CASP7 Target T0307
- 1. Protein Name
- PG_1108
- 2. Organism Name
- Porphyromonas gingivalis W83
- 3. Number of amino acids (approx)
- 133
- 4. Accession number
- gi|34397155|gb|AAQ66219.1|
- 5. Sequence Database
- gi|34397155|gb|AAQ66219.1|
- 6. Amino acid sequence
-
MGLGRQSLNIMTFSGQELTAIIKMAKSMVMADGKIKPAEIAVMTREFMRFGILQDQVDLLLKASDSIEAS
QAVALIARMDEERKKYVASYLGVIMASDGDIDDNELALWTLISTLCGLPTMTVMEAINNMKNL
- 7. Additional information
- crystallization condition contains
20% 1,4 butandiol
0.1 Imidazole pH 8.0
0.1 Zn(oAc)2
0.1 MgCl2
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- structure solved, deposited to pdb (on hold for 8 weeks)
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- end of July
Related Files
Template Sequence file Template PDB file