CASP7 Target T0367
- 1. Protein Name
- FH7577A
- 2. Organism Name
- Archaeoglobus fulgidus DSM 4304
- 3. Number of amino acids (approx)
- 125
- 4. Accession number
- NP_069135.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MDELELRIRKAEKLVQDAKKEFEMGLYERCCSTAYYAMFHAAKAMLLGYGRDSKTHRGTI
YLIWECREELGLSDDDCSKLSRAFDLREESDYGIYKEVSKDLAIKILKDAEIFVQKAKNA
VNKNR
- 7. Additional information
- Hypothetical protein PF01953; DUF103
http://www1.jcsg.org/cgi-bin/psat/targetinfo.cgi?acc=NP_069135.1
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- refinement, trace 85% complete
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- n/a
- 12. Estimated date of public release of structure
- August
Related Files
Template Sequence file Template PDB file