CASP7 Target T0332
- 1. Protein Name
- TARBP1
- 2. Organism Name
- Homo sapiens
- 3. Number of amino acids (approx)
- 159
- 4. Accession number
- gi|56205978|emb|CAI22931.1|
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
LGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWL
PLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANL
IQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLS
- 7. Additional information
- Comment: Dimer in the unit-cell. Ligand bound: S-adenosylhomocysteine
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Complete. Structure deposited in PDB with 4 week hold.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- n/a
- 12. Estimated date of public release of structure
- 19-Jul-06
Related Files
Template Sequence file Template PDB file