CASP7 Target T0385
- 1. Protein Name
- Rv2844
- 2. Organism Name
- Mycobacterium tuberculosis
- 3. Number of amino acids (approx)
- 162
- 4. Accession number
- O05815
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MTSSEPAHGATPKRSPSEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALK
QHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSAADAARLAVRMENDGATAWRAVVEH
AETADDRVFASTALTESAVMATRWNRVLGAWPITAAFPGGDE
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Structure determined at 2.2A. Refinement in progress. R=0.24; R-free=0.27.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- 10/15/2006
Related Files
Template Sequence file Template PDB file