.CB (T0288)E53.CB 6.7755 11.2925 14.6803 20.9996 Constraint (T0288)I21.CB (T0288)V81.CB 6.9665 11.6109 15.0942 20.9996 Constraint (T0288)D38.CB (T0288)A49.CB 6.8231 11.3719 14.7835 20.9892 Constraint (T0288)L16.CB (T0288)K78.CB 5.9990 9.9983 12.9977 20.7473 Constraint (T0288)A13.CB (T0288)N39.CB 5.9297 9.8828 12.8476 20.2999 Constraint (T0288)K6.CB (T0288)A49.CB 6.4376 10.7293 13.9481 20.0999 Constraint (T0288)Q10.CB (T0288)V48.CB 5.6686 9.4476 12.2819 20.0998 Constraint (T0288)Q14.CB (T0288)E80.CB 6.4345 10.7242 13.9414 19.9999 Constraint (T0288)A13.CB (T0288)Q75.CB 6.5093 10.8489 14.1036 19.9998 Constraint (T0288)Y27.CB (T0288)V68.CB 6.2286 10.3809 13.4952 19.1000 Constraint (T0288)A13.CB (T0288)L44.CB 6.2795 10.4658 13.6055 19.1000 Constraint (T0288)Q10.CB (T0288)A43.CB 6.1215 10.2025 13.2632 19.0999 Constraint (T0288)Q10.CB (T0288)N58.CB 6.2163 10.3605 13.4686 19.0998 Constraint (T0288)Y27.CB (T0288)E53.CB 5.9439 9.9065 12.8785 19.0906 Constraint (T0288)C28.CB (T0288)V70.CB 6.2464 10.4107 13.5339 18.9999 Constraint (T0288)N15.CB (T0288)E80.CB 6.7214 11.2024 14.5631 18.9997 Constraint (T0288)Y27.CB (T0288)I62.CB 6.2228 10.3714 13.4828 18.9894 Constraint (T0288)C30.CB (T0288)K87.CB 6.5252 10.8753 14.1378 18.3688 Constraint (T0288)D52.CB (T0288)Y90.CB 6.2370 10.3950 13.5134 18.2690 Constraint (T0288)M2.CB (T0288)L88.CB 4.6782 7.7970 10.1361 18.1999 Constraint (T0288)L16.CB (T0288)E76.CB 6.8565 11.4276 14.8558 18.0998 Constraint (T0288)M73.CB (T0288)H84.CB 7.0170 11.6949 15.2034 18.0116 Constraint (T0288)I17.CB (T0288)T47.CB 6.1906 10.3177 13.4130 18.0000 Constraint (T0288)V48.CB (T0288)I74.CB 6.9333 11.5554 15.0221 17.9999 Constraint (T0288)I19.CB (T0288)V77.CB 6.9676 11.6126 15.0964 17.9998 Constraint (T0288)V34.CB (T0288)V70.CB 6.7861 11.3102 14.7033 17.9996 Constraint (T0288)C28.CB (T0288)N86.CB 6.1605 10.2674 13.3477 17.9868 Constraint (T0288)C30.CB (T0288)V57.CB 6.6300 11.0499 14.3649 17.9022 Constraint (T0288)E53.CB (T0288)K67.CB 6.7302 11.2171 14.5822 17.7218 Constraint (T0288)Y32.CB (T0288)Q89.CB 6.6913 11.1522 14.4979 17.4008 Constraint (T0288)N39.CB (T0288)V48.CB 6.7096 11.1827 14.5375 17.2144 Constraint (T0288)D45.CB (T0288)I54.CB 7.0326 11.7210 15.2373 17.2035 Constraint (T0288)N15.CB (T0288)D38.CB 6.4286 10.7143 13.9286 17.0999 Constraint (T0288)K11.CB (T0288)A43.CB 6.5089 10.8482 14.1026 17.0000 Constraint (T0288)C28.CB (T0288)S61.CB 6.0114 10.0191 13.0248 16.9773 Constraint (T0288)C28.CB (T0288)I54.CB 6.4628 10.7713 14.0027 16.3891 Constraint (T0288)I33.CB (T0288)A71.CB 6.7514 11.2523 14.6280 16.3148 Constraint (T0288)Q10.CB (T0288)V57.CB 6.4183 10.6971 13.9063 16.0999 Constraint (T0288)V34.CB (T0288)L88.CB 7.0193 11.6988 15.2084 15.9998 Constraint (T0288)Y27.CB (T0288)S61.CB 6.6563 11.0938 14.4219 15.9894 Constraint (T0288)Q14.CB (T0288)L44.CB 6.0599 10.0999 13.1298 15.2000 Constraint (T0288)A13.CB (T0288)F37.CB 6.2904 10.4841 13.6293 15.0999 Constraint (T0288)Q10.CB (T0288)Y85.CB 6.6978 11.1631 14.5120 15.0999 Constraint (T0288)D12.CB (T0288)Q75.CB 6.4223 10.7038 13.9150 15.0998 Constraint (T0288)E53.CB (T0288)Y90.CB 5.9043 9.8406 12.7927 15.0760 Constraint (T0288)A42.CB (T0288)T82.CB 7.1094 11.8491 15.4038 15.0000 Constraint (T0288)Q26.CB (T0288)V70.CB 6.1792 10.2987 13.3883 15.0000 Constraint (T0288)Y32.CB (T0288)I83.CB 6.9504 11.5840 15.0592 15.0000 Constraint (T0288)I21.CB (T0288)T55.CB 6.6921 11.1535 14.4996 14.9999 Constraint (T0288)Q14.CB (T0288)E76.CB 6.5837 10.9728 14.2647 14.9998 Constraint (T0288)Q14.CB (T0288)I74.CB 6.2837 10.4729 13.6148 14.9998 Constraint (T0288)P4.CB (T0288)A49.CB 6.8324 11.3874 14.8036 14.9998 Constraint (T0288)I19.CB (T0288)N39.CB 6.5126 10.8543 14.1106 14.9997 Constraint (T0288)Q26.CB (T0288)I62.CB 5.8729 9.7882 12.7246 14.9997 Constraint (T0288)S20.CB (T0288)Q75.CB 6.6339 11.0565 14.3735 14.9995 Constraint (T0288)V70.CB (T0288)H84.CB 6.9730 11.6217 15.1082 14.9394 Constraint (T0288)P41.CB (T0288)K78.CB 6.4692 10.7820 14.0166 14.8646 Constraint (T0288)Q10.CB (T0288)I19.CB 5.6731 9.4551 12.2916 14.8381 Constraint (T0288)I21.CB (T0288)F37.CB 6.7895 11.3159 14.7107 14.6209 Constraint (T0288)I62.CB (T0288)E76.CB 6.9382 11.5637 15.0328 14.6209 Constraint (T0288)I54.CB (T0288)T66.CB 7.0283 11.7138 15.2279 14.3248 Constraint (T0288)M2.CB (T0288)T55.CB 6.1308 10.2180 13.2835 14.1999 Constraint (T0288)D12.CB (T0288)I74.CB 6.1698 10.2831 13.3680 14.0999 Constraint (T0288)Q10.CB (T0288)I74.CB 6.2536 10.4226 13.5494 14.0999 Constraint (T0288)T8.CB (T0288)I54.CB 6.0842 10.1403 13.1823 14.0939 Constraint (T0288)D52.CB (T0288)Y91.CB 6.1573 10.2622 13.3409 14.0748 Constraint (T0288)S1.CB (T0288)K87.CB 5.5483 9.2472 12.0214 14.0000 Constraint (T0288)S1.CB (T0288)N86.CB 5.9533 9.9222 12.8989 14.0000 Constraint (T0288)K63.CB (T0288)L88.CB 6.7531 11.2551 14.6317 13.9999 Constraint (T0288)A25.CB (T0288)A71.CB 6.6390 11.0650 14.3844 13.9999 Constraint (T0288)M2.CB (T0288)A49.CB 6.8377 11.3962 14.8150 13.9998 Constraint (T0288)V3.CB (T0288)A49.CB 6.5332 10.8887 14.1553 13.9998 Constraint (T0288)C30.CB (T0288)V68.CB 6.1509 10.2514 13.3269 13.7214 Constraint (T0288)L31.CB (T0288)L88.CB 6.4124 10.6874 13.8936 13.2748 Constraint (T0288)A13.CB (T0288)A42.CB 6.3724 10.6206 13.8068 13.1000 Constraint (T0288)K11.CB (T0288)F37.CB 6.7016 11.1694 14.5202 13.0000 Constraint (T0288)D45.CB (T0288)H84.CB 7.0014 11.6690 15.1697 12.7381 Constraint (T0288)V3.CB (T0288)Q89.CB 4.8753 8.1256 10.5632 12.1999 Constraint (T0288)V48.CB (T0288)L88.CB 6.2037 10.3395 13.4414 12.1392 Constraint (T0288)A13.CB (T0288)D45.CB 6.7772 11.2953 14.6839 12.1000 Constraint (T0288)T8.CB (T0288)D52.CB 5.5896 9.3161 12.1109 12.1000 Constraint (T0288)K6.CB (T0288)E53.CB 6.4446 10.7410 13.9633 12.1000 Constraint (T0288)T8.CB (T0288)I19.CB 6.3586 10.5976 13.7769 12.1000 Constraint (T0288)T8.CB (T0288)I33.CB 6.2508 10.4180 13.5434 12.0939 Constraint (T0288)P29.CB (T0288)V68.CB 6.9160 11.5266 14.9846 12.0000 Constraint (T0288)V7.CB (T0288)T40.CB 6.8922 11.4870 14.9331 12.0000 Constraint (T0288)P4.CB (T0288)T82.CB 6.9838 11.6397 15.1316 11.9999 Constraint (T0288)I17.CB (T0288)N39.CB 6.6054 11.0090 14.3117 11.9999 Constraint (T0288)R60.CB (T0288)Q75.CB 6.3569 10.5948 13.7733 11.9999 Constraint (T0288)R60.CB (T0288)A71.CB 5.9358 9.8930 12.8610 11.9999 Constraint (T0288)K72.CB (T0288)V81.CB 6.7256 11.2093 14.5721 11.9893 Constraint (T0288)C30.CB (T0288)I83.CB 6.5944 10.9907 14.2879 11.9273 Constraint (T0288)E53.CB (T0288)Y91.CB 6.1349 10.2248 13.2922 11.8734 Constraint (T0288)A49.CB (T0288)Y91.CB 5.9084 9.8474 12.8016 11.6736 Constraint (T0288)I19.CB (T0288)K67.CB 6.5413 10.9022 14.1729 11.6208 Constraint (T0288)C30.CB (T0288)Q89.CB 6.3997 10.6661 13.8660 11.2686 Constraint (T0288)T40.CB (T0288)I74.CB 7.0448 11.7413 15.2637 11.2040 Constraint (T0288)S61.CB (T0288)N86.CB 6.6372 11.0619 14.3805 11.1322 Constraint (T0288)T8.CB (T0288)T55.CB 6.6647 11.1078 14.4401 11.1000 Constraint (T0288)T8.CB (T0288)A49.CB 6.0330 10.0550 13.0715 11.1000 Constraint (T0288)T8.CB (T0288)N86.CB 6.6313 11.0521 14.3677 11.1000 Constraint (T0288)P4.CB (T0288)S61.CB 6.8703 11.4504 14.8856 11.0000 Constraint (T0288)D12.CB (T0288)T82.CB 6.6839 11.1398 14.4818 10.9999 Constraint (T0288)C28.CB (T0288)E69.CB 6.4610 10.7683 13.9987 10.9999 Constraint (T0288)N15.CB (T0288)M73.CB 6.9972 11.6620 15.1606 10.9999 Constraint (T0288)L16.CB (T0288)L44.CB 6.7689 11.2815 14.6659 10.9999 Constraint (T0288)N15.CB (T0288)K72.CB 6.6738 11.1230 14.4598 10.9997 Constraint (T0288)A42.CB (T0288)V57.CB 6.4245 10.7075 13.9198 10.9878 Constraint (T0288)P41.CB (T0288)T82.CB 6.6335 11.0558 14.3726 10.7382 Constraint (T0288)C28.CB (T0288)L88.CB 6.4353 10.7256 13.9432 10.4012 Constraint (T0288)R60.CB (T0288)K78.CB 6.8932 11.4887 14.9353 10.3000 Constraint (T0288)T8.CB (T0288)K87.CB 6.6752 11.1254 14.4630 10.1000 Constraint (T0288)T8.CB (T0288)A43.CB 6.2582 10.4303 13.5594 10.0999 Constraint (T0288)L31.CB (T0288)V48.CB 6.8659 11.4432 14.8762 10.0778 Constraint (T0288)L16.CB (T0288)D38.CB 5.9654 9.9423 12.9249 9.9999 Constraint (T0288)K63.CB (T0288)K72.CB 6.9213 11.5354 14.9961 9.9254 Constraint (T0288)L16.CB (T0288)E80.CB 6.7037 11.1729 14.5247 9.8736 Constraint (T0288)T55.CB (T0288)Q89.CB 5.9061 9.8435 12.7966 9.4071 Constraint (T0288)L16.CB (T0288)V70.CB 6.9103 11.5172 14.9723 9.3210 Constraint (T0288)A49.CB (T0288)Y90.CB 6.1517 10.2529 13.3287 9.3013 Constraint (T0288)Q14.CB (T0288)D38.CB 6.1458 10.2429 13.3158 9.1999 Constraint (T0288)Q10.CB (T0288)V36.CB 6.6228 11.0380 14.3495 9.1000 Constraint (T0288)M2.CB (T0288)Q89.CB 4.7978 7.9964 10.3953 9.1000 Constraint (T0288)A25.CB (T0288)S61.CB 6.2580 10.4300 13.5590 9.0000 Constraint (T0288)A13.CB (T0288)I74.CB 6.1982 10.3303 13.4294 9.0000 Constraint (T0288)A49.CB (T0288)H84.CB 6.9774 11.6290 15.1177 8.9999 Constraint (T0288)I21.CB (T0288)A49.CB 6.9587 11.5978 15.0772 8.9999 Constraint (T0288)S20.CB (T0288)D38.CB 6.6721 11.1201 14.4562 8.9999 Constraint (T0288)S20.CB (T0288)A49.CB 6.8688 11.4480 14.8824 8.9999 Constraint (T0288)A13.CB (T0288)E76.CB 6.9277 11.5461 15.0099 8.9999 Constraint (T0288)L44.CB (T0288)V81.CB 7.1351 11.8918 15.4593 8.9999 Constraint (T0288)L9.CB (T0288)D52.CB 6.5530 10.9216 14.1981 8.9999 Constraint (T0288)V7.CB (T0288)I74.CB 6.9319 11.5532 15.0192 8.9999 Constraint (T0288)N58.CB (T0288)E69.CB 6.7040 11.1733 14.5253 8.9894 Constraint (T0288)Q26.CB (T0288)T55.CB 6.2760 10.4600 13.5980 8.9894 Constraint (T0288)A25.CB (T0288)T55.CB 6.1169 10.1948 13.2533 8.9894 Constraint (T0288)A25.CB (T0288)I54.CB 6.2665 10.4442 13.5774 8.9894 Constraint (T0288)P29.CB (T0288)N86.CB 5.8588 9.7646 12.6940 8.9869 Constraint (T0288)T55.CB (T0288)E69.CB 6.1260 10.2100 13.2730 8.9144 Constraint (T0288)V70.CB (T0288)Y85.CB 6.4377 10.7296 13.9484 8.8796 Constraint (T0288)C30.CB (T0288)M73.CB 6.5520 10.9200 14.1960 8.6210 Constraint (T0288)V57.CB (T0288)T66.CB 6.8795 11.4659 14.9056 8.3250 Constraint (T0288)T40.CB (T0288)A49.CB 6.9934 11.6557 15.1524 8.1004 Constraint (T0288)Q10.CB (T0288)I54.CB 6.8811 11.4685 14.9091 8.0939 Constraint (T0288)Y27.CB (T0288)T55.CB 5.4852 9.1420 11.8846 8.0786 Constraint (T0288)S1.CB (T0288)D52.CB 6.6633 11.1054 14.4370 8.0000 Constraint (T0288)S1.CB (T0288)A49.CB 6.5415 10.9026 14.1733 8.0000 Constraint (T0288)K11.CB (T0288)N39.CB 6.9466 11.5776 15.0509 8.0000 Constraint (T0288)K11.CB (T0288)T47.CB 6.1499 10.2499 13.3248 8.0000 Constraint (T0288)K11.CB (T0288)V48.CB 6.1689 10.2815 13.3660 8.0000 Constraint (T0288)T47.CB (T0288)N86.CB 6.9676 11.6126 15.0964 7.9999 Constraint (T0288)D12.CB (T0288)I83.CB 6.7179 11.1965 14.5554 7.9999 Constraint (T0288)S61.CB (T0288)T82.CB 6.8888 11.4814 14.9258 7.9999 Constraint (T0288)N15.CB (T0288)N58.CB 6.6786 11.1311 14.4704 7.9999 Constraint (T0288)V7.CB (T0288)V77.CB 6.8772 11.4620 14.9006 7.9998 Constraint (T0288)P29.CB (T0288)H84.CB 6.3568 10.5947 13.7731 7.9894 Constraint (T0288)V48.CB (T0288)V57.CB 6.7110 11.1851 14.5406 7.9878 Constraint (T0288)A42.CB (T0288)V70.CB 6.5338 10.8897 14.1566 7.7109 Constraint (T0288)I54.CB (T0288)Q89.CB 6.5213 10.8688 14.1294 7.7069 Constraint (T0288)I33.CB (T0288)H84.CB 7.0549 11.7581 15.2856 7.6740 Constraint (T0288)T55.CB (T0288)Y90.CB 6.5199 10.8665 14.1264 7.6691 Constraint (T0288)Q14.CB (T0288)A43.CB 5.9295 9.8826 12.8474 7.2000 Constraint (T0288)V3.CB (T0288)Y90.CB 5.5901 9.3168 12.1119 7.1999 Constraint (T0288)P4.CB (T0288)T47.CB 6.6162 11.0270 14.3351 7.1000 Constraint (T0288)M2.CB (T0288)Y90.CB 5.7348 9.5580 12.4254 7.1000 Constraint (T0288)P4.CB (T0288)Q89.CB 5.2022 8.6704 11.2715 7.1000 Constraint (T0288)K6.CB (T0288)L88.CB 6.5778 10.9630 14.2519 7.0999 Constraint (T0288)T8.CB (T0288)V36.CB 6.4379 10.7299 13.9489 7.0940 Constraint (T0288)Q10.CB (T0288)I33.CB 6.6226 11.0377 14.3490 7.0939 Constraint (T0288)V57.CB (T0288)V68.CB 7.1204 11.8674 15.4276 7.0005 Constraint (T0288)Q26.CB (T0288)A71.CB 6.6490 11.0816 14.4061 7.0000 Constraint (T0288)P29.CB (T0288)D52.CB 6.3736 10.6226 13.8094 7.0000 Constraint (T0288)Q10.CB (T0288)H84.CB 6.6878 11.1463 14.4902 6.9999 Constraint (T0288)L16.CB (T0288)V57.CB 7.0015 11.6691 15.1698 6.9999 Constraint (T0288)P4.CB (T0288)Y91.CB 6.2556 10.4260 13.5538 6.9999 Constraint (T0288)V3.CB (T0288)Y91.CB 5.6854 9.4756 12.3183 6.9999 Constraint (T0288)L16.CB (T0288)K72.CB 6.4930 10.8217 14.0682 6.9998 Constraint (T0288)L16.CB (T0288)I33.CB 6.6264 11.0440 14.3572 6.9998 Constraint (T0288)D52.CB (T0288)V70.CB 6.8060 11.3434 14.7464 6.8244 Constraint (T0288)I17.CB (T0288)Y85.CB 6.4300 10.7167 13.9318 6.7472 Constraint (T0288)L31.CB (T0288)A42.CB 6.9383 11.5639 15.0330 6.7094 Constraint (T0288)I74.CB (T0288)Y85.CB 6.4821 10.8035 14.0446 6.6117 Constraint (T0288)Y32.CB (T0288)T66.CB 7.0741 11.7902 15.3273 6.3369 Constraint (T0288)I17.CB (T0288)K72.CB 6.9468 11.5780 15.0514 6.3210 Constraint (T0288)I33.CB (T0288)Q89.CB 6.8413 11.4022 14.8228 6.2010 Constraint (T0288)A42.CB (T0288)V77.CB 7.1342 11.8904 15.4575 6.0000 Constraint (T0288)T40.CB (T0288)A50.CB 7.0929 11.8215 15.3679 6.0000 Constraint (T0288)I19.CB (T0288)I62.CB 6.9252 11.5421 15.0047 6.0000 Constraint (T0288)K65.CB (T0288)E76.CB 6.9954 11.6591 15.1568 6.0000 Constraint (T0288)Q26.CB (T0288)I54.CB 6.4888 10.8147 14.0591 6.0000 Constraint (T0288)A42.CB (T0288)E80.CB 6.8654 11.4424 14.8751 6.0000 Constraint (T0288)C30.CB (T0288)Y91.CB 6.4174 10.6956 13.9043 6.0000 Constraint (T0288)Y32.CB (T0288)I74.CB 7.0801 11.8002 15.3402 6.0000 Constraint (T0288)L31.CB (T0288)Q75.CB 6.9230 11.5383 14.9998 6.0000 Constraint (T0288)C30.CB (T0288)I74.CB 6.4524 10.7539 13.9801 6.0000 Constraint (T0288)C30.CB (T0288)K72.CB 6.8773 11.4621 14.9008 6.0000 Constraint (T0288)C30.CB (T0288)A71.CB 5.1208 8.5346 11.0950 6.0000 Constraint (T0288)T40.CB (T0288)I83.CB 7.1393 11.8988 15.4684 6.0000 Constraint (T0288)T8.CB (T0288)T40.CB 6.5229 10.8714 14.1329 6.0000 Constraint (T0288)S1.CB (T0288)L88.CB 5.3258 8.8763 11.5392 6.0000 Constraint (T0288)Y32.CB (T0288)A71.CB 6.8757 11.4595 14.8973 5.9999 Constraint (T0288)N58.CB (T0288)A71.CB 6.3950 10.6584 13.8559 5.9999 Constraint (T0288)K65.CB (T0288)I83.CB 6.7204 11.2006 14.5608 5.9999 Constraint (T0288)I33.CB (T0288)V81.CB 7.1128 11.8547 15.4111 5.9999 Constraint (T0288)S61.CB (T0288)I74.CB 6.6017 11.0028 14.3036 5.9999 Constraint (T0288)I21.CB (T0288)K63.CB 6.9331 11.5551 15.0217 5.9999 Constraint (T0288)I21.CB (T0288)R60.CB 5.7732 9.6220 12.5086 5.9999 Constraint (T0288)Q26.CB (T0288)S61.CB 6.2558 10.4263 13.5542 5.9998 Constraint (T0288)I19.CB (T0288)M73.CB 6.8306 11.3844 14.7997 5.9998 Constraint (T0288)Q35.CB (T0288)A71.CB 6.7012 11.1687 14.5193 5.9997 Constraint (T0288)S20.CB (T0288)V68.CB 6.7080 11.1801 14.5341 5.9997 Constraint (T0288)Q26.CB (T0288)N86.CB 5.4674 9.1123 11.8460 5.9930 Constraint (T0288)Y27.CB (T0288)N86.CB 5.8214 9.7023 12.6130 5.9929 Constraint (T0288)A25.CB (T0288)Q89.CB 5.9097 9.8495 12.8044 5.9928 Constraint (T0288)L16.CB (T0288)M73.CB 6.8114 11.3523 14.7580 5.7001 Constraint (T0288)Y27.CB (T0288)I54.CB 6.3419 10.5698 13.7408 5.6895 Constraint (T0288)L44.CB (T0288)E80.CB 6.7928 11.3213 14.7177 5.6740 Constraint (T0288)I19.CB (T0288)E53.CB 6.7866 11.3110 14.7043 5.6209 Constraint (T0288)A50.CB (T0288)Q89.CB 5.6572 9.4286 12.2572 5.5010 Constraint (T0288)P29.CB (T0288)L88.CB 5.8813 9.8022 12.7429 5.4011 Constraint (T0288)L9.CB (T0288)I21.CB 6.9273 11.5454 15.0091 5.3369 Constraint (T0288)A50.CB (T0288)Y90.CB 6.3699 10.6165 13.8014 5.1998 Constraint (T0288)E69.CB (T0288)I83.CB 6.6827 11.1379 14.4793 5.1920 Constraint (T0288)M2.CB (T0288)C30.CB 6.4817 10.8028 14.0437 5.0999 Constraint (T0288)A50.CB (T0288)Y91.CB 6.4556 10.7594 13.9872 5.0998 Constraint (T0288)S1.CB (T0288)Y85.CB 5.5351 9.2252 11.9927 5.0000 Constraint (T0288)A25.CB (T0288)M73.CB 7.0550 11.7584 15.2859 5.0000 Constraint (T0288)A25.CB (T0288)V57.CB 6.9159 11.5266 14.9845 5.0000 Constraint (T0288)Q14.CB (T0288)V36.CB 6.9275 11.5459 15.0096 5.0000 Constraint (T0288)C28.CB (T0288)Y85.CB 6.3958 10.6597 13.8576 5.0000 Constraint (T0288)A13.CB (T0288)N58.CB 6.4935 10.8225 14.0693 5.0000 Constraint (T0288)Q10.CB (T0288)F37.CB 6.9686 11.6144 15.0987 5.0000 Constraint (T0288)P29.CB (T0288)V57.CB 6.9647 11.6078 15.0901 5.0000 Constraint (T0288)Q14.CB (T0288)A71.CB 6.5986 10.9976 14.2969 5.0000 Constraint (T0288)A13.CB (T0288)T82.CB 6.5294 10.8824 14.1471 5.0000 Constraint (T0288)M2.CB (T0288)Y91.CB 5.7686 9.6143 12.4985 5.0000 Constraint (T0288)N15.CB (T0288)V57.CB 6.8027 11.3378 14.7392 4.9999 Constraint (T0288)A13.CB (T0288)D38.CB 6.5442 10.9069 14.1790 4.9999 Constraint (T0288)M2.CB (T0288)H84.CB 6.4723 10.7871 14.0232 4.9999 Constraint (T0288)M2.CB (T0288)K63.CB 6.4710 10.7851 14.0206 4.9999 Constraint (T0288)P41.CB (T0288)V57.CB 6.9892 11.6487 15.1434 4.9879 Constraint (T0288)C28.CB (T0288)H84.CB 6.5041 10.8401 14.0921 4.9879 Constraint (T0288)V48.CB (T0288)Q89.CB 5.6980 9.4966 12.3456 4.9395 Constraint (T0288)L16.CB (T0288)I83.CB 6.7838 11.3063 14.6982 4.8736 Constraint (T0288)C30.CB (T0288)Y90.CB 6.3498 10.5830 13.7579 4.8735 Constraint (T0288)D45.CB (T0288)K87.CB 6.6051 11.0085 14.3111 4.7380 Constraint (T0288)Q26.CB (T0288)Q89.CB 5.6965 9.4942 12.3425 4.3941 Constraint (T0288)Q26.CB (T0288)L88.CB 5.6436 9.4060 12.2279 4.3941 Constraint (T0288)A25.CB (T0288)L88.CB 4.6104 7.6839 9.9891 4.3941 Constraint (T0288)N39.CB (T0288)A49.CB 6.5028 10.8380 14.0895 4.2034 Constraint (T0288)V3.CB (T0288)T47.CB 6.7776 11.2959 14.6847 4.2000 Constraint (T0288)V48.CB (T0288)V70.CB 6.7545 11.2574 14.6347 4.1929 Constraint (T0288)Y27.CB (T0288)A71.CB 6.2879 10.4798 13.6237 4.1000 Constraint (T0288)K6.CB (T0288)I33.CB 6.7892 11.3153 14.7099 4.1000 Constraint (T0288)D12.CB (T0288)E76.CB 6.5094 10.8491 14.1038 4.1000 Constraint (T0288)P4.CB (T0288)Y90.CB 5.7570 9.5950 12.4735 4.1000 Constraint (T0288)I54.CB (T0288)Y91.CB 6.8289 11.3816 14.7960 4.0372 Constraint (T0288)N39.CB (T0288)A50.CB 6.3014 10.5023 13.6530 4.0110 Constraint (T0288)Q35.CB (T0288)K67.CB 6.5680 10.9467 14.2308 4.0108 Constraint (T0288)T47.CB (T0288)L88.CB 6.8774 11.4623 14.9009 4.0000 Constraint (T0288)Q14.CB (T0288)D45.CB 6.7768 11.2947 14.6832 4.0000 Constraint (T0288)S1.CB (T0288)T47.CB 6.3793 10.6322 13.8218 4.0000 Constraint (T0288)Q26.CB (T0288)D52.CB 7.0020 11.6700 15.1710 4.0000 Constraint (T0288)C28.CB (T0288)V68.CB 5.8628 9.7714 12.7028 4.0000 Constraint (T0288)D12.CB (T0288)V57.CB 6.6574 11.0956 14.4243 4.0000 Constraint (T0288)P4.CB (T0288)P29.CB 6.8012 11.3354 14.7360 4.0000 Constraint (T0288)A13.CB (T0288)I83.CB 7.0531 11.7551 15.2816 4.0000 Constraint (T0288)D12.CB (T0288)N58.CB 6.2827 10.4712 13.6126 4.0000 Constraint (T0288)N15.CB (T0288)Q35.CB 6.4369 10.7282 13.9466 4.0000 Constraint (T0288)V34.CB (T0288)Y85.CB 6.9952 11.6587 15.1563 3.9999 Constraint (T0288)L16.CB (T0288)V48.CB 6.9874 11.6456 15.1393 3.9998 Constraint (T0288)K11.CB (T0288)I33.CB 6.7489 11.2481 14.6225 3.9940 Constraint (T0288)L9.CB (T0288)A49.CB 6.7239 11.2066 14.5686 3.9939 Constraint (T0288)A25.CB (T0288)Y90.CB 6.0635 10.1059 13.1376 3.9928 Constraint (T0288)T55.CB (T0288)Y91.CB 5.9970 9.9950 12.9935 3.8737 Constraint (T0288)Y32.CB (T0288)E69.CB 7.1452 11.9086 15.4812 3.8245 Constraint (T0288)I54.CB (T0288)Y90.CB 6.4316 10.7193 13.9350 3.8014 Constraint (T0288)A50.CB (T0288)N86.CB 6.4121 10.6869 13.8929 3.8000 Constraint (T0288)Y27.CB (T0288)D52.CB 6.4571 10.7619 13.9904 3.6896 Constraint (T0288)V57.CB (T0288)N86.CB 5.3716 8.9526 11.6384 3.6118 Constraint (T0288)C28.CB (T0288)D52.CB 6.4435 10.7391 13.9609 3.4012 Constraint (T0288)C28.CB (T0288)Q89.CB 6.9765 11.6275 15.1158 3.3951 Constraint (T0288)Y27.CB (T0288)L88.CB 5.5294 9.2156 11.9803 3.3941 Constraint (T0288)I17.CB (T0288)K67.CB 6.7307 11.2179 14.5833 3.3212 Constraint (T0288)I17.CB (T0288)I62.CB 6.8243 11.3739 14.7861 3.3212 Constraint (T0288)I17.CB (T0288)L31.CB 5.8068 9.6779 12.5813 3.3212 Constraint (T0288)Y32.CB (T0288)V68.CB 7.0942 11.8236 15.3707 3.3039 Constraint (T0288)V36.CB (T0288)K87.CB 6.7445 11.2409 14.6132 3.2748 Constraint (T0288)V48.CB (T0288)Y90.CB 6.1199 10.1999 13.2598 3.1385 Constraint (T0288)V48.CB (T0288)Y91.CB 5.8972 9.8286 12.7772 3.1372 Constraint (T0288)A13.CB (T0288)A43.CB 6.8707 11.4512 14.8866 3.1000 Constraint (T0288)F37.CB (T0288)T47.CB 6.8686 11.4476 14.8819 3.0000 Constraint (T0288)Q35.CB (T0288)D45.CB 6.8483 11.4138 14.8380 3.0000 Constraint (T0288)P4.CB (T0288)I62.CB 6.5813 10.9689 14.2595 3.0000 Constraint (T0288)P4.CB (T0288)V57.CB 6.9860 11.6433 15.1363 3.0000 Constraint (T0288)M2.CB (T0288)Q26.CB 5.7147 9.5245 12.3819 3.0000 Constraint (T0288)S1.CB (T0288)Q89.CB 4.8795 8.1326 10.5723 3.0000 Constraint (T0288)Y32.CB (T0288)Y91.CB 6.2347 10.3911 13.5085 3.0000 Constraint (T0288)A25.CB (T0288)A50.CB 6.7480 11.2467 14.6207 3.0000 Constraint (T0288)A25.CB (T0288)V34.CB 5.8225 9.7041 12.6154 3.0000 Constraint (T0288)K11.CB (T0288)V36.CB 6.4037 10.6728 13.8747 3.0000 Constraint (T0288)P4.CB (T0288)V48.CB 6.4177 10.6961 13.9050 3.0000 Constraint (T0288)D12.CB (T0288)V48.CB 7.0818 11.8029 15.3438 3.0000 Constraint (T0288)A42.CB (T0288)K78.CB 6.8059 11.3432 14.7462 3.0000 Constraint (T0288)I19.CB (T0288)K78.CB 7.0007 11.6679 15.1683 3.0000 Constraint (T0288)S20.CB (T0288)I83.CB 7.1359 11.8932 15.4611 3.0000 Constraint (T0288)T8.CB (T0288)I74.CB 6.6229 11.0382 14.3497 3.0000 Constraint (T0288)E53.CB (T0288)V93.CB 5.9565 9.9275 12.9057 3.0000 Constraint (T0288)P29.CB (T0288)Y85.CB 5.7511 9.5852 12.4607 3.0000 Constraint (T0288)L9.CB (T0288)N86.CB 6.8470 11.4117 14.8353 3.0000 Constraint (T0288)K11.CB (T0288)Y85.CB 6.7886 11.3144 14.7087 3.0000 Constraint (T0288)T47.CB (T0288)N58.CB 6.7403 11.2338 14.6039 3.0000 Constraint (T0288)A43.CB (T0288)V81.CB 7.1833 11.9721 15.5637 3.0000 Constraint (T0288)T40.CB (T0288)E80.CB 6.5834 10.9723 14.2640 3.0000 Constraint (T0288)I21.CB (T0288)S61.CB 6.6963 11.1605 14.5087 3.0000 Constraint (T0288)S20.CB (T0288)K72.CB 6.7174 11.1956 14.5543 3.0000 Constraint (T0288)S20.CB (T0288)V57.CB 6.8652 11.4421 14.8747 3.0000 Constraint (T0288)I19.CB (T0288)N58.CB 6.6125 11.0208 14.3271 3.0000 Constraint (T0288)I17.CB (T0288)R60.CB 6.4733 10.7888 14.0254 3.0000 Constraint (T0288)Q10.CB (T0288)N39.CB 6.2130 10.3549 13.4614 3.0000 Constraint (T0288)K6.CB (T0288)L44.CB 7.1443 11.9071 15.4793 3.0000 Constraint (T0288)P4.CB (T0288)K92.CB 6.4431 10.7384 13.9600 3.0000 Constraint (T0288)M2.CB (T0288)C28.CB 6.7853 11.3089 14.7015 2.9999 Constraint (T0288)S1.CB (T0288)E53.CB 6.9770 11.6284 15.1169 2.9999 Constraint (T0288)A43.CB (T0288)I54.CB 7.1998 11.9996 15.5995 2.9999 Constraint (T0288)A42.CB (T0288)E53.CB 6.4793 10.7988 14.0385 2.9999 Constraint (T0288)Q35.CB (T0288)I54.CB 6.9552 11.5919 15.0695 2.9999 Constraint (T0288)Y32.CB (T0288)V57.CB 7.0713 11.7855 15.3211 2.9999 Constraint (T0288)I21.CB (T0288)N58.CB 6.8314 11.3856 14.8013 2.9999 Constraint (T0288)I17.CB (T0288)D38.CB 5.2274 8.7124 11.3261 2.9999 Constraint (T0288)D12.CB (T0288)D38.CB 4.0713 6.7856 8.8212 2.9999 Constraint (T0288)D12.CB (T0288)V36.CB 6.9751 11.6251 15.1126 2.9999 Constraint (T0288)K11.CB (T0288)D38.CB 7.1258 11.8763 15.4392 2.9999 Constraint (T0288)Q10.CB (T0288)D38.CB 6.6309 11.0515 14.3669 2.9999 Constraint (T0288)L9.CB (T0288)D38.CB 6.9812 11.6353 15.1258 2.9999 Constraint (T0288)K63.CB (T0288)I83.CB 6.3019 10.5032 13.6542 2.9999 Constraint (T0288)D52.CB (T0288)I74.CB 7.1379 11.8964 15.4654 2.9999 Constraint (T0288)D45.CB (T0288)V77.CB 7.0288 11.7147 15.2291 2.9999 Constraint (T0288)V36.CB (T0288)I74.CB 7.1474 11.9123 15.4860 2.9999 Constraint (T0288)I17.CB (T0288)D52.CB 7.1204 11.8674 15.4276 2.9999 Constraint (T0288)L16.CB (T0288)V34.CB 6.7870 11.3116 14.7051 2.9999 Constraint (T0288)L9.CB (T0288)Q75.CB 6.7472 11.2454 14.6190 2.9999 Constraint (T0288)M2.CB (T0288)I54.CB 6.6800 11.1333 14.4733 2.9999 Constraint (T0288)M2.CB (T0288)A50.CB 6.9915 11.6525 15.1482 2.9999 Constraint (T0288)M2.CB (T0288)Y32.CB 5.5439 9.2398 12.0118 2.9999 Constraint (T0288)K11.CB (T0288)M73.CB 6.7425 11.2375 14.6088 2.9998 Constraint (T0288)Y32.CB (T0288)Y90.CB 5.5468 9.2446 12.0180 2.9998 Constraint (T0288)N15.CB (T0288)I33.CB 6.7178 11.1964 14.5553 2.9964 Constraint (T0288)K11.CB (T0288)I54.CB 6.4453 10.7422 13.9648 2.9940 Constraint (T0288)A25.CB (T0288)K87.CB 5.0038 8.3397 10.8416 2.9929 Constraint (T0288)A25.CB (T0288)N86.CB 3.8888 6.4814 8.4258 2.9929 Constraint (T0288)E69.CB (T0288)V81.CB 6.4849 10.8082 14.0507 2.9894 Constraint (T0288)P29.CB (T0288)R60.CB 6.6627 11.1044 14.4358 2.9894 Constraint (T0288)Y27.CB (T0288)H84.CB 6.9563 11.5939 15.0721 2.9894 Constraint (T0288)A25.CB (T0288)D52.CB 5.2095 8.6825 11.2873 2.9894 Constraint (T0288)T55.CB (T0288)K92.CB 6.5752 10.9587 14.2463 2.8737 Constraint (T0288)E53.CB (T0288)K92.CB 5.6145 9.3576 12.1649 2.8737 Constraint (T0288)C30.CB (T0288)K92.CB 6.4690 10.7816 14.0161 2.8737 Constraint (T0288)I19.CB (T0288)K87.CB 6.8872 11.4787 14.9224 2.8736 Constraint (T0288)E53.CB (T0288)E69.CB 6.8725 11.4542 14.8904 2.6210 Constraint (T0288)N58.CB (T0288)N86.CB 5.8333 9.7222 12.6389 2.6118 Constraint (T0288)N58.CB (T0288)Y85.CB 4.8479 8.0799 10.5038 2.6118 Constraint (T0288)D45.CB (T0288)Y90.CB 6.0176 10.0294 13.0382 2.4383 Constraint (T0288)Y27.CB (T0288)Q89.CB 6.6807 11.1345 14.4748 2.3941 Constraint (T0288)L9.CB (T0288)S20.CB 6.6047 11.0078 14.3101 2.3370 Constraint (T0288)I62.CB (T0288)K87.CB 6.1630 10.2717 13.3533 2.2748 Constraint (T0288)I62.CB (T0288)L88.CB 6.1661 10.2768 13.3598 2.2748 Constraint (T0288)V57.CB (T0288)K87.CB 6.2010 10.3350 13.4355 2.2748 Constraint (T0288)A42.CB (T0288)K87.CB 6.4126 10.6876 13.8939 2.2748 Constraint (T0288)L31.CB (T0288)K87.CB 6.0676 10.1127 13.1465 2.2748 Constraint (T0288)D45.CB (T0288)Q89.CB 5.3364 8.8939 11.5621 2.1394 Constraint (T0288)L31.CB (T0288)A50.CB 7.1017 11.8361 15.3870 2.1004 Constraint (T0288)K6.CB (T0288)Q89.CB 6.8318 11.3863 14.8022 2.1000 Constraint (T0288)A49.CB (T0288)K92.CB 6.4273 10.7121 13.9257 2.1000 Constraint (T0288)N58.CB (T0288)Y90.CB 6.6542 11.0903 14.4174 2.0372 Constraint (T0288)P29.CB (T0288)A50.CB 7.1473 11.9121 15.4858 2.0000 Constraint (T0288)I21.CB (T0288)L88.CB 6.9460 11.5766 15.0496 2.0000 Constraint (T0288)D12.CB (T0288)T47.CB 6.5411 10.9018 14.1724 2.0000 Constraint (T0288)A25.CB (T0288)R60.CB 7.0937 11.8228 15.3696 2.0000 Constraint (T0288)L9.CB (T0288)T55.CB 6.7887 11.3146 14.7089 2.0000 Constraint (T0288)K6.CB (T0288)S61.CB 7.1824 11.9707 15.5619 2.0000 Constraint (T0288)K6.CB (T0288)R60.CB 7.1559 11.9265 15.5045 2.0000 Constraint (T0288)Q26.CB (T0288)Y85.CB 7.1613 11.9355 15.5161 2.0000 Constraint (T0288)P4.CB (T0288)V93.CB 5.8429 9.7381 12.6596 2.0000 Constraint (T0288)S1.CB (T0288)Y90.CB 5.9831 9.9718 12.9633 2.0000 Constraint (T0288)M2.CB (T0288)T47.CB 6.2680 10.4466 13.5806 2.0000 Constraint (T0288)C28.CB (T0288)A71.CB 6.4312 10.7186 13.9342 2.0000 Constraint (T0288)K63.CB (T0288)V93.CB 3.6288 6.0480 7.8624 2.0000 Constraint (T0288)K63.CB (T0288)K92.CB 6.6944 11.1573 14.5045 2.0000 Constraint (T0288)K63.CB (T0288)Y91.CB 6.6564 11.0940 14.4222 2.0000 Constraint (T0288)I62.CB (T0288)V93.CB 7.0288 11.7147 15.2292 2.0000 Constraint (T0288)S61.CB (T0288)V93.CB 5.7554 9.5923 12.4700 2.0000 Constraint (T0288)T55.CB (T0288)V93.CB 4.6539 7.7565 10.0835 2.0000 Constraint (T0288)C30.CB (T0288)V93.CB 5.5899 9.3165 12.1115 2.0000 Constraint (T0288)P29.CB (T0288)V93.CB 5.8546 9.7577 12.6849 2.0000 Constraint (T0288)C28.CB (T0288)V57.CB 7.0368 11.7280 15.2464 2.0000 Constraint (T0288)P4.CB (T0288)C28.CB 6.8199 11.3665 14.7764 2.0000 Constraint (T0288)Q10.CB (T0288)A49.CB 7.0999 11.8331 15.3830 2.0000 Constraint (T0288)T47.CB (T0288)E80.CB 5.9450 9.9084 12.8809 2.0000 Constraint (T0288)A43.CB (T0288)E80.CB 5.3503 8.9171 11.5922 2.0000 Constraint (T0288)T40.CB (T0288)K78.CB 7.1555 11.9258 15.5035 2.0000 Constraint (T0288)N15.CB (T0288)R60.CB 7.0630 11.7717 15.3033 2.0000 Constraint (T0288)N15.CB (T0288)V48.CB 7.1580 11.9299 15.5089 2.0000 Constraint (T0288)A13.CB (T0288)V36.CB 6.5980 10.9966 14.2956 2.0000 Constraint (T0288)K11.CB (T0288)R60.CB 6.8751 11.4585 14.8960 2.0000 Constraint (T0288)L9.CB (T0288)N39.CB 6.5779 10.9632 14.2522 2.0000 Constraint (T0288)L9.CB (T0288)K87.CB 6.3706 10.6176 13.8029 2.0000 Constraint (T0288)V7.CB (T0288)L88.CB 6.5393 10.8989 14.1685 2.0000 Constraint (T0288)K6.CB (T0288)Y91.CB 5.9986 9.9977 12.9970 2.0000 Constraint (T0288)K6.CB (T0288)Y90.CB 6.4511 10.7518 13.9773 2.0000 Constraint (T0288)V3.CB (T0288)K92.CB 5.7084 9.5140 12.3681 2.0000 Constraint (T0288)V34.CB (T0288)K87.CB 6.3444 10.5739 13.7461 1.9999 Constraint (T0288)V36.CB (T0288)L88.CB 6.7680 11.2801 14.6641 1.9998 Constraint (T0288)Y27.CB (T0288)K87.CB 6.5758 10.9596 14.2475 1.9930 Constraint (T0288)Y27.CB (T0288)Y85.CB 6.1273 10.2122 13.2759 1.9930 Constraint (T0288)A25.CB (T0288)Y85.CB 5.4635 9.1059 11.8377 1.9930 Constraint (T0288)Q14.CB (T0288)E53.CB 6.9480 11.5800 15.0540 1.9930 Constraint (T0288)Q14.CB (T0288)A50.CB 6.9935 11.6558 15.1526 1.9930 Constraint (T0288)Q14.CB (T0288)Q26.CB 6.2214 10.3691 13.4798 1.9930 Constraint (T0288)Q14.CB (T0288)A25.CB 5.0547 8.4245 10.9519 1.9930 Constraint (T0288)A13.CB (T0288)Y27.CB 6.7033 11.1722 14.5239 1.9930 Constraint (T0288)A13.CB (T0288)Q26.CB 4.0378 6.7297 8.7486 1.9930 Constraint (T0288)A13.CB (T0288)A25.CB 5.0569 8.4282 10.9567 1.9930 Constraint (T0288)D12.CB (T0288)T66.CB 6.5201 10.8668 14.1268 1.9879 Constraint (T0288)D12.CB (T0288)P29.CB 6.7602 11.2671 14.6472 1.9879 Constraint (T0288)D52.CB (T0288)K92.CB 6.3613 10.6022 13.7828 1.9737 Constraint (T0288)Q10.CB (T0288)S20.CB 6.7498 11.2496 14.6245 1.7382 Constraint (T0288)R60.CB (T0288)N86.CB 6.2861 10.4769 13.6200 1.7382 Constraint (T0288)P41.CB (T0288)Y85.CB 6.3371 10.5618 13.7303 1.7382 Constraint (T0288)V57.CB (T0288)Y90.CB 6.6779 11.1299 14.4688 1.7001 Constraint (T0288)M73.CB (T0288)Y85.CB 5.9843 9.9738 12.9660 1.6119 Constraint (T0288)I74.CB (T0288)H84.CB 6.3131 10.5218 13.6784 1.4011 Constraint (T0288)S61.CB (T0288)L88.CB 6.2590 10.4317 13.5612 1.4011 Constraint (T0288)S61.CB (T0288)Y85.CB 6.5555 10.9259 14.2036 1.4011 Constraint (T0288)R60.CB (T0288)Y85.CB 6.1093 10.1821 13.2367 1.4011 Constraint (T0288)V81.CB (T0288)Y90.CB 6.1146 10.1909 13.2482 1.3370 Constraint (T0288)A42.CB (T0288)Q89.CB 6.3288 10.5480 13.7124 1.3370 Constraint (T0288)V70.CB (T0288)K87.CB 6.1803 10.3004 13.3906 1.2748 Constraint (T0288)V70.CB (T0288)N86.CB 6.8620 11.4367 14.8677 1.2748 Constraint (T0288)D52.CB (T0288)K65.CB 6.9375 11.5624 15.0312 1.2035 Constraint (T0288)D45.CB (T0288)I74.CB 6.7081 11.1802 14.5343 1.2035 Constraint (T0288)V34.CB (T0288)K65.CB 5.9262 9.8770 12.8401 1.2035 Constraint (T0288)I33.CB (T0288)K65.CB 4.7755 7.9591 10.3468 1.2035 Constraint (T0288)V36.CB (T0288)Y91.CB 6.8066 11.3444 14.7477 1.1372 Constraint (T0288)I33.CB (T0288)Y90.CB 6.7375 11.2291 14.5978 1.1013 Constraint (T0288)S20.CB (T0288)P29.CB 7.1067 11.8446 15.3979 1.1013 Constraint (T0288)A49.CB (T0288)V93.CB 5.4017 9.0029 11.7038 1.1000 Constraint (T0288)T47.CB (T0288)Q89.CB 6.9595 11.5991 15.0788 1.1000 Constraint (T0288)I33.CB (T0288)Y91.CB 7.1214 11.8690 15.4297 1.1000 Constraint (T0288)A50.CB (T0288)K92.CB 5.6444 9.4074 12.2296 1.1000 Constraint (T0288)T47.CB (T0288)Y91.CB 6.0751 10.1251 13.1627 1.1000 Constraint (T0288)V36.CB (T0288)Q89.CB 6.5665 10.9441 14.2274 1.0999 Constraint (T0288)T82.CB (T0288)Y91.CB 4.3080 7.1800 9.3340 1.0372 Constraint (T0288)V81.CB (T0288)Y91.CB 5.3617 8.9362 11.6170 1.0372 Constraint (T0288)E80.CB (T0288)Y91.CB 5.8746 9.7910 12.7282 1.0372 Constraint (T0288)V57.CB (T0288)Y91.CB 6.6900 11.1500 14.4950 1.0372 Constraint (T0288)D45.CB (T0288)Y91.CB 3.3099 5.5165 7.1715 1.0372 Constraint (T0288)L44.CB (T0288)Y91.CB 5.9779 9.9632 12.9522 1.0372 Constraint (T0288)A43.CB (T0288)Y91.CB 6.5836 10.9727 14.2644 1.0372 Constraint (T0288)A42.CB (T0288)Y91.CB 4.8691 8.1152 10.5498 1.0372 Constraint (T0288)P41.CB (T0288)Y91.CB 5.1956 8.6594 11.2572 1.0372 Constraint (T0288)A42.CB (T0288)A71.CB 6.9875 11.6458 15.1396 1.0111 Constraint (T0288)V36.CB (T0288)A71.CB 7.1140 11.8567 15.4138 1.0111 Constraint (T0288)V36.CB (T0288)K67.CB 6.3676 10.6127 13.7965 1.0111 Constraint (T0288)V36.CB (T0288)E53.CB 6.4267 10.7112 13.9246 1.0111 Constraint (T0288)D52.CB (T0288)V93.CB 5.3372 8.8954 11.5640 1.0000 Constraint (T0288)V48.CB (T0288)V93.CB 6.6132 11.0220 14.3286 1.0000 Constraint (T0288)T47.CB (T0288)V93.CB 5.7260 9.5433 12.4063 1.0000 Constraint (T0288)P29.CB (T0288)K87.CB 6.6483 11.0804 14.4045 1.0000 Constraint (T0288)P29.CB (T0288)I83.CB 6.5301 10.8835 14.1485 1.0000 Constraint (T0288)C28.CB (T0288)K87.CB 6.2504 10.4174 13.5426 1.0000 Constraint (T0288)A13.CB (T0288)V57.CB 7.0410 11.7350 15.2555 1.0000 Constraint (T0288)K11.CB (T0288)D52.CB 6.7478 11.2463 14.6202 1.0000 Constraint (T0288)V7.CB (T0288)V93.CB 6.5584 10.9307 14.2099 1.0000 Constraint (T0288)V7.CB (T0288)Q89.CB 6.0744 10.1240 13.1613 1.0000 Constraint (T0288)K6.CB (T0288)V93.CB 6.8733 11.4555 14.8922 1.0000 Constraint (T0288)V3.CB (T0288)K63.CB 6.4652 10.7754 14.0080 1.0000 Constraint (T0288)V3.CB (T0288)C30.CB 6.8110 11.3517 14.7572 1.0000 Constraint (T0288)Q26.CB (T0288)M73.CB 7.1082 11.8470 15.4011 1.0000 Constraint (T0288)Q26.CB (T0288)R60.CB 7.1994 11.9990 15.5987 1.0000 Constraint (T0288)Q26.CB (T0288)V57.CB 7.0744 11.7907 15.3279 1.0000 Constraint (T0288)Q14.CB (T0288)K72.CB 5.8443 9.7404 12.6625 1.0000 Constraint (T0288)T8.CB (T0288)R60.CB 7.0392 11.7319 15.2515 1.0000 Constraint (T0288)Q10.CB (T0288)Q75.CB 6.6778 11.1297 14.4685 1.0000 Constraint (T0288)K6.CB (T0288)I74.CB 7.1203 11.8672 15.4274 1.0000 Constraint (T0288)K6.CB (T0288)A42.CB 5.3493 8.9155 11.5901 1.0000 Constraint (T0288)K6.CB (T0288)P41.CB 6.7600 11.2666 14.6466 1.0000 Constraint (T0288)K6.CB (T0288)I19.CB 6.5933 10.9888 14.2854 1.0000 Constraint (T0288)K6.CB (T0288)I17.CB 6.5414 10.9024 14.1731 1.0000 Constraint (T0288)P4.CB (T0288)D45.CB 6.7735 11.2891 14.6758 1.0000 Constraint (T0288)P4.CB (T0288)I33.CB 7.0655 11.7758 15.3086 1.0000 Constraint (T0288)V3.CB (T0288)I83.CB 6.7340 11.2234 14.5904 1.0000 Constraint (T0288)V3.CB (T0288)I54.CB 6.8272 11.3787 14.7923 1.0000 Constraint (T0288)P29.CB (T0288)Y91.CB 6.8540 11.4234 14.8504 1.0000 Constraint (T0288)P29.CB (T0288)Y90.CB 7.0624 11.7707 15.3019 1.0000 Constraint (T0288)Q10.CB (T0288)D52.CB 7.0271 11.7119 15.2255 1.0000 Constraint (T0288)K63.CB (T0288)K87.CB 6.7886 11.3143 14.7086 1.0000 Constraint (T0288)P29.CB (T0288)A71.CB 7.1538 11.9230 15.4998 1.0000 Constraint (T0288)L16.CB (T0288)R60.CB 7.1949 11.9914 15.5889 1.0000 Constraint (T0288)L16.CB (T0288)N58.CB 6.9276 11.5461 15.0099 1.0000 Constraint (T0288)D12.CB (T0288)M73.CB 6.8177 11.3629 14.7718 1.0000 Constraint (T0288)D12.CB (T0288)R60.CB 6.8822 11.4704 14.9115 1.0000 Constraint (T0288)Q10.CB (T0288)I21.CB 7.0853 11.8088 15.3514 1.0000 Constraint (T0288)V57.CB (T0288)L88.CB 6.8174 11.3623 14.7711 1.0000 Constraint (T0288)I17.CB (T0288)H84.CB 6.7308 11.2180 14.5835 1.0000 Constraint (T0288)N15.CB (T0288)I83.CB 5.9646 9.9409 12.9232 1.0000 Constraint (T0288)K11.CB (T0288)H84.CB 6.7630 11.2717 14.6532 1.0000 Constraint (T0288)V7.CB (T0288)Y91.CB 6.7177 11.1961 14.5549 1.0000 Constraint (T0288)M2.CB (T0288)Y27.CB 6.8793 11.4654 14.9051 1.0000 Constraint (T0288)Q35.CB (T0288)Q89.CB 6.4236 10.7060 13.9178 0.9999 Constraint (T0288)V34.CB (T0288)Q89.CB 6.1209 10.2016 13.2620 0.9999 Constraint (T0288)V34.CB (T0288)N86.CB 6.9914 11.6523 15.1480 0.9999 Constraint (T0288)E69.CB (T0288)K78.CB 7.1546 11.9243 15.5016 0.9965 Constraint (T0288)N15.CB (T0288)E53.CB 4.8664 8.1107 10.5440 0.9965 Constraint (T0288)N15.CB (T0288)D52.CB 6.6444 11.0739 14.3961 0.9965 Constraint (T0288)N15.CB (T0288)A50.CB 7.1251 11.8752 15.4378 0.9965 Constraint (T0288)N15.CB (T0288)Y32.CB 4.9462 8.2436 10.7167 0.9965 Constraint (T0288)N15.CB (T0288)C30.CB 6.4422 10.7370 13.9581 0.9965 Constraint (T0288)N15.CB (T0288)Y27.CB 4.6940 7.8234 10.1704 0.9965 Constraint (T0288)N15.CB (T0288)Q26.CB 4.7324 7.8873 10.2535 0.9965 Constraint (T0288)N15.CB (T0288)A25.CB 3.3744 5.6240 7.3112 0.9965 Constraint (T0288)Q14.CB (T0288)Q89.CB 6.6040 11.0067 14.3087 0.9965 Constraint (T0288)Q14.CB (T0288)L88.CB 4.2279 7.0466 9.1605 0.9965 Constraint (T0288)Q14.CB (T0288)K87.CB 6.4827 10.8045 14.0458 0.9965 Constraint (T0288)A13.CB (T0288)Q89.CB 6.0497 10.0828 13.1077 0.9965 Constraint (T0288)A13.CB (T0288)L88.CB 5.0905 8.4842 11.0294 0.9965 Constraint (T0288)D12.CB (T0288)Q26.CB 6.9730 11.6217 15.1082 0.9965 Constraint (T0288)D12.CB (T0288)A25.CB 6.8042 11.3403 14.7424 0.9965 Constraint (T0288)K11.CB (T0288)A71.CB 6.9133 11.5222 14.9789 0.9940 Constraint (T0288)K11.CB (T0288)V70.CB 5.4599 9.0999 11.8298 0.9940 Constraint (T0288)K11.CB (T0288)E69.CB 6.0037 10.0061 13.0079 0.9940 Constraint (T0288)K11.CB (T0288)V68.CB 5.4389 9.0649 11.7843 0.9940 Constraint (T0288)K11.CB (T0288)K67.CB 3.2048 5.3413 6.9437 0.9940 Constraint (T0288)K11.CB (T0288)T66.CB 3.6048 6.0080 7.8104 0.9940 Constraint (T0288)K11.CB (T0288)S61.CB 7.0694 11.7824 15.3171 0.9940 Constraint (T0288)K11.CB (T0288)T55.CB 6.9268 11.5447 15.0081 0.9940 Constraint (T0288)K11.CB (T0288)Y32.CB 4.5573 7.5955 9.8742 0.9940 Constraint (T0288)K11.CB (T0288)L31.CB 3.5463 5.9105 7.6837 0.9940 Constraint (T0288)K11.CB (T0288)C30.CB 4.2640 7.1066 9.2386 0.9940 Constraint (T0288)K11.CB (T0288)P29.CB 3.7051 6.1751 8.0276 0.9940 Constraint (T0288)K11.CB (T0288)C28.CB 6.8055 11.3426 14.7453 0.9940 Constraint (T0288)Q10.CB (T0288)A71.CB 7.1680 11.9467 15.5307 0.9940 Constraint (T0288)Q10.CB (T0288)V70.CB 6.9231 11.5386 15.0002 0.9940 Constraint (T0288)Q10.CB (T0288)V68.CB 6.6470 11.0784 14.4019 0.9940 Constraint (T0288)Q10.CB (T0288)K67.CB 3.8915 6.4859 8.4316 0.9940 Constraint (T0288)Q10.CB (T0288)T66.CB 6.3378 10.5630 13.7319 0.9940 Constraint (T0288)Q10.CB (T0288)A50.CB 7.1068 11.8446 15.3980 0.9940 Constraint (T0288)Q10.CB (T0288)Y32.CB 3.4423 5.7372 7.4584 0.9940 Constraint (T0288)Q10.CB (T0288)L31.CB 4.2718 7.1197 9.2556 0.9940 Constraint (T0288)Q10.CB (T0288)C30.CB 6.0069 10.0115 13.0149 0.9940 Constraint (T0288)Q10.CB (T0288)P29.CB 6.7663 11.2771 14.6602 0.9940 Constraint (T0288)L9.CB (T0288)A71.CB 5.6675 9.4458 12.2796 0.9940 Constraint (T0288)L9.CB (T0288)V70.CB 5.4343 9.0572 11.7743 0.9940 Constraint (T0288)L9.CB (T0288)V68.CB 6.8958 11.4930 14.9409 0.9940 Constraint (T0288)L9.CB (T0288)K67.CB 3.8822 6.4704 8.4115 0.9940 Constraint (T0288)L9.CB (T0288)T66.CB 6.7822 11.3037 14.6948 0.9940 Constraint (T0288)L9.CB (T0288)A50.CB 5.3670 8.9450 11.6285 0.9940 Constraint (T0288)L9.CB (T0288)Y32.CB 3.2762 5.4603 7.0984 0.9940 Constraint (T0288)L9.CB (T0288)L31.CB 2.7745 4.6242 6.0115 0.9940 Constraint (T0288)L9.CB (T0288)C30.CB 5.5225 9.2041 11.9653 0.9940 Constraint (T0288)T8.CB (T0288)A71.CB 5.5517 9.2528 12.0286 0.9940 Constraint (T0288)T8.CB (T0288)V70.CB 7.0126 11.6877 15.1940 0.9940 Constraint (T0288)T8.CB (T0288)K67.CB 5.3373 8.8955 11.5642 0.9940 Constraint (T0288)T8.CB (T0288)A50.CB 6.0747 10.1245 13.1618 0.9940 Constraint (T0288)T8.CB (T0288)F37.CB 4.8994 8.1657 10.6154 0.9940 Constraint (T0288)T8.CB (T0288)Y32.CB 6.2161 10.3601 13.4681 0.9940 Constraint (T0288)T8.CB (T0288)L31.CB 5.7960 9.6601 12.5581 0.9940 Constraint (T0288)M73.CB (T0288)N86.CB 6.9961 11.6602 15.1582 0.8737 Constraint (T0288)I21.CB (T0288)K87.CB 6.4968 10.8280 14.0764 0.8737 Constraint (T0288)I17.CB (T0288)K87.CB 6.9345 11.5576 15.0248 0.8737 Constraint (T0288)D45.CB (T0288)L88.CB 6.0076 10.0127 13.0165 0.7382 Constraint (T0288)E69.CB (T0288)Y85.CB 7.0121 11.6868 15.1929 0.4012 Constraint (T0288)N58.CB (T0288)Q89.CB 6.3388 10.5646 13.7340 0.4012 Constraint (T0288)V57.CB (T0288)Q89.CB 6.5611 10.9352 14.2158 0.4012 Constraint (T0288)Y27.CB (T0288)Y91.CB 7.0281 11.7135 15.2276 0.4012 Constraint (T0288)Y27.CB (T0288)Y90.CB 4.9316 8.2193 10.6850 0.4012 Constraint (T0288)Q26.CB (T0288)Y90.CB 5.7281 9.5468 12.4108 0.4012 Constraint (T0288)I83.CB (T0288)K92.CB 6.6053 11.0088 14.3114 0.3370 Constraint (T0288)T82.CB (T0288)K92.CB 6.8206 11.3676 14.7779 0.3370 Constraint (T0288)V81.CB (T0288)K92.CB 4.9476 8.2460 10.7198 0.3370 Constraint (T0288)E80.CB (T0288)K92.CB 2.9601 4.9334 6.4135 0.3370 Constraint (T0288)E80.CB (T0288)Y90.CB 3.1290 5.2150 6.7795 0.3370 Constraint (T0288)E80.CB (T0288)Q89.CB 6.4843 10.8071 14.0493 0.3370 Constraint (T0288)K78.CB (T0288)K92.CB 3.8313 6.3854 8.3011 0.3370 Constraint (T0288)K78.CB (T0288)Y91.CB 6.7962 11.3270 14.7251 0.3370 Constraint (T0288)V77.CB (T0288)K92.CB 6.0049 10.0081 13.0105 0.3370 Constraint (T0288)V77.CB (T0288)Y91.CB 6.0270 10.0450 13.0585 0.3370 Constraint (T0288)I74.CB (T0288)K92.CB 7.1772 11.9621 15.5507 0.3370 Constraint (T0288)I74.CB (T0288)Y91.CB 5.8561 9.7602 12.6883 0.3370 Constraint (T0288)N58.CB (T0288)Y91.CB 5.7379 9.5632 12.4322 0.3370 Constraint (T0288)N58.CB (T0288)L88.CB 6.2405 10.4009 13.5212 0.3370 Constraint (T0288)D45.CB (T0288)K92.CB 4.4827 7.4711 9.7124 0.3370 Constraint (T0288)L44.CB (T0288)K92.CB 4.6590 7.7650 10.0945 0.3370 Constraint (T0288)L44.CB (T0288)Y90.CB 6.7037 11.1728 14.5247 0.3370 Constraint (T0288)L44.CB (T0288)Q89.CB 6.4850 10.8083 14.0508 0.3370 Constraint (T0288)L44.CB (T0288)T82.CB 6.6280 11.0467 14.3607 0.3370 Constraint (T0288)A43.CB (T0288)K92.CB 6.8142 11.3570 14.7641 0.3370 Constraint (T0288)A43.CB (T0288)Q89.CB 6.8036 11.3394 14.7412 0.3370 Constraint (T0288)A42.CB (T0288)K92.CB 6.1874 10.3124 13.4061 0.3370 Constraint (T0288)A42.CB (T0288)Y90.CB 6.8800 11.4666 14.9066 0.3370 Constraint (T0288)P41.CB (T0288)K92.CB 3.4212 5.7020 7.4126 0.3370 Constraint (T0288)P41.CB (T0288)Y90.CB 6.1497 10.2495 13.3244 0.3370 Constraint (T0288)P41.CB (T0288)Q89.CB 6.6904 11.1506 14.4958 0.3370 Constraint (T0288)T40.CB (T0288)K92.CB 5.7080 9.5134 12.3674 0.3370 Constraint (T0288)T40.CB (T0288)Y91.CB 5.6096 9.3493 12.1541 0.3370 Constraint (T0288)A50.CB (T0288)V93.CB 5.7344 9.5574 12.4246 0.1000 Constraint (T0288)V36.CB (T0288)K92.CB 6.1053 10.1755 13.2281 0.1000 Constraint (T0288)Q35.CB (T0288)K92.CB 5.9971 9.9952 12.9938 0.1000 Constraint (T0288)V34.CB (T0288)K92.CB 6.1055 10.1759 13.2287 0.1000 Constraint (T0288)I33.CB (T0288)K92.CB 6.3230 10.5384 13.6999 0.1000 Constraint (T0288)Y32.CB (T0288)K92.CB 6.9087 11.5145 14.9688 0.1000 Constraint (T0288)K92.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: