CASP7 Target T0327
- 1. Protein Name
- SR346
- 2. Organism Name
- Bacillus subtilis
- 3. Number of amino acids (approx)
- 102
- 4. Accession number
- O31639_BACSU
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MNKDKLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYK
LGPELTEKGENYLKENGTWSKAYKTIKEIKDWIKLEHHHHHH
- 7. Additional information
- NESG Target, SR346
- 8. X-ray structure
- no
- 9. Current state of the experimental work
- refinement
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- 6/14/2006
- 12. Estimated date of public release of structure
- 7/30/2006
Related Files
Template Sequence file Template PDB file