CASP7 Target T0343
- 1. Protein Name
- Hypothetical protein PF0280
- 2. Organism Name
- Pyrococcus furiosus
- 3. Number of amino acids (approx)
- 104
- 4. Accession number
- UniRef100_Q8U417
- 5. Sequence Database
- UniProt
- 6. Amino acid sequence
-
MTWREILRKEGFLDLGEFIVELVYIDCPCEPIPPTLAIYDKKGDEWYKVE
EAPNVQNYREAVEWAIEVLERIRDGENVKLVSLDGPAPPKVMKRLSLALQ
KLTE
- 7. Additional information
- This protein does not belong to any Pfam families. It forms dimer. There is no disulfide in the molecules.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- The refinement is finished and it is ready for PDB deposition
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- May 20, 2006
- 12. Estimated date of public release of structure
- End July
Related Files
Template Sequence file Template PDB file