PFRMAT RR TARGET T0290 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQK PLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNA AFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIEN QKTDAASKPFAEVRILSCGELIP 8 18 0 8 0.446274002555 8 20 0 8 0.456677775781 9 18 0 8 0.541317001123 9 20 0 8 0.533321279712 9 22 0 8 0.511444000649 10 22 0 8 0.442433599387 18 30 0 8 0.484068508438 18 31 0 8 0.467640026684 18 34 0 8 0.554436003771 18 37 0 8 0.521220981257 18 38 0 8 0.454990078524 18 59 0 8 0.469616510501 18 62 0 8 0.461539814485 18 68 0 8 0.460291944182 18 104 0 8 0.49936769815 18 118 0 8 0.443020504854 18 120 0 8 0.491306607899 18 134 0 8 0.46602776493 19 31 0 8 0.519620061707 19 34 0 8 0.5544741315 19 37 0 8 0.537055199281 19 38 0 8 0.498638257059 20 29 0 8 0.440392267905 20 30 0 8 0.567029048233 20 31 0 8 0.57486702011 20 34 0 8 0.640343225766 20 35 0 8 0.462228689962 20 37 0 8 0.602400687824 20 38 0 8 0.524048722318 20 59 0 8 0.542358236801 20 62 0 8 0.524191759804 20 67 0 8 0.484626207899 20 68 0 8 0.531200064705 20 104 0 8 0.585444741712 20 118 0 8 0.545448043136 20 119 0 8 0.472222412763 20 120 0 8 0.599720853103 20 134 0 8 0.54011110492 20 135 0 8 0.465001780178 20 144 0 8 0.455407932829 20 145 0 8 0.481094111311 20 148 0 8 0.497143915936 20 165 0 8 0.472240446688 21 34 0 8 0.487510653501 21 37 0 8 0.48972945781 22 31 0 8 0.522244249423 22 33 0 8 0.507112944174 22 34 0 8 0.629073758209 22 35 0 8 0.46139617662 22 37 0 8 0.573646932757 22 38 0 8 0.522942932526 22 59 0 8 0.463776461245 22 62 0 8 0.463351410419 22 68 0 8 0.46610398094 22 104 0 8 0.487726537163 22 118 0 8 0.441838188043 22 120 0 8 0.472605633683 22 134 0 8 0.459716716178 22 148 0 8 0.477461268174 23 34 0 8 0.480740301975 37 59 0 8 0.442114629024 37 104 0 8 0.444190062851 38 59 0 8 0.436397149602 59 68 0 8 0.523658119954 59 104 0 8 0.467657614994 59 118 0 8 0.449140482882 59 120 0 8 0.448319665815 62 104 0 8 0.473493804523 62 120 0 8 0.462510102922 66 104 0 8 0.436569887533 66 118 0 8 0.437096959682 66 120 0 8 0.456694055818 67 104 0 8 0.494604830521 67 118 0 8 0.475103332391 67 120 0 8 0.497645406686 67 134 0 8 0.46917017084 68 104 0 8 0.515312432814 68 118 0 8 0.441424266313 68 120 0 8 0.463495048285 68 134 0 8 0.444857774144 103 118 0 8 0.48203560395 103 120 0 8 0.539699453606 103 134 0 8 0.435670764456 104 118 0 8 0.599557448547 104 119 0 8 0.553853194187 104 120 0 8 0.640092672113 104 121 0 8 0.525770673587 104 122 0 8 0.511302164882 104 125 0 8 0.441087648806 104 128 0 8 0.463316233799 104 133 0 8 0.462214033037 104 134 0 8 0.588560321917 104 135 0 8 0.516588767301 104 138 0 8 0.447847589678 104 144 0 8 0.562137805185 104 145 0 8 0.555460005656 104 148 0 8 0.630898442419 104 165 0 8 0.501728250568 105 118 0 8 0.500623957806 105 120 0 8 0.522612846021 105 145 0 8 0.452363565752 105 148 0 8 0.474363941438 106 118 0 8 0.531093519659 106 119 0 8 0.493975169838 106 120 0 8 0.564637894894 106 134 0 8 0.466575933926 106 135 0 8 0.441791405723 106 145 0 8 0.44125595756 106 148 0 8 0.462923428208 107 118 0 8 0.461926757306 107 120 0 8 0.472438819871 118 128 0 8 0.465060407878 118 133 0 8 0.503045296981 118 134 0 8 0.591485263472 118 135 0 8 0.538144864525 118 138 0 8 0.465060407878 118 144 0 8 0.53779132869 118 145 0 8 0.495528332855 118 148 0 8 0.5419562714 118 165 0 8 0.436450299735 119 128 0 8 0.519317482411 119 133 0 8 0.500558105485 119 134 0 8 0.632004146583 119 135 0 8 0.593064840848 119 138 0 8 0.523322532007 119 142 0 8 0.448727947879 119 144 0 8 0.54650865064 119 145 0 8 0.545041234779 119 148 0 8 0.589088663315 119 165 0 8 0.495468365171 120 132 0 8 0.51994464677 120 133 0 8 0.580379200471 120 134 0 8 0.659772027494 120 135 0 8 0.596234889238 120 138 0 8 0.543288084475 120 139 0 8 0.452331005676 120 142 0 8 0.46352729352 120 144 0 8 0.620277146269 120 145 0 8 0.601463835035 120 148 0 8 0.655087763551 120 163 0 8 0.473151159935 120 165 0 8 0.566805728672 121 133 0 8 0.461563265565 121 134 0 8 0.577944472584 121 135 0 8 0.533563427544 121 138 0 8 0.484302382406 121 144 0 8 0.530050795271 121 145 0 8 0.533994450685 121 148 0 8 0.573630592302 122 133 0 8 0.441340111936 122 134 0 8 0.545893595147 122 135 0 8 0.470905936187 122 144 0 8 0.490670950449 122 145 0 8 0.45525055913 122 148 0 8 0.482377419749 128 144 0 8 0.463380724269 128 145 0 8 0.438239687533 128 148 0 8 0.45464277105 133 144 0 8 0.521567572088 133 145 0 8 0.508906153522 133 148 0 8 0.5186573094 134 144 0 8 0.570046585703 134 145 0 8 0.544915317906 134 148 0 8 0.586730190888 134 165 0 8 0.464990054638 135 144 0 8 0.594170545012 135 145 0 8 0.588037427337 135 148 0 8 0.610009893323 135 165 0 8 0.511408541707 136 145 0 8 0.44670354931 136 148 0 8 0.438585163395 138 148 0 8 0.473809398223 148 165 0 8 0.446023079203 END