PFRMAT RR TARGET T0283 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 MSFIEKMIGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTD WQDTKRIFGGILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDTKTWMDK YRTKLNDSIGRD 4 27 0 8 0.748730245264 4 38 0 8 0.749138718784 7 17 0 8 0.7597911556 7 20 0 8 0.762134238009 7 27 0 8 0.749907504784 7 38 0 8 0.768176872849 20 31 0 8 0.755088005764 20 38 0 8 0.7517236804 24 34 0 8 0.784321013161 24 35 0 8 0.7697956644 24 38 0 8 0.792938601841 24 39 0 8 0.7485191289 24 41 0 8 0.759667384921 24 42 0 8 0.776837755456 24 57 0 8 0.760720629249 24 61 0 8 0.753703521921 24 64 0 8 0.769460541721 27 38 0 8 0.794583263236 27 42 0 8 0.776412986449 27 57 0 8 0.751038890625 27 64 0 8 0.752691586084 31 42 0 8 0.750172515625 35 57 0 8 0.755823323161 35 64 0 8 0.757173204649 38 57 0 8 0.7848542464 38 61 0 8 0.7806252609 38 62 0 8 0.776587462564 38 64 0 8 0.781181984025 38 65 0 8 0.748347835041 38 83 0 8 0.751165423204 38 90 0 8 0.754469434404 42 51 0 8 0.753293805625 42 54 0 8 0.769553526564 42 57 0 8 0.789099985969 42 58 0 8 0.766270886161 42 61 0 8 0.780158826756 42 62 0 8 0.772134778944 42 64 0 8 0.784367066025 42 65 0 8 0.773921353984 42 78 0 8 0.750912368704 42 83 0 8 0.749839960489 42 86 0 8 0.749294521924 43 64 0 8 0.750869041729 52 64 0 8 0.759988163529 54 64 0 8 0.768206672676 55 64 0 8 0.767980559025 57 78 0 8 0.759139293796 57 83 0 8 0.757402943521 57 90 0 8 0.757677979809 58 68 0 8 0.749265091201 58 70 0 8 0.749152567296 58 75 0 8 0.7495750084 58 78 0 8 0.756710351881 58 83 0 8 0.752396638464 58 86 0 8 0.751494804544 58 90 0 8 0.76020961 61 70 0 8 0.768273286144 61 75 0 8 0.758921487921 61 78 0 8 0.774389440036 61 79 0 8 0.751094355649 61 83 0 8 0.780202990681 61 86 0 8 0.757420349401 61 87 0 8 0.753811177729 61 90 0 8 0.773388330625 61 91 0 8 0.763077372849 61 105 0 8 0.763225882384 61 109 0 8 0.748998509809 62 75 0 8 0.755633809984 62 78 0 8 0.763973891136 62 83 0 8 0.767034398025 62 86 0 8 0.755870270464 62 87 0 8 0.754836028969 62 90 0 8 0.768709851121 62 91 0 8 0.762092334441 62 105 0 8 0.761177727025 64 75 0 8 0.756757326724 64 78 0 8 0.759977702289 64 83 0 8 0.758494679056 64 86 0 8 0.753137587225 64 90 0 8 0.762951587841 64 91 0 8 0.750205428736 64 105 0 8 0.750955696929 65 75 0 8 0.765744004624 65 78 0 8 0.765796509604 65 83 0 8 0.773652180625 65 86 0 8 0.766458226576 65 87 0 8 0.764465189569 65 90 0 8 0.777229139236 65 91 0 8 0.763143763561 65 105 0 8 0.763674993225 68 78 0 8 0.750380400025 69 78 0 8 0.748261330441 75 90 0 8 0.756132854481 76 90 0 8 0.749029666225 78 90 0 8 0.7785238756 79 90 0 8 0.7609945225 83 97 0 8 0.753394488289 83 105 0 8 0.771138641025 83 109 0 8 0.754736987536 86 97 0 8 0.753521219136 86 101 0 8 0.748827161104 86 105 0 8 0.756379829401 86 109 0 8 0.748359946084 87 97 0 8 0.753838961121 87 101 0 8 0.758012268321 87 105 0 8 0.771047316649 90 101 0 8 0.769721966244 90 102 0 8 0.752802640164 90 105 0 8 0.788309585424 90 109 0 8 0.759454732089 91 105 0 8 0.769976415289 91 109 0 8 0.755176642081 END