CASP7 Target T0306
- 1. Protein Name
- EutN (ER316)
- 2. Organism Name
- E. coli
- 3. Number of amino acids (approx)
- 95
- 4. Accession number
- P0AEJ8
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSG
SSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
- 7. Additional information
- This is a family of related bacterial proteins with roles in ethanolamine and carbon dioxide metabolism.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- X-Ray structure solved and in refinement
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- May 26, 2006
- 12. Estimated date of public release of structure
- August 1, 2006
Related Files
Template Sequence file Template PDB file