CASP7 Target T0347
- 1. Protein Name
- Hypothetical protein Atu1540
- 2. Organism Name
- Agrobacterium tumefaciens
- 3. Number of amino acids (approx)
- 205
- 4. Accession number
- APC5835
- 5. Sequence Database
- TargetDB
- 6. Amino acid sequence
-
MTHIYEPRLSRIAIDKLRPTQIAVGFREVELKRKEWRETRKKDGDDFLGNHIVPVVAGPK
DRAYLIDHHHLVLALSKEGVEHVLTSEVAKFSHLGKDEFWSVMDHRNLIYPFDAQGLRRQ
SGDIPKNIHDLEDDPFRSLAGALRMAGGYAKVIIPFSEFGWADFLRRRIDRDLLSDSFDD
ALAEAMKLAKSREARHLPGWCGVEE
- 7. Additional information
- None
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- refinement of structure
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- 9/1/2006
Related Files
Template Sequence file Template PDB file