CASP7 Target T0344
- 1. Protein Name
- Hypothetical protein PF2046
- 2. Organism Name
- Pyrococcus furiosus
- 3. Number of amino acids (approx)
- 229
- 4. Accession number
- Q8TZE9
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRD
EVLLAIELARKVKPDVIHLDSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLA
RKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIENVEKEGHLIIGLPRYMEVNIKD
GKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFSKR
- 7. Additional information
- This protein does not belong to any Pfam families.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Crystallized and diffracted to 3.0A
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- July 15
- 12. Estimated date of public release of structure
- August
Related Files
Template Sequence file Template PDB file