CASP7 Target T0354
- 1. Protein Name
- CvR5
- 2. Organism Name
- Chromobacterium violaceum (ATCC 12472)
- 3. Number of amino acids (approx)
- 130
- 4. Accession number
- Q7P0P8
- 5. Sequence Database
- 6. Amino acid sequence
-
MEIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLK
EAGVDIVGSEGHESGEWVLVDAGDVVVHVMLPAVRDYYDIEALWGGQKPSFAVGAAKPWS
AVLEHHHHHH
- 7. Additional information
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- refinement, will submit to pdb next week
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- 7/3/2006
- 12. Estimated date of public release of structure
- 8/3/2006
Related Files
Template Sequence file Template PDB file