CASP7 Target T0383
- 1. Protein Name
- Hypothetical Protein SP_1558
- 2. Organism Name
- Streptococcus pneumoniae TIGR4
- 3. Number of amino acids (approx)
- 127
- 4. Accession number
- AAK75645.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
SNAMNLKREQEFVSQYHFDARNFEWENENGAPETKVDVNFQLLQHDQENQVTSLIVILSF
MIVFDKFVISGTISQVNHIDGRIVNEPSELNQEEVETLARPCLNMLNRLTYEVTEIALDL
PGINLEF
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Structure Solved
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- Tracing done
- 12. Estimated date of public release of structure
- early September
Related Files
Template Sequence file Template PDB file