CASP7 Target T0285
- 1. Protein Name
- AbfS
- 2. Organism Name
- Cellvibrio japonicus
- 3. Number of amino acids (approx)
- 125
- 4. Accession number
- 5. Sequence Database
-
6. Amino acid sequence
-
AYLPDDSPAKRLLFQMVGNAINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPP
GIMVLAPRLTAKHPYDKVQDRNRKLYGRHITLNDGNSVKVVTISAGRDEGPDRDIIWEMF
LENLE
- 7. Additional information
- sequence in box 6 is construct used for structure determination. it is an extracytoplasmic domain from a two-component histidine kinase.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- crystal structure solved
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- finished
- 12. Estimated date of public release of structure
- several months
Related Files
Template Sequence file
Template PDB file