CASP7 Target T0360
- 1. Protein Name
- A hypothetical protein NMB1681
- 2. Organism Name
- Neisseria meningitidis MC58
- 3. Number of amino acids (approx)
- 141
- 4. Accession number
- AAF42029
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MTQETALGAALKSAVQTMSKKKQTEMIADHIYGKYDVFKRFKPLALGIDQDLIAALPQYDAALIARVLAN
HCRRPRYLKALARGGKRFDLNNRFKGEVTPEEQAIAQNHPFVQQALQQQSAQAAAETLSVEAEAAESSAA
E
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Solved
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- July 15, 2006
- 12. Estimated date of public release of structure
- Aug. 15, 2006
Related Files
Template Sequence file Template PDB file