PFRMAT RR TARGET T0288 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAA GDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 7 17 0 8 0.59574467557 7 19 0 8 0.509833151574 7 20 0 8 0.51586257699 7 21 0 8 0.661634839434 7 31 0 8 0.484824101257 7 33 0 8 0.56450172443 7 36 0 8 0.424418724808 7 70 0 8 0.498724371633 9 18 0 8 0.50827295813 9 19 0 8 0.508896022395 9 21 0 8 0.47177156462 9 31 0 8 0.492050207181 9 33 0 8 0.554822727887 9 81 0 8 0.431236047401 17 27 0 8 0.442731305059 17 31 0 8 0.591109432993 17 62 0 8 0.662958416339 17 74 0 8 0.580744137313 18 30 0 8 0.43366434695 18 32 0 8 0.453020193945 18 33 0 8 0.502472888348 19 30 0 8 0.545123565042 19 31 0 8 0.661547690338 19 32 0 8 0.514982346309 19 33 0 8 0.570847268028 19 34 0 8 0.469323459208 19 35 0 8 0.465086790343 19 36 0 8 0.529033028547 19 42 0 8 0.464864005083 19 54 0 8 0.478728151454 19 70 0 8 0.494310988869 19 83 0 8 0.470324342084 20 30 0 8 0.492428003591 20 31 0 8 0.589420919246 20 32 0 8 0.583669078869 20 34 0 8 0.49588214219 21 31 0 8 0.669723364965 21 32 0 8 0.486179370916 21 33 0 8 0.613365133543 21 34 0 8 0.666090336999 21 36 0 8 0.554430556952 21 54 0 8 0.549336937317 21 55 0 8 0.563374232993 21 57 0 8 0.541258885644 22 31 0 8 0.543723950573 22 32 0 8 0.549026988093 22 34 0 8 0.627521414925 31 53 0 8 0.454034982971 31 55 0 8 0.498197553067 31 62 0 8 0.462070395172 31 70 0 8 0.741534220581 32 53 0 8 0.721244821524 33 48 0 8 0.554920770621 33 52 0 8 0.49771632457 33 53 0 8 0.446945966786 33 54 0 8 0.671994688295 33 55 0 8 0.537403892159 33 57 0 8 0.540619615367 33 83 0 8 0.573559783661 33 85 0 8 0.443556375064 34 50 0 8 0.508354007141 34 51 0 8 0.507497926972 34 53 0 8 0.490557011849 36 48 0 8 0.423076847967 36 54 0 8 0.550421759605 36 57 0 8 0.443390510475 36 62 0 8 0.537103628847 36 85 0 8 0.436299707692 42 54 0 8 0.503724082441 48 85 0 8 0.720792735585 52 87 0 8 0.551477524152 53 74 0 8 0.42076235769 53 86 0 8 0.491294614363 54 74 0 8 0.430359519703 54 83 0 8 0.495750213285 54 85 0 8 0.444572827287 55 83 0 8 0.518409744521 55 85 0 8 0.457046789972 56 82 0 8 0.457404950804 56 84 0 8 0.623267449647 57 67 0 8 0.512116095156 57 70 0 8 0.564256617596 57 73 0 8 0.446537684722 57 74 0 8 0.538856779151 57 81 0 8 0.662555351767 57 82 0 8 0.45253179281 57 83 0 8 0.515191401096 57 85 0 8 0.483168993178 58 67 0 8 0.445329850281 62 73 0 8 0.468273205845 70 81 0 8 0.444151786408 70 83 0 8 0.451782911069 70 85 0 8 0.473741771002 END