CASP7 Target T0323
- 1. Protein Name
- XB5566A
- 2. Organism Name
- Bacillus halodurans
- 3. Number of amino acids (approx)
- 221
- 4. Accession number
- BAB05468
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MRYFSTDSPEVKTIVAQDSRLFQFIEIAGEVQLPTKPNPFQSLVSSIVEQQLSIKAASAI
YGRVEQLVGGALEKPEQLYRVSDEALRQAGVSKRKIEYIRHVCEHVESGRLDFTELEGAE
ATTVIEKLTAIKGIGQWTAEMFMMFSLGRLDVLSVGDVGLQRGAKWLYGNGEGDGKKLLI
YHGKAWAPYETVACLYLWKAAGTFAEEYRSLEELLHHGNQC
- 7. Additional information
- None
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Solved, on hold in PDB
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- Completed
- 12. Estimated date of public release of structure
- July 20
Related Files
Template Sequence file Template PDB file