CASP7 Target T0372
- 1. Protein Name
- conserved hypothetical protein
- 2. Organism Name
- Bacteroides thetaiotaomicron
- 3. Number of amino acids (approx)
- 305
- 4. Accession number
- GI:29341004
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MIPFKDITLADRDTITAFTMKSDRRNCDLSFSNLCSWRFLYDTQFAVIDDFLVFKFWAGEQLAYMMPVGN
GDLKAVLRKLIEDADKEKHNFCMLGVCSNMRADLEAILPERFIFTEDRAYADYIYLRSDLATLKGKKFQA
KRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNFEALGLTGGI
LHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKL
SYQPVTILEKYMACLKDHPMDMVRW
- 7. Additional information
- crystals structure indicates dimeric oligomerization state
intrasubunit disulfide bond formed between cys 176 and cys1 81
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Structure undergoes refinement
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- structure undergoes refinement
- 12. Estimated date of public release of structure
- August 20th 2006
Related Files
Template Sequence file Template PDB file