CASP7 Target T0351
- 1. Protein Name
- SR355
- 2. Organism Name
- Bacillus subtilis
- 3. Number of amino acids (approx)
- 117
- 4. Accession number
- XKDW_BACSU
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MILYDAIMYKYPNAVSRKDFELRNDGNGSYIEKWNLRAPLPTQAELETWWEELQKNPPYE
PPDQVELLAQELSQEKLARKQLEELNKTLGNELSDIKLSLLSLKGDYAELEHHHHHH
- 7. Additional information
- 8. X-ray structure
- no
- 9. Current state of the experimental work
- in-pdb on hold
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- 6/27/2006
- 12. Estimated date of public release of structure
- 8/1/2006
Related Files
Template Sequence file Template PDB file