CASP7 Target T0364
- 1. Protein Name
- FG7402A
- 2. Organism Name
- Pseudomonas putida KT2440
- 3. Number of amino acids (approx)
- 156
- 4. Accession number
- NP_742468.1
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMDRIGLDADSRGQSGNSLFTLE
AHINYLHEVKLGTEVWVQTQILGFDRKRLHVYHSLHRAGFDEVLAASEQMLLHVDLAGPQ
SAPFGHTTVCRLNHLVEQQEGAQAPQYMGRTIKLPA
- 7. Additional information
- Hypothetical protein PP0301
http://www1.jcsg.org/cgi-bin/psat/targetinfo.cgi?acc=NP_742468.1
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- refinement, trace >85% complete
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- n/a
- 12. Estimated date of public release of structure
- August
Related Files
Template Sequence file Template PDB file