CASP7 Target T0366
- 1. Protein Name
- MPDZ12
- 2. Organism Name
- Homo sapiens
- 3. Number of amino acids (approx)
- 106
- 4. Accession number
- MPDZ_HUMAN
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
TENLYFQSMGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRV
GDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSETSV
- 7. Additional information
- Dimer in unit cell.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Complete. Structure deposited in PDB with 4 week hold.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- n/a
- 12. Estimated date of public release of structure
- 01-Aug-06
Related Files
Template Sequence file Template PDB file