CASP7 Target T0319
- 1. Protein Name
- TRM112
- 2. Organism Name
- Saccharomyces cerevisiae
- 3. Number of amino acids (approx)
- 135
- 4. Accession number
- 5. Sequence Database
- 6. Amino acid sequence
-
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVL
TVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYY
IKNGIPNLLLPPHLV
- 7. Additional information
- Subunit of an adoMet-dependent tRNA methyltransferase (MTase) complex (Trm11p-Trm112p), required for the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- completed
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- End of July
Related Files
Template Sequence file Template PDB file