PFRMAT RR TARGET T0311 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTP EMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 8 71 0 8 0.261518756119 9 23 0 8 0.258030212858 9 47 0 8 0.260198678857 9 49 0 8 0.260142726839 9 64 0 8 0.257204920593 9 74 0 8 0.330113418579 12 70 0 8 0.27079645977 13 24 0 8 0.263573366267 13 27 0 8 0.469165662359 13 28 0 8 0.36062209863 13 31 0 8 0.281801668428 13 38 0 8 0.362912971429 13 41 0 8 0.557028689395 13 42 0 8 0.288514931909 13 48 0 8 0.449714629535 13 52 0 8 0.268625460432 13 56 0 8 0.468109048285 13 60 0 8 0.422750445492 13 66 0 8 0.349426238691 13 70 0 8 0.260424438744 16 27 0 8 0.322965337117 17 27 0 8 0.386956175516 17 28 0 8 0.268386035971 17 38 0 8 0.274184983471 17 41 0 8 0.380294562208 17 56 0 8 0.282122085865 24 34 0 8 0.260989489065 24 37 0 8 0.29716856147 24 38 0 8 0.425120984679 24 52 0 8 0.263438365759 27 38 0 8 0.596839486096 27 41 0 8 0.367893786802 27 42 0 8 0.53607692204 27 49 0 8 0.25904775886 27 52 0 8 0.308420823529 27 56 0 8 0.599660938099 27 59 0 8 0.436862213263 27 60 0 8 0.255260587968 28 37 0 8 0.257450198625 28 38 0 8 0.33828482912 28 41 0 8 0.390166019844 28 42 0 8 0.267904884892 28 52 0 8 0.262878194974 28 53 0 8 0.298235215711 28 56 0 8 0.426309961736 28 59 0 8 0.258590708945 28 60 0 8 0.31719357461 28 70 0 8 0.347054221367 28 76 0 8 0.308198789916 31 41 0 8 0.264157609432 31 42 0 8 0.256002602812 31 49 0 8 0.263701210122 31 53 0 8 0.463943550191 31 56 0 8 0.296007134253 34 49 0 8 0.261371394118 37 52 0 8 0.304443703748 37 59 0 8 0.309148383432 38 48 0 8 0.291699803774 38 52 0 8 0.554828174705 38 53 0 8 0.267665460432 38 54 0 8 0.265248673782 38 56 0 8 0.480962182406 38 59 0 8 0.338658259858 38 60 0 8 0.401302469965 38 70 0 8 0.286607832224 41 50 0 8 0.432590282696 41 52 0 8 0.527591650807 41 53 0 8 0.362569747945 41 54 0 8 0.300786461146 41 56 0 8 0.461035399243 41 60 0 8 0.338615275025 41 68 0 8 0.257341547614 41 76 0 8 0.339211689585 42 52 0 8 0.259434218147 42 53 0 8 0.426406379783 42 56 0 8 0.570329820267 48 64 0 8 0.258395202185 48 68 0 8 0.255439179003 48 70 0 8 0.257402379168 50 64 0 8 0.301935396178 53 64 0 8 0.282278387054 53 66 0 8 0.362506920548 53 67 0 8 0.603800520189 53 69 0 8 0.256585870069 53 70 0 8 0.280584347458 53 79 0 8 0.269900186782 56 66 0 8 0.372418532794 56 67 0 8 0.255114527177 56 68 0 8 0.26538757792 56 70 0 8 0.392967031892 56 76 0 8 0.272950653465 56 79 0 8 0.257445319089 60 70 0 8 0.259576700611 66 79 0 8 0.260187293272 67 79 0 8 0.282351327609 68 79 0 8 0.26194197458 70 79 0 8 0.260953705798 END