CASP7 Target T0361
- 1. Protein Name
- A putative transcriptional regulator
- 2. Organism Name
- Shigella flexneri 2a str. 2457T
- 3. Number of amino acids (approx)
- 169
- 4. Accession number
- AAP18223.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVA
LRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADF
AVWSEARFSGMVKTALTLAVTTTLKELTP
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Solved
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- July 15
- 12. Estimated date of public release of structure
- Aug. 15
Related Files
Template Sequence file Template PDB file