CASP7 Target T0286
- 1. Protein Name
- CelX
- 2. Organism Name
- Clostridium thermocellum
- 3. Number of amino acids (approx)
- 205
- 4. Accession number
- 5. Sequence Database
-
6. Amino acid sequence
-
MASKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSSLPDKDH
EGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLNGNLNATGLSNLIDQIFTVKPN
VTLFVADYYPWPEAIKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISWDGLHLS
EIGYKKIANIWYKYTIDILRALAGE
- 7. Additional information
- structure solved is one domain (cellulose esterase family 3), with sequence in the box # 6 above, from a multi-domain protein involved in cellulose degradation
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- crystal structure solved by SeMet SAD and fully refined.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- several months
Related Files
Template Sequence file
Template PDB file