CASP7 Target T0342
- 1. Protein Name
- CESG35223
- 2. Organism Name
- Homo sapiens
- 3. Number of amino acids (approx)
- 188
- 4. Accession number
- 35223
- 5. Sequence Database
- CESG Sesame
- 6. Amino acid sequence
-
SANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKT
SQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEI
TCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII
KKGETQTL
- 7. Additional information
- None
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Map tracing in progress.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- June 25
- 12. Estimated date of public release of structure
- July 25
Related Files
Template Sequence file Template PDB file