CASP7 Target T0317
- 1. Protein Name
- NP_780327
- 2. Organism Name
- Mus musculus
- 3. Number of amino acids (approx)
- 163
- 4. Accession number
- NP_780327
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRV
PVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDR
AFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPREPIDPE
- 7. Additional information
- pH of crystals 6.0
most likely monomeric, but homodimer can not be ruled out,
tungstate ion is sitting in the open cleft of the molecule near Arg103
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- structure is solved and refined to Rfactor ~16.8% and Rfree of ~21.6%, resolution 2A
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- completed
- 12. Estimated date of public release of structure
- approx. two months from now
Related Files
Template Sequence file Template PDB file