CASP7 Target T0330
- 1. Protein Name
- FG7292A
- 2. Organism Name
- Chlorobium tepidum
- 3. Number of amino acids (approx)
- 233
- 4. Accession number
- NP_662590
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MSRTLVLFDIDGTLLKVESMNRRVLADALIEVYGTEGSTGSHDFSGKMDGAIIYEVLSNV
GLERAEIADKFDKAKETYIALFRERARREDITLLEGVRELLDALSSRSDVLLGLLTGNFE
ASGRHKLKLPGIDHYFPFGAFADDALDRNELPHIALERARRMTGANYSPSQIVIIGDTEH
DIRCARELDARSIAVATGNFTMEELARHKPGTLFKNFAETDEVLASILTPKHS
- 7. Additional information
- None
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- In refinement, 85% complete trace
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- July
- 12. Estimated date of public release of structure
- August
Related Files
Template Sequence file Template PDB file