CASP7 Target T0287
- 1. Protein Name
- CagS (HP0534)
- 2. Organism Name
- Helicobacter pylori
- 3. Number of amino acids (approx)
- 199
- 4. Accession number
- Q75WX2
- 5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MSNNMRKLFSMIADSKDKKEKLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGA
LDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGI
FLPFFSKPIMFKMSIREMDSQIELYGTNLPLLKLFVMTDEEVNFYANLKTIEQYNDYVRD
LLMKFDLEKYMKEKGVQNA
- 7. Additional information
- GO category Molecular Function: UNKNOWN
EC number: UNKNOWN
Binding site: UNKNOWN
Comment: The protein is a monomer, despite the fact that there are four monomers in the asymmetric unit. The structure solved was obtained from a different strain, so it contains some mutations with respect to the reported sequence.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Structure have been already solved using the Se-Met method. The C-terminus was probably cleaved by a protease.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- Already traced and refined
- 12. Estimated date of public release of structure
- June 4th, 2006
Related Files
Template Sequence file
Template PDB file