CASP7 Target T0379
- 1. Protein Name
- PG0725
- 2. Organism Name
- Porphyromonas gingivalis W83
- 3. Number of amino acids (approx)
- 208
- 4. Accession number
- AAQ65895.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFR
TELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMS
PRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATA
ERLGFHTYCPDNGENWIPAITRLLREQK
- 7. Additional information
- hydrolase, haloacid dehalogenase-like family (gi 34396830)
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- MCSG target apc80854 is in refinement against data to 2.4A Bragg Spacings.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- september 2006
Related Files
Template Sequence file Template PDB file