CASP7 Target T0373
- 1. Protein Name
- APC5815
- 2. Organism Name
- Pseudomonas aeruginosa PAO1
- 3. Number of amino acids (approx)
- 147
- 4. Accession number
- AAG08180.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAE
RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMH
ACLDESERALLAAAGPLLTRLAQFEEP
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Solved and refined
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- N/A
- 12. Estimated date of public release of structure
- September
Related Files
Template Sequence file Template PDB file