CASP7 Target T0363
- 1. Protein Name
- 68057197
- 2. Organism Name
- Haemophilus influenzae
- 3. Number of amino acids (approx)
- 97
- 4. Accession number
- GI 68057197
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MAHHHHHHSLNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNK
IGIFSRPIKLTDVLKEGDRIEIYRPLLADPKEIRREG
- 7. Additional information
- pH 6.5, 2.0 M Ammonium Sulphate
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Refined and will be submitted soon
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- 06-20-2006
- 12. Estimated date of public release of structure
- 07-30-2006
Related Files
Template Sequence file Template PDB file