PFRMAT RR TARGET T0286 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 MASKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRS GPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLNG NLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKA NAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILR ALAGE 7 89 0 8 0.585646273998 8 31 0 8 0.613370580361 8 35 0 8 0.603680690181 8 42 0 8 0.610091595601 8 44 0 8 0.689119485782 8 45 0 8 0.585820572192 8 86 0 8 0.674952310762 8 87 0 8 0.694370218853 8 88 0 8 0.707420796072 8 89 0 8 0.696276605342 8 90 0 8 0.603762392459 8 123 0 8 0.690383147683 8 124 0 8 0.68342211359 8 125 0 8 0.689413613983 8 158 0 8 0.580978350511 9 31 0 8 0.656460361822 9 35 0 8 0.64782170762 9 42 0 8 0.664358248704 9 44 0 8 0.734861867871 9 45 0 8 0.627973500864 9 86 0 8 0.692523747368 9 87 0 8 0.712785912333 9 88 0 8 0.714528894266 9 89 0 8 0.705127685467 9 90 0 8 0.623262002828 9 110 0 8 0.580711456402 9 114 0 8 0.586637594973 9 123 0 8 0.699294142812 9 124 0 8 0.69658162718 9 125 0 8 0.699239674627 9 126 0 8 0.610489213354 9 158 0 8 0.598304680283 10 31 0 8 0.642859655931 10 35 0 8 0.636018451846 10 42 0 8 0.651629033778 10 44 0 8 0.725733 10 45 0 8 0.607422654517 10 86 0 8 0.683226028123 10 87 0 8 0.703847683111 10 88 0 8 0.702556787117 10 89 0 8 0.700029463315 10 90 0 8 0.602362560094 10 123 0 8 0.69710452176 10 124 0 8 0.687572589317 10 125 0 8 0.691211064101 10 126 0 8 0.582220225137 10 158 0 8 0.596507230165 11 27 0 8 0.584284569364 11 31 0 8 0.665033654203 11 35 0 8 0.647685537156 11 42 0 8 0.650735755538 11 44 0 8 0.721811290652 11 45 0 8 0.591283731186 11 86 0 8 0.698863844148 11 87 0 8 0.71753009128 11 88 0 8 0.701560019324 11 89 0 8 0.702872702592 11 90 0 8 0.608000017282 11 114 0 8 0.576620895679 11 123 0 8 0.702191850275 11 124 0 8 0.687017013826 11 125 0 8 0.692943152396 11 158 0 8 0.58657223315 12 31 0 8 0.594508247761 12 44 0 8 0.572895271799 12 86 0 8 0.57244318586 12 87 0 8 0.647070046661 12 88 0 8 0.659200111548 12 89 0 8 0.649172518617 12 123 0 8 0.599557448547 12 124 0 8 0.615919691438 12 125 0 8 0.625544219796 13 88 0 8 0.602705709662 13 89 0 8 0.577171024352 13 124 0 8 0.575842000628 15 88 0 8 0.594317609112 15 89 0 8 0.591490710291 44 86 0 8 0.585259549882 44 87 0 8 0.651449288767 44 88 0 8 0.660752454831 44 89 0 8 0.650267329144 44 123 0 8 0.598201190731 44 124 0 8 0.615778074156 44 125 0 8 0.618920888452 45 87 0 8 0.625762092537 45 88 0 8 0.637216751925 45 89 0 8 0.628681587274 45 123 0 8 0.57680608751 45 124 0 8 0.606099077612 45 125 0 8 0.601719835507 75 88 0 8 0.585836912647 75 89 0 8 0.571070587588 86 123 0 8 0.633098957109 86 124 0 8 0.640168927573 86 125 0 8 0.64398170055 87 96 0 8 0.705024195915 87 97 0 8 0.65714121414 87 107 0 8 0.63078405923 87 110 0 8 0.644766042419 87 111 0 8 0.608702656874 87 114 0 8 0.639613352082 87 123 0 8 0.750243683425 87 124 0 8 0.725133849961 87 125 0 8 0.734186462372 87 126 0 8 0.626295880754 87 146 0 8 0.587313000471 87 156 0 8 0.579589411783 87 158 0 8 0.64353506143 87 159 0 8 0.591398114375 87 191 0 8 0.576757066143 87 195 0 8 0.584349931186 88 97 0 8 0.685818713747 88 107 0 8 0.653328441163 88 110 0 8 0.652941717046 88 111 0 8 0.611328023409 88 114 0 8 0.656149893166 88 121 0 8 0.645817278397 88 123 0 8 0.760647106834 88 124 0 8 0.748664106049 88 125 0 8 0.756752631579 88 126 0 8 0.65326307934 88 142 0 8 0.583413078397 88 146 0 8 0.600298215868 88 150 0 8 0.572236206756 88 156 0 8 0.639232074784 88 158 0 8 0.672158092852 88 159 0 8 0.624133493794 88 187 0 8 0.578957580833 88 191 0 8 0.58966602608 88 195 0 8 0.588723726473 89 107 0 8 0.652375247918 89 110 0 8 0.655262061744 89 111 0 8 0.620206337628 89 114 0 8 0.662925735428 89 121 0 8 0.67097068641 89 123 0 8 0.761938002828 89 124 0 8 0.753321135899 89 125 0 8 0.760195020896 89 126 0 8 0.695241709819 89 142 0 8 0.590205261115 89 146 0 8 0.606224354438 89 156 0 8 0.673448988845 89 158 0 8 0.690127147211 89 159 0 8 0.63082218696 89 187 0 8 0.5989855326 89 191 0 8 0.607727676355 89 195 0 8 0.607428101335 90 107 0 8 0.615636456874 90 110 0 8 0.601567324588 90 114 0 8 0.606997802671 90 123 0 8 0.725112062687 90 124 0 8 0.704844450903 90 125 0 8 0.718826434093 91 107 0 8 0.629542184603 91 110 0 8 0.626922264886 91 111 0 8 0.583059035192 91 114 0 8 0.630849421053 91 123 0 8 0.734202802828 91 124 0 8 0.704937046819 91 125 0 8 0.721054182875 91 158 0 8 0.577579535742 92 124 0 8 0.60036357769 92 125 0 8 0.594780588688 96 107 0 8 0.585706189002 96 124 0 8 0.615064540927 96 125 0 8 0.597193529301 111 123 0 8 0.575901915632 114 123 0 8 0.629177247761 114 124 0 8 0.63246167934 114 125 0 8 0.642064420424 123 156 0 8 0.573690507306 123 158 0 8 0.632641424352 123 159 0 8 0.59846263802 124 135 0 8 0.580765924588 124 142 0 8 0.617450247447 124 146 0 8 0.645163660173 124 150 0 8 0.601115238649 124 156 0 8 0.657713130086 124 158 0 8 0.70030725106 124 159 0 8 0.665060888295 124 187 0 8 0.604110988845 124 191 0 8 0.60517311846 124 195 0 8 0.610440191987 125 135 0 8 0.632134870228 125 142 0 8 0.634945428594 125 145 0 8 0.57531365923 125 146 0 8 0.64699923802 125 149 0 8 0.606883419482 125 150 0 8 0.593860076355 125 156 0 8 0.689152166693 125 158 0 8 0.714877490652 125 159 0 8 0.650790223723 125 187 0 8 0.605347416654 125 191 0 8 0.621932979104 125 195 0 8 0.620783700393 126 135 0 8 0.617188800157 126 142 0 8 0.626426604399 126 146 0 8 0.635277684525 126 150 0 8 0.581898862844 126 156 0 8 0.656574745012 126 158 0 8 0.698286481383 126 159 0 8 0.624939622938 126 187 0 8 0.583799802514 126 191 0 8 0.583560142498 126 195 0 8 0.594263140927 END