CASP7 Target T0314
- 1. Protein Name
- PaT4
- 2. Organism Name
- Pseudomonas Aeruginosa
- 3. Number of amino acids (approx)
- 106
- 4. Accession number
- Q9I4L2
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
- MSITSTDICQAADALKGFVGFNRKTGRYIVRFSEDSFGMDVADDSITPTSEFVWSSVRDDVMRLGREQLQILLEQNINERLNIGEPLLVYLRRQDLPEITAQRQLR
- 7. Additional information
- GO category Molecular Function:
EC number:
Binding site:
Comment: NESG Target, PaT4
- 8. X-ray structure
- no
- 9. Current state of the experimental work
- completed, about to go in PDB.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- 5/30/2006
- 12. Estimated date of public release of structure
- 7/30/2006
Related Files
Template Sequence file Template PDB file