(c) 1992-2000 Regents of the University of California, Santa Cruz
Sequence Alignment and Modeling Software System
http://www.soe.ucsc.edu/research/compbio/sam.html

Citations (SAM, SAM-T99, HMMs)

Sequence numbers correspond to the following labels:

    • T0310 PYCS, Homo sapiens, 425 res
    • gi|91207493|sp|Q31IE5|PROA_THICR_7:416 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207480|sp|Q4K5F9|PROA_PSEF5_9:419 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|49529761|emb|CAG67473.1|_9:420 gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Acinetobacter sp. ADP1]
    • gi|50083785|ref|YP_045295.1| gamma-glutamyl phosphate reductase [Acinetobacter sp. ADP1]
    • gi|52000791|sp|Q6FEN5|PROA_ACIAD Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207459|sp|Q39JM2|PROA_BURS3_7:419 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207494|sp|Q3SG61|PROA_THIDA_7:423 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207492|sp|Q47MW1|PROA_THEFY_8:417 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|29726869|pdb|1O20|A_17:426 Chain A, Crystal Structure Of Gamma-Glutamyl Phosphate Reductase (Tm0293) From Thermotoga Maritima At 2.00 A Resolution [Taxonomy]
    • gi|76654528|ref|XP_877689.1|_368:799 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 4 [Bos taurus]
    • gi|14549164|sp|O67166|PROA_AQUAE_4:426 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|76654530|ref|XP_592664.2|_59:489 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 1 [Bos taurus]
    • gi|76654532|ref|XP_877893.1|_252:682 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 5 [Bos taurus]
    • gi|86821039|gb|AAI05338.1|_363:793 Similar to pyrroline-5-carboxylate synthetase isoform 1 [Bos taurus]
    • gi|76654534|ref|XP_869446.1|_361:791 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 2 isoform 2 [Bos taurus]
    • gi|17429763|emb|CAD16448.1|_13:424 probable gamma-glutamyl phosphate reductase (gpr) (glutamate-5-semialdehyde dehydrogenase) (glutamyl-gamma-semialdehyde dehydrogenase) (gsa dehydrogenase). oxidoreductase protein [Ralstonia solanacearum]
    • gi|17547460|ref|NP_520862.1| gamma-glutamyl phosphate reductase [Ralstonia solanacearum GMI1000]
    • gi|21362760|sp|Q8XVT6|PROA_RALSO Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207483|sp|Q4FUZ5|PROA_PSYAR_10:427 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|38258947|sp|Q8YJ78|PROA_BRUME_10:420 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|3514028|gb|AAC72811.1|_8:416 gamma-glutamyl phosphate reductase [Meiothermus ruber]
    • gi|6225875|sp|O86053|PROA_MEIRU Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207456|sp|Q3MH53|PROA_ANAVT_11:429 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|14548209|sp|Q9KPT9|PROA_VIBCH_5:407 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|52001484|sp|Q8UBS1|PROA_AGRT5_18:426 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|91207474|sp|Q3SVI0|PROA_NITWN_15:425 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|68427250|ref|XP_706852.1|_343:776 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 3 [Danio rerio]
    • gi|68427260|ref|XP_706856.1|_341:773 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 2 isoform 7 [Danio rerio]
    • gi|73921808|sp|Q5GZF2|PROA_XANOR_6:412 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|55634225|ref|XP_507942.1|_330:793 PREDICTED: similar to pyrroline-5-carboxylate synthetase; Pyrroline-5-carboxlate synthetase; pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase) [Pan troglodytes]
    • gi|68427253|ref|XP_706853.1|_348:780 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 4 [Danio rerio]
    • gi|68427257|ref|XP_706855.1|_340:772 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 2 isoform 6 [Danio rerio]
    • gi|14548211|sp|Q9PEM3|PROA_XYLFA_5:413 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|68427255|ref|XP_706854.1|_343:773 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 5 [Danio rerio]
    • gi|68427248|ref|XP_706851.1|_343:777 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 2 [Danio rerio]
    • gi|68427246|ref|XP_683085.1|_343:782 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 1 [Danio rerio]
    • gi|39931990|sp|Q8G5H9|PROA_BIFLO_16:429 Gamma-glutamyl phosphate reductase (GPR) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase) [Taxonomy]
    • gi|52696232|pdb|1VLU|B_18:452 Chain B, Crystal Structure Of Gamma-Glutamyl Phosphate Reductase (Yor323c) From Saccharomyces Cerevisiae At 2.40 A Resolution [Taxonomy]
    • gi|52696231|pdb|1VLU|A Chain A, Crystal Structure Of Gamma-Glutamyl Phosphate Reductase (Yor323c) From Saccharomyces Cerevisiae At 2.40 A Resolution [Taxonomy]
    • gi|6680676|ref|NP_031462.1|_6:432 aldehyde dehydrogenase family 3, subfamily A1 [Mus musculus]
    • gi|1352251|sp|P47739|AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring (ALDH class 3) (Dioxin-inducible aldehyde dehydrogenase 3) [Taxonomy]
    • gi|529696|gb|AAA20670.1| cytosolic dioxin inducible aldehyde dehydrogenase-3 [Taxonomy]
    • gi|2392057|pdb|1AD3|B_5:431 Chain B, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide-Adenine-Dinucleotide [Taxonomy]
    • gi|2392056|pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide-Adenine-Dinucleotide [Taxonomy]
    • gi|76644087|ref|XP_591738.2|_3:432 PREDICTED: similar to Fatty aldehyde dehydrogenase (Aldehyde dehydrogenase, microsomal) (Aldehyde dehydrogenase family 3 member A2) isoform 1 [Bos taurus]
    • gi|76644089|ref|XP_872052.1|_3:432 PREDICTED: similar to aldehyde dehydrogenase 3A2 isoform 1 isoform 2 [Bos taurus]
    • gi|68387630|ref|XP_693896.1|_5:429 PREDICTED: similar to aldehyde dehydrogenase family 3, subfamily A2 [Danio rerio]
    • gi|76626113|ref|XP_591231.2|_46:322 PREDICTED: similar to aldehyde dehydrogenase 8 family, member A1 [Bos taurus]
    • gi|76654526|ref|XP_877598.1|_363:421 PREDICTED: similar to pyrroline-5-carboxylate synthetase isoform 1 isoform 3 [Bos taurus]
              10               20        30          40        50      
              |                |         |           |         |      
   1 TVEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
   2 -VLNLAKKAKEAS..K..K..L.AQLSTEQKNRALLKIAQYLE..ENMEKILTENQKDLA.EA..
   3 -MTELGQQARAAS..R..E..V.ARSSTAVRNQALLATAAALD..AARSELATANSKDLE.RG..
   4 -VQTKGQRAREAA..R..I..L.AGLGTSKKNEALLAMARALE..EEQEAILAANARDMV.AG..
   5 -MSRLGRDARAAS..R..L..L.ARAATAQKNRALLAAADALD..AARAELSHANEQDLA.AG..
   6 -MSRLGRDARAAS..R..L..L.ARAATAQKNRALLAAADALD..AARAELSHANEQDLA.AG..
   7 -MQKLGQQAREAS..R..Q..L.MVATTRQKNTALLNIATALE..EQAETLKTENAKDLE.QG..
   8 -MQQLGQAARKAS..R..L..L.ARADTNQKNAALHAIADAIV..REQEALLAANRQDLD.AA..
   9 -MQKLGQQAREAS..R..Q..L.MVATTRQKNTALLNIATALE..EQAETLKTENAKDLE.QG..
  10 -MQNLGCRARKVS..R..V..L.ARAGAEEKNQALEMAASFIE..KESQALVEANHKDLA.AG..
  11 -----ARKASKAS..R..K..L.SGIATDVKNKALAAIAEKLV..QAKDEIIRANNIDME.RG..
  12 -MSRLGRDARAAS..R..L..L.ARAATAQKNRALLAAADALD..AARAELSHANEQDLA.AG..
  13 -MTRLGHAAREAS..R..V..L.ARTSTAQKNRALEAAAAALD..DAREALAAANAQDLA.AG..
  14 ---NIAADARQAA..I..A..M.AKLSASAKNELLLAMAGSLV..RNTVQLIEENRKDLE.AG..
  15 --AQIAHEARQAS..F..V..L.SRLSTRVKNELLLAMAEALE..QQAPHLIAENAKDLE.EG..
  16 -MTRLGRAARQAS..R..V..I.ARATTAQKNRALLAAADALD..AARPELTAANEQDLA.NG..
  17 ----KGKQAKDAA..Y..K..L.ASISSQIKDKALEAMAYALV..AQEEEILAANALDVE.AG..
  18 -MTRLGRAARQAS..R..V..I.ARATTAQKNRALLAAADALD..AARPELTAANEQDLA.NG..
  19 ----KGKKAKEAS..Y..T..L.SFASTNEKDNGLLKISEFLI..KRCDEILEENKKDLE.KA..
  20 ---NKGKKAKEAS..R..F..L.SSVDSNFKNKALHKMGEDLK..ANMNKIIAANKIDME.KG..
  21 -MQTLGSQARDAS..R..I..I.AAADTALKNTALLAIADALS..DGRDKLLAANAVDMQ.NG..
  22 -VDGLARRAREVG..R..I..L.SRAETAAKNRALLAIAAALE..ESADALIEENRKDLE.AG..
  23 EMRQVAEGAREAS..R..T..L.SRMPTEIKDRALKEMAERLL..QQAGWLMQENEKDVA.FA..
  24 -LEQMGIAAKAAS..Y..K..L.ALLSSGEKNRVLEKIADELE..AQMESILSANVQDVE.QA..
  25 -VEVKAKQAKAAA..R..R..M.AVLDENTKNLALNHMADALI..KDIGKILEANKKDVV.EA..
  26 -LEQMGIAAKAAS..Y..K..L.ALLSSGEKNRVLEKIADELE..AQMESILSANVQDVE.QA..
  27 ----KGQNAKNAS..Y..D..L.GIASTKQKDDALMIMAEELI..KAKGDIISANKIDLD.AA..
  28 -LEQMGIAAKAAS..Y..K..L.ALLSSGEKNRVLEKIADELE..AQMESILSANVQDVE.QA..
  29 -MLTLGKQARAAS..R..Q..M.ASADTGKKNAALLAIADAIN..SARDTIAAENARDME.AG..
  30 -MREVGSEARSAS..R..L..I.AKADTGVKNKALIATAEAID..AAREELMAANAKDLE.SG..
  31 -IKQLAKEARDAS..R..T..L.AQVSTTVKNDLLKGMADALV..AATTALMAENAKDLE.AG..
  32 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQAAADALD..AARAELAAANELDLA.AG..
  33 -MIQVGQQARAAS..R..K..L.ARASTQDKNAALNAMANALD..LARPQLLAENAKDLE.NG..
  34 -MQAVGQQARKAS..R..V..L.SSASTHTKNNALSAIYTALV..NHEPEILAANAVDMQ.KG..
  35 --SEMAFQVKEAS..I..R..L.AAAGTELKNKALENIARLLM..ERKDEIIKANNEDLQ.RS..
  36 DMNELARRVKEAS..I..V..L.ASAGTELKNRALAQIARSLQ..DGREEIIRANREDLL.RS..
  37 -MQTLGRQARAAS..R..V..L.ATASTADKNAALVAMAAAIR..EQTGELLAANARDLD.EA..
  38 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQAAADALD..AARAELTAANELDLA.AG..
  39 -LKQLGQQAKEAS..Y..T..L.GLMDTRQKNTLLNKMAAAIE..ANAPRILQANALDLE.QA..
  40 -MQALGRAARAAA..R..I..V.AKADTAVKNHALIAMARAIR..CHEASLLAANAADVA.QA..
  41 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQAAAAALD..AARDALTAANEQDLA.NG..
  42 -MRALGERARDAS..R..M..L.ARATTAQKNRALHAMAEALD..AARETLETANRRDLE.AG..
  43 -VEVKAKKAKEAS..R..K..M.AVLDTETKNRALINMAEALL..ENADKILKANEKDVL.EA..
  44 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQATAAALD..EARDELSAANALDLA.YG..
  45 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALLAAANALD..AARAELAAANEQDLA.TG..
  46 -MHSIGREARAAS..R..L..I.AKAETAAKNRALTQMAVAIK..RDEQQLLAANARDVE.NA..
  47 --INIAKNSKLAA..K..K..L.SYADTNTKNKALIEMSKALL..ENKDYILSQNKIDIE.NA..
  48 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  49 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQATAAALD..EARAELSAANALDLA.NG..
  50 -LEQMGKAAREAA..W..Q..L.AQLSTKQKNQALIRIADLLE..QESAIILEANQLDMI.QA..
  51 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSESILNANAQDVA.DA..
  52 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  53 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSESILNANAQDVA.DA..
  54 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  55 -VRKVAERARDAA..A..D..L.APLSRDAKDEALTAVADALR..ERTEEIVAANAKDVA.QA..
  56 ------ASARAAS..A..E..I.ARSDTATKNRALLATAEAIQ..AMQSELSEANQRDLV.AG..
  57 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSESILNANAQDVA.DA..
  58 -LEQMGIAAKQAS..Y..K..L.VQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  59 --IQKAQKVKEAS..K..K..L.MNLSESQKNLALSCISKKIL..DNMEYILVENKKDME.NA..
  60 -MTDLGRRARQAS..R..A..M.ARASTAAKNAALAAVAEAIE..RDAASLKEANARDVA.KA..
  61 -LEQMGIAAKAAS..Y..K..L.ALLSSCEKNRVLEKIADELE..AQMESILSANVQDVE.QA..
  62 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  63 -MQSVGEQARTAS..R..A..M.MRATGAAKNQALLAMAEAIL..AQRAELQAANAKDVA.AA..
  64 -LMQLGQQAKDSA..Q..Q..L.ALMPTNRKNELLVQMAQTIK..KNQQAIIEANHKDLE.KA..
  65 -MKQLALEAKQAA..T..T..M.AELSSAVKNDLLCRMAAALE..SKTSQLQQENEKDLQ.AA..
  66 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  67 ---EQGKKAKAAS..R..F..L.ATASTTLKNEALLKTADALE..AQGAEIVAANAIDLE.LG..
  68 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  69 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
  70 -MTRLGRAAREAS..R..V..I.GRASTAQKNRALQATAAALD..EARAELSAANALDLA.NG..
  71 -MTDLGRRARHAS..R..A..M.ARASTAAKNAALDAVARAIE..RDAQVLKDANARDVA.RA..
  72 -MQSVGEQTRTAS..R..A..M.MRATGAAKNQALLAMAEAIL..AQRAELQAANAKDVA.AA..
  73 --LEKAKKVREAW..D..V..L.RNATTREKNKAIKKIAEKLD..ERRKEILEANRIDVE.KA..
  74 -MTDLGRRARHAS..R..A..M.ARASTAAKNAALDAVARAIE..RDAQALKDANARDVA.RA..
  75 -MTDLGRRARHAS..R..A..M.ARASTAAKNAALDAVARAIE..RDAQVLKDANARDVA.RA..
  76 -MTDLGRRARHAS..R..A..M.ARASTAAKNAALDAVARAIE..RDAQALKDANARDVA.RA..
  77 -MQQLGSEARTAS..R..A..M.ARADTETKNKALRAIATAIR..RERDTLLAANAADLE.AA..
  78 -MTDLGRRARHAS..R..A..M.ARASTAAKNAALDAVARAIE..RDASALKEANARDVA.RA..
  79 -LEQMGKAAKQAS..W..Q..L.AVLSTAKKNQVLSVMADRLE..ANSEAILLANEQDMA.QA..
  80 -MQTLGRQAREAS..R..A..I.ARADTEQKNRALLTMAAAIR..RDAARLLAANAQDME.HA..
  81 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKALV..DDTQTLLAANQKDLA.NA..
  82 -MQSVGEQARTAS..R..A..M.MRATGAAKNQALLAMAEAIL..AQRAELQAANAKDVA.AA..
  83 -VRKVAERARDAA..A..D..L.APLSRDAKDEALTAVADALR..ERTEEIVAANAKDVA.QA..
  84 -MQTLGRQAREAA..R..E..M.ARADTGHKNAALHAMADALE..EHAGDLKRANADDLE.NG..
  85 --LEKAKKVREAW..D..V..L.RNATTREKNKAIKKIAEKLD..ERRKEILEANRIDVE.KA..
  86 -VRVMAQAAQAAA..R..G..L.VASTTDARNQALLGAAALLD..DRRRELREANALDMQ.RA..
  87 -MQNVGKEARAAS..R..A..L.AAANTGDKNAALMAIHDVLK..NAKQDILAANTVDMD.NG..
  88 -MQTLGRQAREAS..R..A..I.ARADTEQKNRALLTMAAAIR..RDAARLLAANAQDME.HA..
  89 --RTIAADARQAA..I..A..M.AKLPTTAKNDLLMAMAMALI..SNTPHLIDENRKDLE.AG..
  90 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
  91 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKALV..DDTQTLLAANQKDLA.NA..
  92 -IEEKVNRARSVL..R..E..L.TSLKTSVKNETLLKVAELID..KNRDYIKEENRKDVE.KA..
  93 -IEEKVNRARSVL..R..E..L.TSLKTSVKNETLLKVAELID..KNRDYIKEENRKDVE.KA..
  94 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKALV..DDTQTLLAANQKDLA.NA..
  95 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKVLV..DDTQTLLAANQKDLA.NA..
  96 -MDRLGSAARSAS..T..A..M.AAASTAAKNAALLALAREIR..AGAARLAAENARDLD.VA..
  97 -IDEIGKKARKAA..R..Q..L.AWLDSGSKNATLHAMADALI..ACKKILQVENEKDLE.AG..
  98 -MQGIGRAAQAAA..R..I..L.ARASSAQRNTALLAVAEQLQ..SERQRLKEANECDQE.VG..
  99 -IRRIGQQARAAG..R..A..L.ARSGTGARNDALAAIAARIE..AGSEAIAAANAADLE.AA..
 100 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKALV..DDTQTLLAANQKDLA.NA..
 101 -MTDVGRRARRAS..R..S..I.ARASTAAKNAALEAVARAIE..RDAGALKAANARDVA.RA..
 102 -----GREARTAS..H..T..M.AKVDSSSKNKALTEIAASIK..KNEKNLLSANKDDLE.AA..
 103 DMRRLGQRAKQAS..L..L..I.APLSTQIKNRFLSTLAKALV..DDTQTLLAANQKDLA.NA..
 104 ------RDAKSAS..R..R..I.ATASTALKNTALDYIAEGIN..SSADFILTENKKDVL.AA..
 105 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHRLADLLT..DQRDEILLANKKDLE.EA..
 106 -MDRVGRQARAAS..R..A..M.ARASTADKNRALLTIAAAIR..RDADKLKAVNARDVE.RA..
 107 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 108 -IEEKARLARAAS..R..P..L.SYASSAQKDAALKNIARCLL..DNEPAILEANLKDQN.EA..
 109 -MIELGENARDAA..R..L..V.AKADTNLKNQALLAMADAID..NSRPALREANAIDLE.NG..
 110 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 111 -VEQQGDMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDME.EA..
 112 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 113 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 114 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 115 --KNLAKKAKIAA..R..T..L.SVLDTEAKNSALEAIASQLL..ADKETILQANGKDLD.NG..
 116 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 117 -LNKMGQAAREAS..R..Q..L.ALLGEQKKNQVLETVAQELL..AKADEIIAANKVDLE.NA..
 118 -MTDVGRRARRAS..R..E..I.ARASTAAKNAALEAVARAIG..RDADALKAANARDVA.RA..
 119 -LQQLGANAKQAS..Y..A..L.ANLTASQKADLLEAIADALT..ENSPAILAANAKDVA.AA..
 120 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 121 -MQSVGDAAKQAS..S..H..I.AKANSGTKNTALLAIAEAIH..EHREALASANAKDMA.KG..
 122 -LEQMGKAAKQAS..W..Q..L.AMLSTAKKNQALAVIANLLE..SESQTILHANAQDMQ.AA..
 123 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 124 ----VGRQARTAS..R..G..M.ARAGTAQKNRALLHIAAAIR..RDAARLKEINARDVE.RA..
 125 -LQQLGANAKQAS..Y..A..L.ANLTASQKADLLEAIADALT..ENSPAILAANAKDVA.AA..
 126 -LQQLGSQAKQAS..Y..A..L.ANLSAAQKADLLEAIAEALT..QNTQAILAANAKDVA.AA..
 127 -MQQVGKHARDAS..R..Q..L.AAANTGDKNAALLIIYEQLK..QAKDEILAANKIDMD.KG..
 128 -IEILGQNAKKAS..Q..S..V.ARLSTASKNEILRDLARNIV..ADTETILTENARDVA.KA..
 129 -MQALGRAACAAA..R..I..V.AKADTATKNHALAMMARAIR..RDEALLLAANAKDVA.QA..
 130 -MTDVGRRARRAS..R..E..I.ARASTAAKNAALEAVARAIG..RDADALKAANARDVA.RA..
 131 -LEQMGKAAKQAS..W..Q..L.AMLSTAKKNQALAVMANLLE..SESQTILQANEQDMK.AA..
 132 -MTRVGQQARAAS..R..A..M.ARASTADKNRALLTIAAAIR..RDADKLKAVNARDVE.RA..
 133 -LEQMGKAAKQAS..W..Q..L.AMLSTAKKNQALAVIANLLE..SESQAILQANEQDMK.AA..
 134 -IDTLGQQAKVAS..R..Q..I.AKLSTAAKNDLLNQVAKALV..AESDYIITENAKDMA.NA..
 135 -LQQLGSQAKQAS..Y..A..L.ANLSAAQKADLLEAIAEALT..QNIQAILAANAKDVA.AA..
 136 -MTDVGRRARRAS..R..E..I.ARASTAAKNAALEAVARAIG..RDADALKAANARDVA.RA..
 137 -IEEKARLARAAS..R..P..L.SYASSAQKDAALKNIARCLL..DNGPAILEANLKDQN.EA..
 138 -LEQMGKAAKQAS..W..Q..L.ALLSTAKKNQALAVIANLLE..SESQAILQANEQDMK.AA..
 139 -IEILGQNAKKAS..Q..S..V.ARLSTASKNEILRDLARNIV..ADTETILTENARDVV.KA..
 140 -VDTLGQQAKVAS..R..Q..I.AKLSTAAKNDLLNQVAKALV..AESDYIITENAKDIA.NA..
 141 -VDTLGQQAKVAS..R..Q..I.AKLSTAAKNDLLNQVAKALV..AESDYIFTENAKDMA.NA..
 142 -LQQLGSQAKQAS..Y..A..L.ANLSAVQKADLLEAIAEALT..QNTQAILAANAKDVA.AA..
 143 ---QIAKRAADAA..H..A..V.ATLSEQEKNAVLQKMANAIR..AHKDEILKVNETDMK.TG..
 144 -IEEKARLAKAAS..R..P..L.SYASSAQKDAALKNIAACLL..NNAPAILEANLKDQT.EA..
 145 ---KKGSAAKEAA..Q..F..L.AQASTKQKNAALLNLSNDLL..THTASLLEENNKDII.RA..
 146 -LEQMGKAAKAAS..W..Q..L.AVLTSAQKDSALQVIADSLE..ANSQSILDANAQDMA.EA..
 147 -LEQMGKAAKAAS..Y..Q..L.AVLNTAQKDRALLTIADLLE..VESATILAANVLDLA.DA..
 148 --QEMGKQAKQAA..F..V..L.AQLSQQQKNQALEIIAQQLE..AQSDKILAENQKDIA.LA..
 149 -LQQLGNNAKQAS..Y..A..L.ANLTASQKAGLLEAIADALT..ENAAAILAANAKDVA.AA..
 150 --HTVGRQARAAS..R..R..L.AGATTAEKNAALLAIAAAIR..RESAALVAANQEDLT.AA..
 151 ---KKGSAAKEAS..Q..F..L.AQASTKQKNAALLNLSNDLL..AHTASLLQENNKDII.RA..
 152 ---KKGSAAKEAA..Q..F..L.AQASTKQKNAALLNLSNDLL..THTASLLEENNKDII.RA..
 153 -MQNVGKEARAAS..R..A..L.AAANTGDKNAALMAIHDVLK..NAKQDILSANKIDMD.NG..
 154 --EHMGKAAKQAS..W..Q..L.AMLSTAKKNQALAVIANLLE..SESQTILQANERDMA.AA..
 155 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 156 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 157 ----VGRQARAAS..R..G..M.ARAGTAQKNRALLHLAAAIR..RDAARLKDVNARDVE.RA..
 158 -MQNVGKEARAAS..R..A..L.AAANTGDKNAALMAIHDVLK..NAKQDILSANKIDMD.NG..
 159 -------RAKEAS..A..A..L.ALVSGAQKNGWLRESAKQLR..AAEKAIIAANAIDLA.AA..
 160 -VLAKGKKAKEIA..R..E..L.VLKSTEQKNEALSAIADQLI..LETAYILEENKKDIE.EG..
 161 ----IARRAKAAS..R..L..L.GTLDTNIKDQWLIESADALI..EASDAIIAANQLDLE.NA..
 162 -MQALGRSARDAA..R..A..L.AIAPAAQKTAALMAAADAVW..ARREEIIEANGKDMA.YG..
 163 -----AKAARAAS..R..T..M.GTLSAEKRVEALEAIARHLE..AAKDDILSENKKDLD.AA..
 164 ---QAAYRAKAAA..A..D..L.APLPRAEKDDALLAIADALE..VRTSEIVAANAKDVE.RA..
 165 -VLAKGKRAKEVA..R..E..L.VLKSTHQKNEALAAVANQLI..HETAYILEENKRDIE.EG..
 166 --EHMGKAAKQAS..W..Q..L.AMLSTAKKNQALAVIANLLE..SESQTILQANERDMA.AA..
 167 ----ISQRAAKAA..R..A..V.ATLSETDKNAVLQKMADAIR..ARQDKIIEVNKKDLA.TG..
 168 -MTELGKRARAAA..A..Q..L.AFASAEAKRAALIGAADAVW..ARRGEIIAANARDLE.FG..
 169 -LEQMGRAAKTAA..M..T..L.GQLTTLQKNTGLLAMAAALE..THADTILAANKADLA.AA..
 170 -VLAKGKKAKEIA..R..E..L.VLKSTEQKNEALSAIADQLI..LETAYILEENKKDIE.EG..
 171 -MQELGRKAKAAA..A..E..L.AFAPSDAKRKALDAAADAMW..ARRDEIIAANAKDLE.YG..
 172 --KSLAVATRAAS..R..Q..V.ANLSTTVKNRLLLAMAEALR..AKKEYIQAENEKDLA.AG..
 173 -MQRMGSGAKVAS..A..H..M.ARASAAVKNWALSKLATLLR..QNVKALDNANQRDLA.RA..
 174 -IEELGLKVKTAS..K..E..A.AKLSTAEKNTFLQKLADSLV..ENTDRIISENAKDLA.KA..
 175 -LEQLGQQAQQAS..Y..T..L.GLLSTAQKNQVLTAMATALT..SHQDEILAANAQDLE.NP..
 176 -------------..-..-..-.--ASTAAKNAALEAVAHAIE..RDAHALKDANARDVA.RA..
 177 -MQTLGLQAKTAS..A..Q..V.ARAPAAIKNRALKNLAALLR..QNLGSLQAANQRDLE.RA..
 178 ---EVGVRAKAAA..A..D..L.MSLATRQKDAVLSQVGELLV..AEKAFLQEENEKDLA.AG..
 179 -------------..-..-..-.--ASTAAKNAALDAVARAIE..RDAQALKDANARDVA.RA..
 180 -IEILGQNAKKAS..Q..S..V.ARLSTASKNEILRDLARNIV..ADTETILTENARDVA.KA..
 181 -LIQMGKQAKQAA..F..A..L.SQLSQQEKNHALALIAERLE..AQQERILAENAKDIQ.AA..
 182 --ADIGRRARAAA..R..P..L.AIAPTAAKNAALLAMADAIV..ARQQDILDANAIDVS.NG..
 183 -LQQLGHNAKQAS..Y..A..L.ANLTASQKADLLDAIADALT..ENTLAILAANAKDVA.AA..
 184 -LEQMGKQAKDAA..F..I..L.AQLTTAEKNRALSIIAEQLE..QQAPLILAENAKDIE.LA..
 185 -LEQMGKQAKDAA..F..I..L.AQLTTAEKNRALSIIAEQLE..QQAPLILAENAKDIE.LA..
 186 ---AMGDAARTAQ..S..Q..L.AQANTEAKNQLLNAIADALD..QHADDIAAANTLDMN.KA..
 187 -----AQRAQRST..M..A..L.AQVPSGIKNKALRAMARSLR..TAHSEILESNTTDLE.FG..
 188 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 189 -----CKVLQNAS..K..Q..L.SSMNTKDKNEALRQVAISLQ..KNESFIIQENQKDVE.NA..
 190 -MSDMGRRARAAS..R..T..L.ALTPPEAKTQALHAAAAAIR..AAADEILAANAGDVA.KA..
 191 --DALAADCKAAA..R..E..L.STLSTETKNRTLRRMADALE..ADEEAILAANGKDVS.AA..
 192 -VLAKGKRAKEVA..R..E..L.VLKSTNQKNEALAMVANQLI..SETAYILEENKRDIE.EG..
 193 ---TIGQKAKDAA..R..K..L.AYAGTAAKNKALLAMAEALL..NHEQKILEANRKDVE.AA..
 194 -MEDIGKRAKAAA..Q..Q..L.ATASAAQKEQALNAAADAVW..AQRGEIIAANAKDLE.FG..
 195 -IEEKAIKAKTAA..K..S..L.RLATEKEKNEALAALADHLK..QNMSYILTENAKDIE.AG..
 196 --DNLGQNAKKAS..F..L..L.AQLGTEAKNTALLKVAEALL..AELPYILEENAKDVA.LA..
 197 --TDLGQRARKAA..R..I..L.ALTPSAAKDKALRAAAQAIR..IDTKLILAANAKDME.AG..
 198 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 199 -LEQMGKQAKDAA..F..I..L.AQLTTAEKNCALSIIAEQLE..QQAPLILAENAKDIE.LA..
 200 --VAKGKKAKEIA..R..E..L.VLKSTNQKNEALAAIADQMI..VETAYILEENKRDIE.EG..
 201 --IAIGKRAQNAA..N..K..L.ALMNTATKNKALLQLADDLI..KNKNQIIAANQQDLA.AA..
 202 --AEVGRKAKAAA..A..P..L.SIATSEQKNKALNAAADAIL..EARADILEANRLDLA.NA..
 203 --TELGERARAAS..R..I..L.ALTPSAAKDKALRAAAQAIR..IDAKLILAANAQDME.AG..
 204 -MQQIGARARAAA..A..E..L.AFAEPEAKRQALLAAADAVL..VRQEEILAANAEDLA.FG..
 205 -LEQMGKQAKDAA..F..I..L.AQLTTAEKNCALSIIAEQLQ..QQAPLILAENAKDIE.LA..
 206 --AEVGRKAKAAA..A..P..L.SIATSEQKNKALNAAADAIL..EARADILEANRLDLA.NA..
 207 --AEIGARAKNAS..A..E..L.AFASPEAKFTALTAAADAVW..ARRADIIAANEKDMA.FG..
 208 -LEQLAQDAQIAS..Y..Q..L.ATLSSRSKNQALKAIINQLV..QHQSAILAANQLDIA.AG..
 209 -----AVRAKAAA..A..L..L.APRSRAEKDRALLAMADALI..ARSAEILAANAEDLA.AA..
 210 --AEVGRKAKAAA..A..P..L.SIATNEQKNKALNAAADAIL..EARADILEANRLDLA.NA..
 211 -MREIGVRARAAA..A..E..L.AFAEPSRKEEALNAAAEAML..ARSDEILEANGRDLA.FG..
 212 -VIEKAKKAKVAK..E..E..L.VHQPTERKNEALSFIAEAIR..FKQDEILAENEKDIV.RG..
 213 --AEVGRKAKAAA..A..P..L.SIATNEQKNKALNAAADAIL..EARADILEANRLDLA.NA..
 214 ---DLASKAREAS..R..R..L.ALLSRADKDEALRALADALD..AATEQIVAANAEDVD.RG..
 215 ---DLGQKARAAA..A..V..L.AEASAERKHAALIGAADAIL..EAEDAILDANAEDMH.YA..
 216 --KAYAQAARAAA..R..A..L.STASPRAKNTALLAIAAKLE..AQQEALFAANREDLE.AA..
 217 -MREIGVRARAAA..A..E..L.AFAEPSRKEEALNAAAEAML..ARSDEILEANGRDLA.FG..
 218 -LEQMGIAAKQAS..Y..K..L.AQLSSREKNRVLEKIADELE..AQSEIILNANAQDVA.DA..
 219 --ADIGARAKAAA..A..T..L.GFASADQKQTALEKAADALM..ASSADILDANAKDLE.FG..
 220 -VHDAARRARVAS..R..V..L.ALLPAVAKDQALRSAADAIA..GHAELILSANAEDLE.TA..
 221 ---TLAQQAKIAS..I..E..L.AQFGNVQKNHALLTIAEQLE..QRSAEILAANAKDIE.FA..
 222 -IEDMGRRARAAG..R..R..L.AAASPAAKAGALDHLATLLE..QRQDAILAANAADLA.AA..
 223 ---TLGKAAKDAA..F..Q..L.ATASTAQKNKALAIIADELE..ANAADILAANSKDIE.LG..
 224 --IDIGRRARAAG..R..I..L.ALAPAAARNAALLAGAAALR..AEAGAIALENAKDMS.AG..
 225 ---TIGKRAQIAA..N..K..L.ALMNTATKNKALLQLADDLI..KNKNQIIAANQQDLA.AA..
 226 --ADIGARAKAAA..A..T..L.GFASADQKQTALEKAADALM..ASSADILDANAKDLA.FG..
 227 -MLEIGRRAKAAA..R..P..L.ATASAERKHAALVAMAGVIV..TRTAEILAANALDLE.NA..
 228 ---TIGQKAKDAA..R..K..L.AYAGTAAKNKALLAMAEALL..NHEQKILEANRKDVE.AA..
 229 ---TLGKAAKDAA..F..Q..L.ATASTAQKNKALAIIADELE..ANAADILAANSKDIE.LG..
 230 ----IAQKTRKAA..S..K..L.AILSTEAKNQAIIAIAQALE..SAKDEILQANIADCE.AA..
 231 --NDIAQQTRQAA..S..L..L.AMLSTEAKNQAIAAVAQALE..SAKEEILQANIADCE.AA..
 232 -VEQQAEMARTGG..R..S..L.ATLLPEQRAEIIFHLADLLT..DHREEILSANKKDMD.EA..
 233 --AELGMRAKRAA..Q..I..L.ATASAKRKHAALIGAAEAVW..TRRAEIIAANAKDLE.FG..
 234 ------KAAKDAA..F..E..L.ATASTAQKNQALAIIADELE..ANSAAILAANAKDIE.LG..
 235 ----AAYRAKSAA..A..D..L.APLPRAAKDDALLAVADALE..VRTSEIVEANAQDVA.KA..
 236 ----KGSGAKEAA..Q..F..L.AQATTKHKNAALLNLSNDLL..IHTATLLQENEKDIL.RA..
 237 --NDIAQQTRQAA..S..L..L.AMLSTEAKNQAIAAVAQALE..SAKEEILQANIADCE.AA..
 238 ------HNARQAA..L..H..L.GSLNTAERNQAIAAIADGLT..AAMPEILAANQEDCA.AA..
 239 ---ALGLKAKQAS..A..L..M.ARAPTATKNAALRKLAGLLR..ANVNALQIDNARDIE.RA..
 240 ----KGSGAKEAS..Q..F..L.AQATTKHKNAALLNLSNDLL..IHTATLLQENEKDIL.RA..
 241 -VLQKAALAKEAA..A..E..M.VMKTTAEKNEALQCIADGLR..NERQLILTENQKDIE.AG..
 242 --EHMGKAAQEAA..F..E..L.ATVATAQKNQALAIIADELE..ANKDAILAANAKDIN.AA..
 243 --AELGRRGRAAA..R..P..L.AVASTERKNAALLAMAEALE..ANTGRILAANKTDME.KG..
 244 -VNELGRRAATAA..R..S..L.ASASTERKNTALTAAAQALR..DNCGRLLEANAKDVD.SV..
 245 ---GMAKKARLAS..Q..I..L.AQAPTAQKAEALVLTADAIR..RHSADILAANAQDVA.TA..
 246 -------------..-..-..-.-------KRKALEHMALNIE..GAEAAIREANDKDIR.AA..
 247 --NDIAQQTRQAA..S..L..L.AMLSTEAKNQAIAAVAQALE..SAKEEILQANIDDCE.AA..
 248 ---EIAKTTRQAA..Q..K..S.AVLSTEAKNQAIEAVAQALE..KATPKIITANQLDCR.IA..
 249 ---NLSQQASQAA..R..T..L.LTLKEESKNTILRTMAASLR..EHCAPILAANHLDLN.QA..
 250 --RHLAQQCRDAA..R..I..L.ATLSTDAKRRLLETMATALN..TDAATILAANAADLD.AA..
 251 ----TAEKTSQAA..R..K..L.GGLSTGDRNQAIEAIATALE..NASADIIKANEIDCE.IA..
 252 --TQLGQRAKAAS..F..I..L.ASLTAKQKNVLLATIADHLA..QRKNDILQANAQDII.AA..
 253 -VEQQAEMARTGG..R..N..L.ATLLPEQRAEIIFHLADLLT..DHREEILSANKKDLE.EA..
 254 --EVMGKAARQAA..F..E..L.SQLSAGDKNYALQMIAEQLE..SQQQQILAANARDID.EA..
 255 --LEKAERLKTAS..Q..T..L.AMLSAEEKNEALEQIAQTLD..RERAFILQENEKDMA.QG..
 256 --RHLAQQCRDAA..R..I..L.ATLSTDAKRRLLETMATALN..TDAATILAANAADLD.TA..
 257 ----LSQEAAKAA..L..I..L.AQVDEQLKNTVLLDMARSLR..EKSYEIQSANLIDLH.RA..
 258 ---EAARRARVAS..R..A..L.AQLTTAQKNDALHAAADTLL..AAADTVLAANAEDIA.AA..
 259 -IEQKVMEAKMAS..I..V..L.ASVDTQTKDNALEAMAKALD..ANRNKILEANKADLE.EA..
 260 --TDLGRRARAAA..R..V..L.ALAPPEQKNRALEAMERAIR..AGAAAILDANAEDVA.DA..
 261 --IEKAKQAQQAS..K..Q..L.AILTTEEKNRALKQIADQLL..VERTYLIEENQKDIE.AG..
 262 -MSDLAARARAAA..R..V..L.ALAPPEQKNRALEAMERAIR..SNAAAILAANAEDVA.EA..
 263 --RHLAQQCRDAA..R..I..L.ATLSTDAKRRLLETMATALN..TDAATILAANAADLD.AA..
 264 ---VLGKAAKAAS..F..Q..L.ATASTAQKNQALASMADQLE..AQSASILAANAKDIA.LG..
 265 --EHMGKAAQEAA..F..E..L.ATVATAQKNQALAIIADELE..ANKDAILAANAKDIN.AA..
 266 ---VLGKAAKAAS..F..Q..L.ATASTAQKNQALAIMADQLE..AQSASILAANAKDIA.LG..
 267 ---VLGKAAKAAS..F..Q..L.ATASTAQKNQALASMADQLE..AQSASILAANAKDIA.LG..
 268 ---DLSQAAATAA..Q..T..L.ALLDEKVKNTILVDMARALR..AHSDDIIKANLLDLD.HA..
 269 -VLAKGKKAKEIA..R..E..L.VLKSTEQKNEALSAIADQLI..LETAYILEENKKDIE.EG..
 270 ----LATQARSAA..R..V..L.GLASTAQKDQALDAMARAIR..AAAAAILNANAEDVA.DA..
 271 -VLAKGKKAKEIA..R..E..L.VLKSTEQKNEALSAIADQLI..LETAYILEENKKDIE.EG..
 272 -VHDAARRARVAA..R..R..L.ASLPTTVKDRALHAAADELL..AHRDQILAANAEDLN.AA..
 273 ---TIGAQAKAAS..R..P..L.SIAGTDQKNRALLAMASAIE..ASKEAILAANRKDLA.AA..
 274 ---TIGAQAKAAS..R..P..L.SIAGTDQKNRALLAMASAIE..ASKEAILAANRKDLA.AA..
 275 --ARIGENARAAA..G..T..L.AWTEAERKYAALIGAAEAVW..ARREEILEANREDLA.FG..
 276 -VRSMARQARAAQ..R..Q..L.ELTSPEERNAALEAIARALE..ARAGQIVAANRADLA.AA..
 277 --AQAAKAARIAS..R..Q..V.AKLSATQKETLLKDIAERML..GQTETIIVANEKDLA.AG..
 278 ------QAAQQAA..F..E..L.ATTATAIKNNALAIIADELE..SNKDIILAANKQDID.AA..
 279 --ETLSRDAATAA..Q..T..L.AVLDEQTKNTVLLDMAKSLR..ASTAEILAANQQDLT.RA..
 280 --LEKAKQLRLAS..I..K..T.SQTNNDDRIRALNLMADYLE..KNSKEIIEANIEDYK.KA..
 281 -MKQLGEDACAAA..A..E..L.AFASPQRKHAALIGAAHEVW..KTRDAIIAANEEDMA.YA..
 282 -LEVQAQATRAAA..R..Q..L.AQWSGADRQRLLSAIATTLE..QEAPRILAANQADCE.AA..
 283 -INQMGKKAAAAA..R..A..M.RAASPSAKTSALLSLAQLIR..QENKAITEANARDLA.AA..
 284 ---EKLEAARRAA..P..V..V.AELSTESKNALLLALARTID..ERTEEILAANRADLE.AS..
 285 --GDLAAQAREAA..R..S..L.GLASTAQKNEALDAMARAIR..SNAAAILQANAQDVA.DA..
 286 ------KAAKDAA..F..E..L.ATASTAQKNQALAIIADELE..ANSVAILAANAKDIE.LG..
 287 --GDLAAQAREAA..R..S..L.GLASTAQKNEALDAMARAIR..SNAAAILQANAQDVA.DA..
 288 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 289 --ETLSRDAAQAA..K..T..L.AQVDTQTKNTILLDMARSLR..DNSFEIRSANLIDLA.SA..
 290 --LQLGQAAKSSG..F..A..L.ANLGVMAKNRLLGRVAAELK..SAFDEILAANAKDVA.AA..
 291 -VHDAARRARVAA..R..A..L.AVMPTVAKDHALRAAATAVT..AHTEEILAANAEDLQ.AA..
 292 ---TMGARARRAA..V..T..I.AQASDAQKADALRRAAQAVR..DQAPAIIAANARDMD.NA..
 293 --NTLGEQAKAAS..Y..A..M.ASLTASQKRDLLRAIAAKLT..DKRAQIVAANQQDVA.KA..
 294 -VIEKAKRAKQAS..F..K..M.ALSTTDDKNEALQLISQAII..NHKQEILTANALDIE.EG..
 295 ---DMGQKARHAA..A..L..L.AVMSSEQKNKALEMIALSLE..AQSAEILQANHQDLV.NA..
 296 ---AFLQKAKQAS..R..A..I.ATLLPQRRNEILRAMAGAIR..ESQEMILNVNALDLK.EA..
 297 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 298 -MNDIGRKAKAAA..R..P..L.GFASTEAKNKALNAMADAIM..ANKAHILAENAKDLK.DI..
 299 --AEIGARARAAS..A..E..L.AIADSATKRAALEAAADAVW..TGRAEIMEANARDLA.YG..
 300 ----LALQCRDAA..Q..V..V.SQLSSQAKCALLQAMAAALE..ADAGTILAANARDLE.AA..
 301 ----LALQCRDAA..Q..V..V.SQLSSQAKCALLQAMAAALE..ADAGTILAANARDLE.AA..
 302 -------AGQQAA..F..E..L.ATTSTAVKNNALAIIADELE..SNKDIILAANKQDID.AA..
 303 --TNMGKAAKGAA..F..E..L.ATASTAQKNQALAIIADELE..ANSAAILAANAKDIE.LG..
 304 ----LALQCRDAA..Q..V..V.SQLSSQAKCALLQAMAAALE..ADAGTILAANARDLE.AA..
 305 ----LALQCRDAA..Q..V..V.SQLSAQAKHALLEAMAAALE..TDAAAILAANARDLE.AA..
 306 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 307 --RHLAQQCRDAA..R..R..L.ATLSTDAKRRLLETMATALN..TDAATILAANAADLD.AA..
 308 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 309 -MDAIGKRARAAA..R..R..L.ALAPTDTKNAALLAMADALV..AATDTILAENAADLD.RA..
 310 -IETKVVKAKKAS..I..E..L.SSVSEEVKNRALEAMAESLD..RERKAILEANSKDLE.YAse
 311 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 312 ----QVQLARAAA..Q..H..T.ATLPTAIKNAALEAMATALL..EHQEPILAANRADLE.RAae
 313 ---RVVRNAKSAA..A..H..L.ATSSTAEKDAGLRAIADALR..ENSDRIVKANEVDIA.AG..
 314 --TDLGRQARAAA..R..T..L.ALAPPEQKNRALEAMERAIR..AGADKILAANAEDVA.DA..
 315 --RHLAQQCRDAA..R..R..L.ATLSTDAKRRLLETMATALN..TDAATILAANAADLD.AA..
 316 --SVKAKLAKEAA..A..E..M.IMKTTAEKDEALSLIANGLR..KELDFLLAENAKDIV.NG..
 317 -------SVRRAA..T..Y..L.GQSTDIQRKEALGAIADALS..LCRKEIVSANQQDLK.RS..
 318 ---ACARRAKEAA..V..Q..L.ATLTRRQKDAALHAIADALV..AQTERIVAANAADVS.RA..
 319 -VHDAARRARVAS..R..T..L.ATLSTETKNRALRAAADRVL..MDAHLIIAGNERDLE.KA..
 320 ----LAAEVRQAA..M..A..L.GQSDDNQRRKALMAMANALL..SSSEQIVRANQLDLE.KA..
 321 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 322 -----VKEVHEQA..R..L..L.ATLDAAARNGALEQVACALE..EAREEILAANAADCE.QA..
 323 -IESKVIKAKKAS..I..E..L.ASVSSEVKNRALEAMAEALD..KERKIILEANLKDLE.YAaq
 324 ---DKLEAARSAS..R..T..L.STLTTFQKNAALEAIARDVS..AHASRIVEANERDLQ.RG..
 325 --RASAVRARQAA..G..Q..L.APLSRAAKDAALLGMAAALL..DRSAEILAANALDTA.AA..
 326 ----LALQCRDAA..Q..V..V.SQLSAPAKHALLDAMAAALE..ADAAAILAANARDLE.AA..
 327 -IEELGLKVKKAS..K..E..V.AKLSTADKNVFLQNLADSLI..ENTDRIISENEKDLA.NA..
 328 ----LALQCRDAA..Q..V..L.SQLSADAKQALLLAMANALD..TDATQILQANQRDVD.AA..
 329 ---QISADAAHAA..R..T..L.AQLDESLKNTVLLDMARSLR..EKSYEIQSANLIDVH.RA..
 330 ------ELAERAR..K..R..L.SEIAKGNRDRALLAMADLLE..ARWEEVLRANREDLE.EA..
 331 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 332 --TNMGIAAKDAA..F..H..L.ATASTAQKNKALAIIADELE..ANAATILEANAKDIE.LG..
 333 --TNMGIAAKDAA..F..H..L.ATASTAQKNKALAIIADELQ..ANAATILEANAKDIE.LG..
 334 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 335 --HDAARRARGAA..R..A..L.ASLSTETKNRALCTAADHVL..MNTRTILDANTADLD.AA..
 336 --EKFLQEAKSAS..R..V..L.SLLSGAKKNRVLKEMANALR..VNKADLIDANALDMA.DG..
 337 ---QISADAAHAA..R..T..L.AQLDESLKNTVLLDMARSLR..EKSYEIQSANLIDVH.RA..
 338 --KIMGKKARNAA..L..V..L.AVVSAEQKKHALEMIALSLE..SQADEILCANNQDLI.NA..
 339 ---EKADQVRLAS..I..K..I.SQTENHNRIKALNSMADCLE..KSTKEILEANNEDYT.RA..
 340 -VEQQTEMARSAG..R..T..L.ASLEPEQRSDIICALADLLT..ERKEEILSANKKDME.NA..
 341 --GDLATQARAAA..R..A..L.SLASTAQKNEALDAMERAIR..RNAAAILEANAEDVT.DA..
 342 ----VAESAKEAS..I..S..L.GQSTNKQRCEALTEMANALN..DNADEILKANVQDLE.RS..
 343 -MNDLASRARAAA..R..V..L.ALAPAAQKNRALEAMERLIR..ARVDTIIAANAEDVV.EA..
 344 ----MGRTAREGA..R..A..L.RLATPEQRTAAIQAMAVAIR..EDADAILTANAKDLA.RA..
 345 --HDLGRRARAAA..R..V..L.ALASPEQKNRALEAMERAIR..AGADKILAANAEDVA.DA..
 346 ------QKAKAHA..P..S..L.SQATTAEKNSVLQAMAQQLK..ADADVLLQANQLDIA.NA..
 347 --AEMGARARTAA..K..R..L.AQTPTAEKAAALKAAAGAIR..ARSAAILAANAEDMA.AG..
 348 ------ELAERAR..K..R..L.SEIAKGNRDRALLAMADLLE..ARWEEVLRANREDLE.EA..
 349 ----LALQCRDAA..Q..V..L.SQLSADAKQALLLAMANALD..TDATQILQANQRDVD.AA..
 350 -VREMAVAARDCS..R..R..L.QNLSSEERKKILLDVADALE..ANEDLIRSENEADLA.AA..
 351 ----QVQLARAAA..R..C..T.ATLPTAIKNAALEAMATALL..EHQEAILAANQADLE.QAae
 352 ----QADQAARAQ..E..R..L.AQANTEAKNELLLAIADALD..EHAADIEAANALDML.ES..
 353 -VREMAVAARDCP..R..H..L.QNLSSEERKKILLDVADALE..ANEDLIRSENEADLA.AA..
 354 ----QADQAARAQ..E..R..L.AQANTEAKNELLLAIADALD..EHAADIEAANALDML.ES..
 355 --HDAARRARSAA..R..G..L.ATLSTDTKDRALRTAADHVL..MNTRAILEANEADLD.TA..
 356 ---QISADAAHAA..H..I..L.AQLDESLKNTVLLDMARSLR..EKSYEIQSANLIDVH.RA..
 357 ----LATDVRRAA..T..A..L.GQTDDGQRQQALEAMAAALE..RHAESIVAANQQDLE.QA..
 358 -VEQQTEASRSSG..R..T..L.ASLPPEQRGEIICHLAELLT..GRKEEILAANKIDVD.LA..
 359 --RDMAVAARESS..R..R..L.QAVSSEERKKILLDIADALE..ANEEKILAENEADVA.AA..
 360 ----QADQAARAQ..E..R..L.AQANAEAKNELLLAIADALD..EHAADIEAANALDML.ES..
 361 -MTALGAQARAAA..R..V..L.AIAPTAQKNEALAAMERAIR..AHTPAILQANAEDVA.EA..
 362 ---NLSEDAAKAA..L..T..L.ALLDEHLKNTVLLDMARSIR..EKSYEIQSANLIDLQ.RA..
 363 -MTALGAQARAAA..R..V..L.AIAPTAQKNEALAAMERAIR..AHTPAILQANAEDVA.EA..
 364 ---DMGRKARRAA..T..V..L.AVMSSEQKNKALEMIALSLE..AHSDEILRANHQDLL.NA..
 365 ---DMAVAARESS..R..K..L.QALSSEDRKNILLDIANALE..ANEKIIKAENDLDVA.AA..
 366 -VREMAVAARDCS..R..R..L.QAVSSEERKQILLNIADALQ..SREKEIRIENEADVV.AA..
 367 ----QLALAKAAK..K..S..V.NTADAEEKNRALLAMADSLE..AAAEDILAANRLDLK.AA..
 368 --REMAVAARACS..R..R..L.QALSSQERSKILQDIADALE..ANEKAILAENEADVV.AA..
 369 ---EMAVAARDCS..R..H..L.QNLSSEERKKILLDVADALE..ANEDLIRSENEADVA.AA..
 370 ---EMAVAARDCS..R..H..L.QNLSSEERKKILLDVADALE..ANEDLIRSENEADVA.AA..
 371 ---NLSEDAAKAA..L..T..L.ALLDEHLKNTVLLDMARSIR..EKSYEIQSANLIDLQ.RA..
 372 -------AVRLAA..V..D..L.GMADDGERMQALKAMAEALA..DRSDALVAANREDME.RS..
 373 --REMAVAARDCS..R..H..L.QKLSSEERKKILLDIADALE..ANEDLITSENQADLD.LA..
 374 -------------..-..-..I.NLATTEQKNQALSAMADQLV..AQTEAILAGNAIDME.HA..
 375 ----ISRQAAKAA..H..Q..L.ALLDTETKNKVLLDMAAALR..AEKAFIIKENESDLA.AA..
 376 -MLQLGRQARSAA..R..V..L.AIAPTAQKNLALAAMERAIR..VNAAAILAANAEDVA.EV..
 377 ----LAEHARRAS..R..S..L.ARANAGTRNHALSEAAKALR..VRSDEIVAANQKDLA.A-..
 378 -IQQLGTAARDAA..R..G..L.VSASTEAKNKALMEAARALR..EATPALLEANARDVA.SV..
 379 ----IADRSRHAA..R..S..M.ARANRAWKDKGLRAIGAALL..DSRAQILAANATDVE.AG..
 380 --KSKVIQAKKAS..I..E..L.SSVSTEVKNLALEAMAQALD..KERKAILDANAKDLE.AAae
 381 ---EKADKVRLAS..I..K..I.SQTENQNRIKALNFMADYLE..KNSKEILEANNADYL.SA..
 382 ------QAAKAAA..F..D..L.AVAPTAQKNKALAIIADELE..ANKDAILAANEKDIK.AA..
 383 -------AVRLAA..V..D..L.GQTDDQQRADALQAMADALA..ERAEVIVAANREDLE.RS..
 384 -VEQIAENARNGS..R..V..L.QNLTAAERAQAVNTLADLLI..SRQSQILEANAKDLD.EA..
 385 --------VKSAS..V..S..L.SQCSNDQRQSALILMTEALS..LRSSEILKANSDDVH.RA..
 386 -------AAKRAS..I..A..L.AIASNAEKDAALRGIAEGVL..AAADSILAANAVDLA.TG..
 387 -------AVRRAA..V..D..L.GQTDDGQRALALQAMADALT..ERAATILAANREDLE.RS..
 388 ------AAVRRAA..M..A..L.GQCSDGQRQQALLAMAQSLE..RSAEAIVAANTADLE.AA..
 389 ---AAAERARAAS..H..G..L.ALATRAEKDAALQAMAEALL..TREPEVLAANGEDVA.RA..
 390 ---EMAVAARDCS..R..H..L.QNLSSEERKKILLDVADALE..ANEDLIRSENEADVA.AA..
 391 -LEAIGRRAKTAA..R..A..L.AKLSTEQKNAALCAIADGLL..ARQDKILAANAADVA.DA..
 392 -VEVVAEEARTGS..R..T..L.QALRPEERASCINTLADLLE..SRQKEILEANRKDLE.AA..
 393 -VESMAEDARLGS..R..V..M.QNLSAADRALCVNTLADLLI..SKQSYILEANAKDLD.EA..
 394 -IKELAQKAAKAA..K..V..L.AVLDEKTKNQVLQDMADALR..TNADVIYAANKMDLA.QA..
 395 ---DMAVAARESS..R..R..L.QAMSPQDRSKILLDVADALE..ANEKLIRIENEADLA.AA..
 396 --KEMGKNAKQAA..T..I..L.AQLSQQQKNTALQIIAEQLE..LQSNKILVENAKDIQ.LA..
 397 --EGLARAARSAQ..R..Q..L.ARMDSPVKERALTLAAAALR..AAEAEILAANAQDMA.NG..
 398 -VEVMAENARTGS..R..Q..M.QALTPAQRASAVNTLADLLV..SREKFILEANAKDLA.EA..
 399 --LEIGKLAQQAS..Y..E..L.ALLDSHTKNVALETIASALE..AQQTLILEANKKDIE.LG..
 400 ---DMAVAARESS..R..K..L.QALSSEDRKKILLDIADALE..ANVTTIKAENELDVA.SA..
 401 ---VLGKAAKAAS..F..Q..L.ATASTAQKNQALAIMADQLE..AQSASILAANAKDIA.LG..
 402 ---DMAVAARESS..R..K..L.QALSSEDRKKILLDIADALE..ANVTTIKAENELDVA.SA..
 403 ---DMAVAARESS..R..K..L.QALSSEDRKKILLDIADALE..ANVTTIKAENELDVA.SA..
 404 ---TMAQKAKQAS..R..V..A.AQLNSSEKNALLNDIATAIE..NNSDAIIQENSKDIA.AG..
 405 ---KIGVDARAAA..I..V..L.ATTGSERKHAALIGAADAIC..ANVMQILDANAEDQV.YG..
 406 EMRKLAEASREAA..R..A..L.SHADPRRKDAALRAAAEAIG..RRERRILSENARDVA.AA..
 407 ---DMAVAARESS..R..K..L.QALSSEDRKQILYSIADALE..ANEKTIRAENELDVA.TA..
 408 -MVAMLILAKRSA..R..I..L.ERLSNEERNAVLESMADEIE..SQCEIICEANAKDMS.VA..
 409 ---ELARAARKAQ..R..V..L.AAISSDARANALKLAAKQLR..TDAATILAENAKDIE.AG..
 410 -VQDLCSRAKKAS..K..V..L.KQLSSSKKNKVLLSLADLLE..KRKAEILLANELDLK.DG..
 411 ---EQAIAARSAA..T..V..L.RRLRRIDKDDLLAAMGIGLR..KGVDEILAANGADVD.RG..
 412 -VQDLCSRAKKAS..K..V..L.KQLSSSKKNKILLSLADLLE..KRKAEILLANELDLK.DG..
 413 --KEMGKNAKQAA..T..I..L.AQLSQQQKNTALQIIAEQLE..LQSDKILVENAKDIQ.LA..
 414 ----QLALAKAAK..K..S..V.NTADTEEKNRALFAMADSLE..AAAADILAANRQDLE.AA..
 415 --REMAVAARDCS..R..R..L.QALSSEERKQILLKIADALE..AHQNEIRIENEADVA.DA..
 416 ------EQVQAVK..K..S..I.NTASEEVKNQALLAMADHLV..AATEEILAANALDMA.AA..
 417 -VEEIGKRAKLVT..S..D..V.ANLAVDIRNQILLDMSSALV..ANWQEIVAANKKDLD.AA..
 418 -VEVMAENARTGS..R..Q..M.QALTPAQRASAVNTLADLLV..SREKFILDANAKDLA.EA..
 419 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 420 ---EMAVSARESS..R..R..L.QILKSEERSKILLAIADALE..KNASAISLENEADVA.DA..
 421 -----CRRAKVAS..R..P..L.RLASRATKDAALHAIADAIE..AATERIVTANGEDLA.RG..
 422 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 423 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 424 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 425 ---DMAVAARESS..R..K..L.QALSSEDRKKILLDIADALE..ANVTTIKAENELDVA.SA..
 426 --EKLLNNLKNSS..K..S..L.SILTQTQRENLIINIANEIM..SAKDEILSANKIDLD.LA..
 427 -----AQKAHLAA..T..V..L.KTVSNDDRTATLKMVHDALR..EAKDEVIAANVKDLD.AA..
 428 ------EQVQAVK..K..S..I.NTASEEVKNQALLAMADHLV..AATEEILAANALDMA.AA..
 429 ---DMAVAARESS..R..K..L.QALTSEDRNKILHDIADALE..ANEKTIKAENELDVA.AA..
 430 ----VAENARAGG..R..E..L.QNLTPDQRASCVHTLADLLV..SKQSEILDANAKDLS.EA..
 431 --EAKVDAAQTAA..L..E..L.ANESDEARQENLQAIADAID..ERRAEVLEANEKDVE.AA..
 432 ----QLALAKAAK..K..S..V.NTADTEEKNRALLAMADSLE..AATADILAANRQDLE.AA..
 433 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 434 --ESIAKDANNAF..S..L..L.KTLSNDQRSSALQKIHDALQ..KNKGQIIEANKIDMD.NA..
 435 -IEILGQNAKKAS..Q..S..V.ARLSTASKNEILRDLARNIV..ADTETILTENARDVA.KA..
 436 --------VRLAA..V..E..L.GQTNNGQRSRALHAMADALQ..ERSSLIVAANVQDLE.RS..
 437 ---NLLENIKKNS..Q..K..L.LNLTPKDKEKIILKLAQILR..ENFKIILEANKKDMA.NF..
 438 --ETIAKAANSAF..A..S..L.KTLTNDQRSLALQKIHDALL..TNKDKILESNKLDME.NA..
 439 -------------..-..T..L.QAVSSEERKQILLNIADALQ..SREKEIRIENEADVV.AA..
 440 ----KATLAKKVA..P..E..I.AQLGTGVKNQILLAAAEALL..ERSAEIIEANSRDIA.AG..
 441 --ADLGARASRAA..H..L..L.AQATTDKKNAALQTAAIALR..EASAALIAANEIDVK.MA..
 442 -IGEIARRSRESG..I..Q..L.SSSTVEERNAILEHFAEEIY..LNRNEILEANMKDMD.NS..
 443 -IEEVAEKCRDAG..R..Q..L.AALSNKERGAMVRHLAALLV..DKEKYIIEANQTDLA.NA..
 444 -IEEVAEKCRDAG..R..Q..L.AALSNKERGAMVRHLAALLV..DKEKYIIEANKTDLA.NA..
 445 ---AKATAAKNIV..P..D..I.AVLGTGPKNAILRAAADELV..ARSAEIIEANASDIE.AG..
 446 -IGEIARRSRESG..I..Q..L.SSSTVEERNAILEHFAEEIY..LNRNEILEANMKDMD.NS..
 447 -IEEVAEKCRDAG..R..Q..L.AALSNKERGAMVRHLAALLV..DKEKYIIEANQTDLA.NA..
 448 -----AIKARDGG..R..L..L.QALTSEQRAEVIIRLADLLI..ERSSTIMAANRRDID.EA..
 449 -VEVLAKNARSGS..R..R..L.QALAPEARAKIINKIADSLI..SRQDEIMSVNELDLR.QA..
 450 -----ARAAHRVA..P..I..V.AQLTSADKNAVLLDAAAALE..AAGAEIIAANQRDID.QG..
 451 -------------..-..-..-.LLLNTQQKNDLLADAADALE..ANAADIIAANEKDIA.TG..
 452 -VEVLAKNARSGS..R..R..L.QALAPEARAKIINKIADSLI..SRQDEIMSVNELDLR.QA..
 453 -VEVLAKNARSGS..R..R..L.QALAPEARAKIINKIADSLI..SRQDEIMSVNELDLR.QA..
 454 ---DMAVAARESS..R..K..L.QALSSEDRKQILHDIANALE..VNEKTIKAENDLDVA.AA..
 455 ---AKATAAKNIV..P..D..I.AVLGTGPKNAILRAAADELV..ARSAEIIEANASDIE.AG..
 456 --EENVKEAKNAF..N..I..L.QTLSVEDRDDALDKIVEELR..IKKSEVLAANAEDMK.AA..
 457 ---DMAVAARESS..R..K..L.QALSSEDRKQILHDIANALE..VNEKTIKAENDLDVA.AA..
 458 ---DAAQAAKSAS..H..V..L.ATLSADARNEALEAIHAGLT..AARDDILAANARDLE.LA..
 459 ---NLLENIKKNS..Q..K..L.LNLTPKDKENIILKLACALR..ENFKIILEANEKDMT.NF..
 460 -VQEMGQRAKKAT..A..Q..V.AGLSLATRNTLLKNMGAALL..MRQDEIIAANQQDLV.-A..
 461 --EKIAKQARVAG..N..V..L.KTISDENRSKILYRIRDALA..NAKDEIESANKEDLE.QA..
 462 ---EMAVAARESS..R..R..L.QAMSSQDRKKILLDIANALE..TNEELIKIENDADVE.AA..
 463 -----AGRARAAM..R..S..L.AAMPAARRDGALRAAAAELR..IHAVNILAANARDHD.SF..
 464 ------ELAERAR..K..R..L.SEIAKGNRDRALLAMADLLE..ARWEEVLRANREDLE.EA..
 465 --MEQLEAVRQAS..R..N..I.VTLSDQNINKVLEDLAGRIT..SSAQAILEANRKDLE.KM..
 466 ----IARAASLAS..R..Q..L.ATLPTIDRNDALTALHDALL..RNREIILDANAKDVA.IA..
 467 ----IAKAASSAS..R..H..L.AILSEADRNEALTALHAALS..RNKDAILEANARDIQ.AA..
 468 -MEKAAREAREGS..R..K..L.NTLSYLERKKILLEVANALD..TNRDKILDANAVDLR.VA..
 469 -----YARLRAAV..A..R..L.AVCSAAEKDGALRAVRDALH..AQREDILRANAQDLA.RA..
 470 -----YARLRAAV..A..R..L.AVCSAAEKDGALRAVRDALH..AQREDILRANAQDLA.RA..
 471 ---NTFKSVRQAS..R..E..L.VMIGEQAINSILIDLAETIP..DCSSSILEANRRDLD.RM..
 472 ----QLQAVQNAS..R..K..I.VPLNEETINGLLVELADRIP..AAADAILEANRKDLE.RM..
 473 -------------..-..-..L.DKVNSKTKNKVLKKYAFLLG..KEKKSIFKANQKDIQ.FA..
 474 -----ARTASLAS..R..R..L.ATLSEADRNGALTALHDALL..RNKNSILEANAKDVD.MA..
 475 -------AVQAAS..R..E..L.ALLSDDTINQILNAVADATI..AETSFILSENEKDLA.RM..
 476 -VRDLGLRARAAA..R..V..L.RSLPTARKAAALHAIARELQ..AREGVILAANARDVA.AA..
 477 ---NQLRAAKKAT..T..D..L.NLIQSDTRTIILKTLAANLE..KHIENIIQENQKDLS.LM..
 478 -------HVREAS..R..L..L.ATRSEKEINGILLDLAGRIA..ERAPIIIEANQKDLD.RM..
 479 ----QLIAVQQAS..R..E..I.ITLTDETINSLLCALADSIP..SHQEAILQANQKDIE.RM..
 480 ----VASAAKTAS..F..T..L.ATLPASERNNALEAIHAALT..ASKDDILAANAKDLE.LA..
 481 ----TFAAVQAAG..R..H..L.ALLPDDRINQILNAVAEAAL..EQTSYILSENRKDLE.RM..
 482 ---LIGQNARKAS..-..-..L.DKVNSKTKNKVLKKYAFLLG..KEKKSIFKANQKDIQ.FA..
 483 --ANQLRAAKKAT..T..D..L.NLIQSDTRTIILETLAANLE..KHIENIIQENQKDLS.LM..
 484 -----LHDVVRAS..R..E..L.VTLSDEAINRLLLDLADQIP..NHQTAILEANQRDIE.RM..
 485 ----AARAAKSAS..H..V..L.ATLSAEARNDALTAIHAGLT..AARDEILAANARDLE.LA..
 486 --ANQLRVAKKAT..T..D..L.NLIQSDTRTIILKTLAANLE..KHIENIIQENQKDLS.LM..
 487 ---EIAKLASSVS..R..Q..L.GALPVVSRNDALTAIHTALY..QNKDAILQANARDIE.VA..
 488 ---KQLEKVREAS..R..K..L.CTLSDSDINSLLNDLANRIP..GNSQTILEANQKDLD.RM..
 489 -VQDMGERARRAA..R..V..L.RSLPTGRKVQALRALAAELR..AREAGILAANAQDVQ.AA..
 490 ---QIAKNARKAG..N..I..L.KTISNEGRSDILYKIHDALK..ANAHAIEEANKIDLA.VA..
 491 ---LIGERAQAAS..Q..I..V.SGLSIDERNKILLSFASEIE..KNSDKIVEINVQELK.EH..
 492 ---QIAKNARKAG..N..I..L.KTISNEGRSDILYKIHDALK..ANAHAIEEANKIDLA.VA..
 493 ---EKLKAVREAS..R..K..I.ITLDDKAINALLLDLAAHIP..LHSPAILEANQRDLE.LM..
 494 ----IAKTARAAG..N..I..L.KTLSDEERSSILYKIHDGLK..ANAASIEAANKLDLE.QA..
 495 -----LDEVRTAS..R..T..L.VTLTDSTINEVLLDLAGRIA..PNAAAILEANRSDLE.RM..
 496 -VLQKAALAKEAA..A..E..M.VMKTTAEKNEALQCIADGLR..NERQLILTENQKDIE.AG..
 497 ----IAIAARRAF..E..A..S.QLVNPSERDVALKAIRETLQ..ASKDEIIAANKKDME.AA..
 498 ----YAEEARAGS..S..A..L.SDLTYAERQAMLRAVAKALQ..TNEARILEANREDMV.AA..
 499 ----IAIAARRAF..E..A..S.QLVNPSERDVALKAIRETLQ..ASKDEIIAANKKDME.AA..
 500 ---SIAKKARVAG..N..V..L.KTLSNEQRTGVLRRIHDGLL..AKKEDIRKANEADLE.TA..
 501 -VEQQAEMARHAG..R..T..L.AFLHPEQRGEIICCLAELLT..EKKDEILSANRRDME.LA..
 502 --SVKAKLAKEAA..A..E..M.IMKTTAEKDEALSLIANGLR..KELDFLLAENAKDIV.NG..
 503 ---SIVNRARDAF..N..S..G.KTRPLQFRVEQLEALQRMIN..ENLKGISKALASNLR.KN..
 504 ---DTVKRAREAF..N..S..G.KTRSLQFRIQQLEALQRMIN..ENLKSISGALASDLG.KN..
 505 -------------..-..-..-.--LSIETRNAVLRTMAKLVE..QERNEIILTNQEDLA.DY..
 506 ---SIVNRARDAF..N..S..G.KTRPLQFRVEQLEALQRMIN..ENLKGISKALASNLR.KN..
 507 ---DTVKRAREAF..N..S..G.KTRSLQFRIQQLEALQRMIN..ENLKSISGALASDLG.KN..
 508 ---SIVNRARDAF..N..S..G.KTRPLQFRVEQLEALQRMIN..ENLKGISKALASNLR.KN..
 509 -----VRRVRQAF..L..S..G.RSRPLRFRLQQLEALRRMVQ..EREKDILTAIAADLC.KS..
 510 -MKQIVDKARKAF..L..T..G.KTRSIDFRIQQLQAMERMLT..ENEAGFVEALKADLH.KN..
 511 ---SIVNRARDAF..N..S..G.KTRPLQFRVEQLEALQRMIN..ENLKGISKALASNLR.KN..
 512 -----VRRVRQAF..L..S..G.RSRPLRFRLQQLEALRRMVQ..EREKDILTAIAADLC.KS..
 513 -----VRRVRQAF..L..S..G.RSRPLRFRLQQLEALRRMVQ..EREKDILTAIAADLC.KS..
 514 -------------..-..-..-.--------------------..----------AVDLR.VA..
 515 -------------..-..-..-.--LNTDIKNKVLDSMMQIIE..SRKDEILEANKKDLE.AF..
 516 ---REVQRVRAAF..G..S..G.RSRPLTFRRRQLEALRVMVQ..EREKDILAAIGADLS.KS..
 517 ---REVQRVRAAF..G..S..G.RSRPLTFRRRQLEALRVMVQ..EREKDILAAIGADLS.KS..
 518 -------------..-..-..-.--LDTKVKNDVLQSMITIID..KRRDEIIEENKKDLE.SF..
 519 -------------..-..-..-.-----ATRSSALQSIRAALE..AHKKRIQEANQLDMQ.AAna
 520 ---EVVGRARAAF..S..S..G.RSRPLEFRLQQLRNLQRMVQ..EKEQEILAAIGADLH.KC..
 521 ---AKGIKAKEVA..R..E..L.VLKTTDQKNEALAAIANQLI..VETAYILEENKRDIE.EG..
 522 -------------..-..-..-.--------NKILLKIADALE..ANEKIIRIENEADVT.AA..
 523 -----AKRAFQAS..L..K..L.GTTKGIDRSRAVLAMAQALE..NAFDDILEANTLDLE.AS..
 524 -------------..-..-..-.--LNTQVKNNVLQSMITILD..THRAPLLEANKKDLD.AF..
 525 -----AKRAFQAS..L..K..L.GTTKGIDRSRAVLAMAQALE..NAFDDILEANTLDLE.AS..
 526 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 527 -------------..-..-..-.-----------LEALRRMVQ..EREKDILTAIAADLC.KS..
 528 -----AQRAYQAS..L..K..L.GITKGADRSRAVLAMAQALE..RSFDDILEANTLDLE.AS..
 529 DVERAVQSAREGQ..R..E..W.AALTAMQRSRVLRRAVEILR..ERNDELAALETRDTG.KP..
 530 -------------..-..-..-.-----------------ILE..EDREALLEANKKDLD.AF..
 531 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 532 -------------..-..-..-.---NTELKNNVLGSMMRILD..ERREDILTANKKDLD.AF..
 533 --REKINKQREYF..S..T..G.ETKDINFRIEKLKKLRDVLK..SEEEKIFEALKKDLM.KS..
 534 EVEAAVAAAKEAF..P..A..W.SERSPEQRAQVLNKLADLIQ..ANLEDLAQAESKDQG.KT..
 535 -INYMLENQKKYF..N..E..R.KTRDLKFRLNKLRLLKNAIK..TREEDIMEALKKDLN.KP..
 536 ----VVDGLREVF..Q..S..G.RSRPLQYRKQQLRALLRLIT..ERHADIEQALKQDLN.RS..
 537 -VNQAVAAAKAAF..P..A..W.ADTPPIRRARVLHRFLQLMN..EHRDALAAIITAEHG.KV..
 538 -VNAAVAAAQAAF..P..A..W.ADTPPLRRARVLNKFLQLLN..EQRDTLAAMITAEHG.KV..
 539 -------------..-..-..-.---------------ADLIV..QHKTVLLEANSKDIT.GY..
 540 -VDRAVASAHAAF..P..A..W.AATPPIRRARVLHRFLQLLN..EHRDTLAAIITAEHG.KV..
 541 -VDRAVASAQEGQ..R..E..W.AAMTAMQRSRILRRAVDLLR..ERNDELAALETRDTG.KP..
 542 -VDRAVASAQEGQ..R..E..W.AAMTAMQRSRILRRAVDLLR..ERNDELAAIETRDTG.KP..
 543 -VDRAVASAREGQ..R..E..W.AAMTAMQRSRILRRAVDLLR..ERNDELAAIETRDTG.KP..
 544 -VDRAVASAQQGQ..R..E..W.AALTAMQRSRILRRAVDLLR..ERNDELAAIETRDTG.KP..
 545 ----IVENQRAYF..N..H..G.NTVDYSFRKQQLEKMKVMLK..EYESHIFQALKHDLN.KS..
 546 -----VERSYNAY..L..A..L.ETSDSLDRSLGIKAMAKGLN..RSFDAILEANTLDLE.MS..
 547 ---EALATARNAF..S..T..G.ITKNAPFRLNQLKALLRLYE..ENTPAIIAALTEDLH.KS..
 548 ----ALEIAHSAF..A..K..W.QNVSAEERAKCLEKAADLLE..ERMKELIYILIVEAG.KI..
 549 -VQKAIDSAKAAF..P..A..W.RNTPPAKRAQVMFRFKQLLE..QNEARIAQLISEEHG.KT..
 550 -VDAAVAAAKRAF..P..A..W.RDTSLSRRTEILFAFRELVR..AHRDELARIISAEHG.KV..
 551 ----ALEIAHSAF..A..K..W.QNVSAEERAKCLEKAADLLE..ERMKELIYILIVEAG.KI..
 552 DVEQAFENALRHK..D..N..W.ANTPVEQRAVILEKMADLME..QHMPQLFDLAVREAG.KT..
 553 -VQKAIDSAKAAF..P..A..W.RNTPPAKRAQVMFRFKQLLE..QNEARIAQLISEEHG.KT..
 554 ----LVDELRSNF..N..S..G.RTKSYEWRISQLQNIARMID..EKEKCITEALYQDLS.KP..
 555 ----LVDELRSNF..N..S..G.RTKSYEWRISQLQNIARMID..EKEKCITEALYQDLS.KP..
 556 DMRRLGQRAKQAS..L..L..I.APLSTQIKNCFLSTLAKALV..DDTQTLLAANQKDLA.NA..
 557 -VQKAIESAKSAF..P..A..W.RNTPPAKRAQVMFRFKQLLE..QNEARIAQLISEEHG.KT..
 558 -IEAAVEAARAAF..P..G..W.SARSPQERSKVLYRLADLLE..QSLEELAQAESRDQG.KT..
 559 -----------RR..A..D..W.AGLKPHQRADVLYRIADLIH..AHREALAQLQRRDNG.KP..
 560 -----------RR..A..D..W.AGLKPHQRADVLYRIADLIH..AHREALAQLQRRDNG.KP..
 561 ---ETLQRLRETF..R..T..G.RTVSFAWRRSQLLALRQFLL..EQEAIIAEAVTLDFG.KS..
 562 -----------RR..A..D..W.AGLKPHQRADVLYRVADLIH..AHREALAQLQRRDNG.KP..
 563 --EAALVAAVNVA..P..I..W.QATPPEVRAAALERAADLME..AQMQSLMGIIMREAG.KT..
 564 -IEAAVEAAREAF..P..A..W.SSRSPQERSLVLNRLADVLE..QSLEELAQAESKDQG.KT..
 565 -----------RR..A..D..W.AGLKPHQRADVLYRVADLIH..AHREALAQLQRRDNG.KP..
 566 -VGAALAHAVAAA..P..I..W.QATPVDARADCLARAADLLE..AQMHTLMGLIVREAG.KS..
 567 -IPAIVQRLRRTY..A..T..G.RTRSVQWRKEQLHALERLMT..ENEGVITEALEKDLG.RA..
 568 -----VYQAYQAA..N..Q..L.ARTKPLVRSQALQAIAQAID..SARDDILEANTLDLE.AC..
 569 -VDAALQAAANAA..P..I..W.QATPPDVRASALERAADLME..AQMQSLMGIIMREAG.KT..
 570 -IKRLLAAQKNFF..A..N..Q.GTKPAAFRLARLQELKDSIK..NNEQQLISALKEDLG.KS..
 571 -VAKAMKAAQTAT..T..S..W.SAVAPAERAACLERAADIMQ..RDMPALLGLVMREAG.KS..
 572 ---SIVSDLRAAF..L..T..G.KTRSVEYRKNQLKQLAYMIK..DNQEAFVESLRKDLG.RS..
 573 --SAALAHAVAAA..P..I..W.QATPVDARADCLARAADLLE..AQMHTLMGLVVREAG.KS..
 574 -VAKAMKAAQTAT..T..S..W.SAVAPAERAACLERAADIMQ..RDMPALLGLVMREAG.KS..
 575 -VAKAMKAAQTAT..T..S..W.SAVAPAERAACLERAADIMQ..RDMPALLGLVMREAG.KS..
 576 ------KNLRKVF..L..S..Q.KTRKIDWRYSQLKAIKKMMS..ENKDNITAAVKKDLG.KH..
 577 -----VYQAYQAA..N..Q..L.ARTKPLVRSQALQAIAQAID..SARDGILEANTLDLE.AC..
 578 -VEQAVASARETF..A..S..W.KETPVSERARVMLRYQALLK..EHHDELAKIVSSELG.KT..
 579 -VEQAVASARETF..A..S..W.KETPVSERARVMLRYQALLK..EHHDELAKIVSSELG.KT..
 580 --SAALAHAVAAA..P..I..W.QATPVDARADCLVRAADLLE..AQMHTLMGLIVREAG.KS..
 581 --SAALAHAVAAA..P..I..W.QATPVDARADCLVRAADLLE..AQMHTLMGLIVREAG.KS..
 582 -IEQAVASARETF..A..S..W.KETPVSERARVMLRYQALLK..EHHDELAKIVSSELG.KT..
 583 -VNDAVTYSHEAQ..I..T..W.AAKTPQERAQLLQKWADLID..ANKEDLAIIMTAEQG.KP..
 584 -VNDAVTYSHEAQ..I..T..W.AAKTPQERAQLLQKWADLID..ANKEDLAIIMTAEQG.KP..
 585 --RRAVRLAADAA..P..D..W.AAVPPSERAACLDRAAELMQ..ARMPTLLGLIIREAG.KS..
 586 -LDATVAAARKAA..D..S..W.GDISLAKRTAVLFKFRELVA..AHVDDLAELITAEHG.KV..
 587 DVEKAVESAERGQ..K..V..W.AAMTAMQRSRILRRAVDILR..ERNDELAMLETLDTG.KS..
 588 -VEKAFAIAEQNQ..T..A..W.QATPAEQRAAILEKIADLME..SNMPTLFDLAVREAG.KT..
 589 -VDEVIKNTKESI..K..V..W.AEMPVYKRANIFHKAADLLL..ENIDEIANILVLEIA.KD..
 590 --ERIFLHQKQFA..L..K..L.RGESLDVRIEALEALEKSIE..LHKQDIIDALKKDFQ.KP..
 591 ------------L..K..T..E.KSKSISQRIETLEKLKASIK..SHEQDIVDALYKDFQ.KP..
 592 -VDRAVQAARAAM..Eg.P..W.GNTSAAERARVLHAVADGIE..RRFDEFVAAEVADTG.RT..
 593 ------------R..A..D..W.AALKPHQRALVLYRIADLIA..QRHEALAQLQRRDNG.KP..
 594 ------------R..A..D..W.AGLKPHQRAQVLYRIADLIM..QRHEALANLQRRDNG.KP..
 595 DVEKAVESAERGQ..K..V..W.AAMTAMQRSRILRRAVDILR..ERNDELAMLETLDTG.KS..
 596 ---HALAAAVHHG..S..L..W.SATPPADRAAVLKEAANRLE..TDMQPLIGLLVREAG.KS..
 597 -VDKIIDNAEKAQ..K..S..W.NEVPLNERAHVLYKTADLLE..EHKEELANIMIREVA.KD..
 598 --SAALAHAVAAA..P..I..W.QATPVDARADCLVRAADLLE..AQMHTLMGLIVREAG.KS..
 599 ------------R..A..D..W.AGLKPHQRAQVLYRIADLIM..QRHEALANLQRRDNG.KP..
 600 -------AARRAF..DdgP..W.PRMGLAERGAVLHRLADLII..EHRDELALADTTDMG.KP..
 601 --SAALAHAVAAA..P..I..W.QATPVDARADCLVRAADLLE..AQMHTLMGLIVREAG.KS..
 602 -----LDAAQGAF..L..A..L.DSYGGNDRSRAVLAMAEALE..RSFAQILEANTLDLV.VS..
 603 -VDNVLSIAKEGQ..K..K..W.SKVPMSERAEILYKAADILV..ERTDEIVDIMVREIG.KD..
 604 -------------..-..-..-.--------------------..---------------.--..
 605 -VEQAVTDAEAAQ..V..A..W.AALTAAERGKLLHKWADLID..DNHEDLAVLMTAEQG.KP..
 606 -VEESLREMRETF..A..S..G.RTRSLKWRKAQIGAIYEMVK..DNEDKICNALFQDLG.KH..
 607 ---SMLDELRNAF..Q..S..G.LTVSFAWRRAQLLALLRFLR..EREVDIAAAVHADLG.KS..
 608 ----AVKAARAALvhP..S..W.KQLPATGRGILLAKLADLME..QKRELLASIDAWDNG.KP..
 609 --------ARADG..S..G..W.ARAPVTERAAILERAADAMQ..ARMPILLGLIVREAG.KS..
 610 EVEQALQNAVNQA..P..V..W.FATPPQERAAILQRAAVLME..DQMQQLIGLLVREAG.KT..
 611 -VKTCLEAAQKAQ..V..E..W.GQTTFDERRQILQDFIDMFI..KHENELVEASMRDTG.KT..
 612 -VESALESSVKGI..E..L..W.SSKEPLERSKILYDISNKIE..KNTNIFINLLVRESG.KT..
 613 -VDAAVASAKTAS..T..A..W.ARTSISARTQVVFRFRELLN..ERKAELAAIITAEHG.KV..
 614 -LDAAVRSAEKAQ..V..A..W.AATNPQRRARVMMKFGQLIN..DNMDKLAELVSREHG.KT..
 615 --DAAVEAAKAAF..A..A..W.RDTPPGERAEYLFKAAAAAR..RIRYDLAALQVYEVG.KA..
 616 -MEAEVAALRGRF..A..A..G.GTRGAEWRAAQLRGILRMAA..EAEAEVCRALHADLA.KP..
 617 -------------..-..-..-.--------------------..---------------.--..
 618 ----AVQRARRSF..Q..T..G.KTKPLGFRLQQLKNLLRFLT..ERKKDIAAAVKQDMG.KS..
 619 -------VIRAAE..S..R..W.PNSAVSDRAAMLEAAADAMQ..ARMPILLGLIVREAG.KS..
 620 -VDRAVAAARHAF..D..EgpW.SKLNPSERGRLVWRLADLLE..EHADEFAQIDALDNG.KP..
 621 ---QQLATLRETF..Q..H..G.QTQQLYWRHAQLQALRAFLV..EREAAIAEALRADLR.KS..
 622 -ISRAARAAREAQ..P..R..W.AALSAWERAEVCHAVADLLE..ERKEELARQLSLEQG.KP..
 623 -VDKAVDMLYKSY..K..A..W.YSLGYMKRALIFLKAADMLS..EQKFKFAAILTYENG.KN..
 624 -LDLAVANAKEAF..K..T..W.RNTGQGARMRVMLKLQQLLR..DNTGKLAEMITREHG.KT..
 625 ------NNMRKYY..G..S..G.KTKETSWRESQLKGLRNFVK..ENEEEILKALKKDLG.KH..
 626 -LDLAVANAKEAF..K..T..W.RNTGQGARMRVMLKLQQLLR..DNTGKLAEMITREHG.KT..
 627 -------------..-..-..-.-DAPAEDRARVLNRAADLYE..ENFGEIFALLAREAG.KI..
 628 -VDHAMKAGREAL..P..A..W.AALTVYERAQYLHKAADIIE..RDKEEIATVLAKEIS.KA..
 629 -VDHAMKAGREAL..P..A..W.AALTVYERAQYLHKAADIIE..RDKEEIATVLAKEIS.KA..
 630 -------------..-..-..-.WSAPAATRAAVLCRAADLYE..ENFGPIFAALAQEAG.KT..
 631 -LDQAYRAAKNAQ..K..E..W.EQTLPAQKQEVLEKAAALLA..ERKDEVIERLVNEAG.SS..
 632 -VDHAMKAGREAL..P..A..W.AALTVYERAQYLHKAADIIE..RDKEEIATVLAKEIS.KA..
 633 -VDHAMKAGREAL..P..A..W.AALTVYERAQYLHKAADIIE..RDKEEIATVLAKEIS.KA..
 634 -------------..-..E..W.SLMHVEKRASILEKIADDIE..ANPSELIYYLMNEAG.KT..
 635 -VDAAYEAAADAQ..T..E..W.ADTPPQERARIVAAASEILA..SHRDEVVDLLATESG.TT..
 636 -IEAAVKAARSAQ..P..G..W.DAVPGVRRGEILHQIANLIE..ARSDELSRIVAAEAG.KK..
 637 ---AAVEAAAAAF..P..A..W.AALGPGERRKRLLRAADMMD..SRTDEFIAAGAAETG.AM..
 638 -VEEAIAAARRAQ..P..E..W.ARVPMERKQAILQSIGDELI..ARCDELGRLLSREEG.KP..
 639 -------------..-..-..-.---TAAERAAILRRAADLYE..DALGPLFAALHREAG.KT..
 640 -VDLAIAAAREAF..E..TgpW.SKLTAVERGRLMLKLSLRIL..EEKEALAQIETKDNG.KP..
 641 ----------AAA..S..R..W.SATPVAARAMILERAADAMQ..AAMPELIALIVREAG.KS..
 642 ---QAAQAATDAF..P..A..W.AALSAAERGAYLHRLADLIE..ANVEKLAMIECLDMG.ML..
 643 -----LDIAQENG..E..I..W.FATPPAERAAFLVRTAELME..QQMGPLMGVLVREAG.KT..
 644 --ERAIDILSSGY..K..K..W.FQVPYDARVNIIEKALRMLQ..ERKFEFAALLTYENG.KN..
 645 -----VDIAAKAQ..K..G..W.RQLTSIERAGFLHKLADALL..ARKDAIGQALALESG.KS..
 646 --ERAIEAAESAW..P..A..W.RALTAQERADILMKWYELML..EHQDELAAIMTAEQG.KP..
 647 -------------..-..-..I.WTADYTTRAAVLRKAADALE..KDADTLFALLAREAG.KT..
 648 -------------..-..-..I.WDASAAERAAVLRRAADLYE..DHYGPIFGILGREAG.KS..
 649 ----TFQELRQTF..L..S..Q.KTKSLAYRKTQLRNLLRGLT..EMEQEFHKALELDLK.CS..
 650 -------------..-..-..-.--LSLEQRIYYLKKLKNLII..EHRQDIYDALHKDLN.KN..
 651 -------------..-..-..-.WSAQAKERGVILNRVADLYE..QNYGEIFAILSREAG.KS..
 652 -------------..G..A..W.SRSSPGERKAVLLRLADLME..AHKHELALLDSLDMG.KP..
 653 ---AALSKAVEAF..P..E..W.SRLDWRERARILAKLADLIE..RDRFKLAAAITYEVG.KN..
 654 -------------..-..-..-.-DAPAEERAAALNKAADLYE..AHYGELFALLAREAG.KT..
 655 EMRQAVEAAQKAF..L..T..W.KDTSIMHRQQVAFNFVRLIR..DNWDRLAASITLEQG.KT..
 656 --NKAVDMLYRSY..K..N..W.YNIGYMKRALTFLKAAGMLS..DQKFKFAAILTYENG.KN..
 657 ---DVLDQQKRAY..Q..R..Y.PVPSAKDRIDRLARLKRILI..KYQDQFAEAINRDYG.NRs.
 658 -----LQRLRDSF..E..T..G.KLDSVDYRLEQLRTLWFKFY..DNLDNIYEAVTKDLH.RP..
 659 -IAEAVASSQRAF..E..S..W.KDRSPLERGRILRRFADLAR..KHADEIARNMTRDQG.KP..
 660 EMEAAVKAASDAF..P..A..W.RDTSVSNRSRIISNYKNLIN..KNMDKIAAIITEEQG.KT..
 661 ----ALQRQRSAF..R..A..E.GPPTAAVRRDRIDRLTALML..DNADAIVDAMAADYGtRP..
 662 ------TAARKGF..E..S..W.SRTSGDHRAAILQRAGDLLE..QRRGELIALLQDEGG.KT..
 663 -VDAAYAAAKDAT..R..T..W.GKMIPGERQRAMLKLADAIE..AHSDELVAAQSRNTG.QP..
 664 ----------SSY..Q..K..W.SKVEVAERAAILRRAADALQ..QQMPKFCALLVKEAF.KT..
 665 -------------..-..Q..P.WQAPAAERAAVLNRAADLYE..AHYGELFALLHREAG.KT..
 666 -----IGTARAAQ..R..A..W.GRLSIERRGQVLLRFHDLVL..ERQVELLDLIQLESG.KA..
 667 ----ALAHAVTAA..P..I..W.QATPVDARADCLVRAADLLE..AQMHTLMGLIVREAG.KS..
 668 -IDATMRRLHAGQ..V..A..W.DDTPLTERAAVLLRAADRLE..AELPAWCGLLVKEAH.KT..
 669 ----TLRQVRRLL..P..Q..L.QRLSGETKRQALLALSRRLL..ERSDLLLEANTLDLE.SC..
 670 ---SLHQKLRAAF..T..D..N.RTRDVRWRKWQLKQLFWLLD..ENEDALVKAMADDLH.RH..
 671 -IDKAIAAAQQAQ..P..A..M.AALAPYERQAVLEHCVKRFT..ERADELAKALCIEAG.KP..
 672 ----LFAAQQPVA..A..A..W.RSSTAAQRRERLRALRSALL..ARRQALYAAFAGDFG.KP..
 673 -----LRQVRRLL..P..Q..M.QRLSSQTKRQALLALSRCLL..ERSDLLLEANTLDLE.SC..
 674 --EQAAQTARETF..F..A..TdWAHAPRQRAQALFEFADRME..AARDEIVDLIVAENG.KL..
 675 -AERKIDAAHDAF..L..K..W.RTVPAPVRGELVRVFGNVLR..EHKAELGRLVTLEAG.KI..
 676 -AERKIDAAHDAF..L..K..W.RTVPAPVRGELVRVFGNVLR..EHKAELGALVTLEAG.KI..
 677 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIINHLADLLT..DQREEILLANKKDLE.EA..
 678 -IEAAVEAARAAF..P..G..W.SARSPQERSKVLYRLADLLE..QSLEELAQAESRDQG.KT..
 679 ------DALRRGE..L..I..Q.RSLAAHERADILRRLAELLK..THREELAMLITAEIG.KT..
 680 ---RKIDAAHDAF..L..K..W.RTVPAPVRGELVRVFGNVLR..EHKAELGRLVTLEAG.KI..
 681 ---RKIDAAHDAF..L..K..W.RTVPAPVRGELVRVFGNVLR..EHKAELGRLVTLEAG.KI..
 682 --SEAVKATHQAF..L..T..W.KTFSLEKRAEFINKIGESLS..KHKDQLVKLMTQEMG.KL..
 683 -------------..-..-..-.TQKSHDEIYQILAKSAKLMR..ERRGDLIGLAALEVG.KT..
 684 -------------..-..-..-.TQKSHDEIYQILAKSAKLMR..ERRGDLIGLAALEVG.KT..
 685 -------------..-..-..-.TQKSHDEIYQILAKSAKLMR..ERRGDLIGLAALEVG.KT..
 686 -------------..-..-..-.--------------------..---------------.--..
 687 -------------..-..-..-.----------------EFLI..KRCDEILEENKKDLE.KA..
 688 -------------..-..-..-.--------------------..---------------.--..
 689 ------ESLKVAL..S..A..N.ENLSFDNLYEILSSTAQLMR..ERRGDLIGIAALEVG.KT..
 690 -------------..-..-..-.TQKSHDEIYQILAKSAKLMR..ERRGDLIGLAALEVG.KT..
 691 -VEKAILAARAAF..P..D..W.SGRSVEERLAICQKFSELLE..ENKEHLARTMAKETG.KP..
 692 -------------..-..-..-.--------------------..---------------.--..
 693 -------------..-..-..-.--------------------..---------------.--..
 694 -VKQAIENAHDAF..L..L..W.KNTGFTERARIMHAAAELLR..RDVDYYANLLTIEMG.KL..
 695 -------------..-..-..-.--------------------..---------------.--..
 696 -------------..-..-..-.--------------------..---------------.--..
 697 -----IATAVEKG..K..A..W.GALSGAERAAVLHRAGDILE..ARRADLLEVMASETG.KT..
 698 -------------..-..-..-.--------------------..---------------.--..
 699 --AAALNAAETAF..K..T..W.KLSSKLERAQLVEALADELL..KRADDLSLAVSLSIG.RP..
 700 -------------..-..-..-.--------------------..---------------.--..
 701 -VNAVIATALEAQ..H..S..W.AGRGGNARAEILRTVTHAFA..TRRGDLLAVAGAETG.KI..
 702 -------------..-..-..-.--------------------..---------------.--..
 703 -------------..-..-..-.--------------------..---------------.--..
 704 EVEAAVEAARAAF..P..G..W.SSRSPQERSQVLQRLADLLE..QSLEELAQAESKDQG.KT..
 705 -VRTLVRRSKVAQ..E..K..L.SKMSQEQIDKIVKAVVDAAF..NNATKLAKMANEETG.FG..
 706 -------------..-..-..-.--------------------..---------------.--..
 707 --RNLIRKAKEAQ..Q..V..L.ATFSQKQIDAIVQAVSEATF..NQREKLAKMANEETG.FG..
 708 -------------..-..-..-.--------------------..---------------.--..
 709 -VDQMVAKARKAA..E..A..F.KGLTQEQVDRITEAMTKAGV..ANERKLAEMAVEETG.IG..
 710 ---NLIAKAKKAQ..E..I..Y.KTFSQEKVNSIVKAITEAIE..KEAVKLAKMAHEETG.FG..
 711 ---EPLKRARVAS..T..Y..L.SQASYALRQEALRHLIEELA..TAEPLLLEQNTLDLE.SS..
 712 ----LVDELRSNF..N..S..G.RTKSYEWRISQLQNIARMID..EKEKCITEALYQDLS.KP..
 713 -------------..-..-..-.--------------------..---------------.--..
 714 --SKVVHTLRRGF..V..E..G.ALKTIESRKCAIQNILALLL..ENEESIIKALEKDLH.RC..
 715 --NEMVQKAKAAV..A..E..Y.KKLNQEQTDAICEAIAKVID..AKKEELAQDAVTETR.LG..
 716 -VNQLVENGLKAL..E..E..F.RQLNQEQVDYIVAKASVAAL..DKHGVLAMHAYEETG.RG..
 717 ----LVEKALEAE..R..V..Y.ATYSQEQVDNIVAAMALAGS..EASLELAKEAHAETG.RG..
 718 --DAMVARSVVAQ..N..S..I.QTLPEDQIDAMIGDIADAVN..RESWNLAEAAILETG.MG..
 719 ----MLERARWAA..R..A..Y.ADYDQAAVSAITTAVADAAY..GAAERFAAEAVAETG.MG..
 720 ----MLERARWAA..R..A..Y.ADYDQAAVSAITTAVADAAY..GAADRFAAEAVAETG.MG..
 721 -------------..-..-..-.--------------------..---------------.--..
 722 ----LARLGKVAA..N..K..I.ANYTEEQIDKILRNMVRVAE..ENAVSLAQMAVEETG.FG..
 723 -----IERAAAAF..T..A..L.SAVPDEAISRFFDLFAQRLEnpDAWALIETANLADIE.RA..
 724 ---QLLERARFAA..A..A..Y.ADYDQAAVARIVEAVAEAGY..RNAERFAAAAVAETQ.MG..
 725 ---ALVAASSKAL..E..Q..W.RRAGPRAWVGVSLEILQRLN..RRSFEMAHAVQHTTG.QA..
 726 ---ALVAASSKAL..E..Q..W.RRAGPRAWVGVSLEILQRLN..RRSFEMAHAVQHTTG.QA..
 727 ---ALVAASSKAL..E..Q..W.RRAGPRAWVGVSLEILQRLN..RRSFEMAHAVQHTTG.QA..
 728 ---ELAQQAKKAA..R..T..L.AILSESQKNAVLTDMAAAIR..ENKSKIIEVNEKEVA.RA..
 729 -------------..-..-..-.--------------------..---------------.--..
 730 -------------..-..-..-.--------------------..---------------.--..
 731 ---DMAVAARESS..R..Q..L.QAMSPGARSKILLDIASALE..ANEQNITVENEADVA.AA..
 732 -------------..-..-..-.---------------ADPLN..KERAAIIKSNKEDMA.RY..
 733 -------------..-..-..-.--------------------..---------------.--..
 734 -------------..-..-..-.--------------------..---------------.--..
 735 -------------..-..-..-.--------------------..---------------.--..
 736 -------------..-..-..-.--------------------..---------------.--..
 737 -------------..-..-..-.--------------------..---------------.--..
 738 -------------..-..-..-.--------------------..---------------.--..
 739 -------------..-..-..-.--------------------..---------------.--..
 740 -VEQQGEMARSGG..R..M..L.ATLEPEQRAEIIHHLADLLT..DQRDEILLANKKDLE.EA..
 741 -------------..-..-..-.--------------------..---------------.--..
 742 -------------..-..-..-.--------------------..---------------.--..
 743 -------------..-..-..-.--------------------..---------------.--..
 744 -------------..-..-..-.--------------------..---------------.--..
 745 -------------..-..-..-.--------------------..---------------.--..
 746 -------------..-..-..-.--------------------..---------------.--..
 747 ------QAAVESR..S..I..M.ATSSFAQRRSFLVALSEELH..RNSEHIIHANRRDC-.--..


                          60                    70        80           
                          |                     |         |           
   1 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
   2 ..K....KGG....L.....SP.....AFIERL.TL.N.....EKRILDMAEGVRQ..VA.KLP.
   3 ..R....ENG....L.....DS.....AMLDRL.EL.T.....SQRIDAMIEGLRQ..VA.ALP.
   4 ..K....EKG....L.....SR.....ALLDRL.LL.N.....EKRIRDMAAGLRE..LA.ALP.
   5 ..R....ANG....L.....EP.....AMLDRL.AL.T.....PARIDDMIEGLRQ..VA.TLP.
   6 ..R....ANG....L.....EP.....AMLDRL.AL.T.....PARIDDMIEGLRQ..VA.TLP.
   7 ..K....ANG....L.....DA.....AMLDRL.AL.T.....DKVINGMATGLRQ..IA.ALN.
   8 ..R....QAG....L.....DD.....AMLDRL.TL.S.....AKGVLAMADGLRQ..IA.ALP.
   9 ..K....ANG....L.....DA.....AMLDRL.AL.T.....DKVINGMATGLRQ..IA.ALN.
  10 ..R....SKG....L.....DE.....ALLDRL.TL.T.....EARIAVMAEGLRQ..IA.SLP.
  11 ..R....EKG....L.....SK.....ALLDRL.EL.N.....EKRIEGMAEGLKE..LV.KLE.
  12 ..R....ANG....L.....EP.....AMLDRL.AL.T.....PARIDDMIEGLRQ..VA.TLP.
  13 ..R....AGG....L.....DE.....AMLDRL.AL.T.....PARIDEMIEGLRQ..VA.RLP.
  14 ..E....AKG....L.....ST.....AMLDRL.ML.N.....EARIKAMADGLRE..VA.ALS.
  15 ..K....QKG....L.....SS.....AMLDRL.ML.D.....AKRISAMADALRE..VA.ALP.
  16 ..R....ANG....L.....EP.....ALLDRL.AL.T.....PARIDEMIEGLRQ..VA.KLP.
  17 ..R....NKG....M.....SN.....ALLDRL.ML.N.....KKRIEEMAEGLYA..LV.SLP.
  18 ..R....ANG....L.....EP.....ALLDRL.AL.T.....PARIDEMIEGLRQ..VA.KLP.
  19 ..I....EKG....T.....SN.....AMLDRL.KL.D.....EERVKSIANAVAD..VV.KLD.
  20 ..K....EKG....L.....SK.....SLLDRL.LI.D.....EKRVNDMVNGLIE..VA.ELP.
  21 ..S....ANG....L.....DA.....ALLDRL.EL.N.....APRIDAMIEGLQQ..VA.ELP.
  22 ..A....AKG....L.....DR.....AQLERL.GV.D.....AKRVQTMAVGLRE..IA.ALP.
  23 ..K....NLG....L.....SP.....AMIDRL.TL.K.....ESTIRDMADGILE..VA.SLP.
  24 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKAIADDVRQ..VC.NLA.
  25 ..E....KRN....I.....KA.....SLIDRL.KL.D.....EKRVEAMAKGLRE..IS.ALP.
  26 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKAIADDVRQ..VC.NLA.
  27 ..V....LKG....T.....SK.....AMLDRL.AL.T.....DERIESMAAGLKD..VI.KLQ.
  28 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKAIADDVRQ..VC.NLA.
  29 ..R....ANG....L.....DA.....ALLDRL.EL.T.....PERIDGMIEGLNQ..VA.ALP.
  30 ..R....ANG....L.....DA.....ALLDRL.EL.T.....PARIDAMIKGLHQ..VA.ALP.
  31 ..R....EKG....L.....SD.....AMLDRL.RL.D.....EARIQGMADGLRE..VA.ELP.
  32 ..R....ASG....L.....EP.....ALLDRL.AL.T.....PARIDGMITGLRQ..VA.SLP.
  33 ..K....NKG....L.....DA.....ALLDRL.AL.T.....EARIDGMIEGLRQ..VA.GLL.
  34 ..R....DSH....L.....DS.....ALLDRL.EL.T.....PTRFKGMLQGLKD..VI.ALT.
  35 ..R....EEK....L.....AE.....PLLKRL.KF.D.....EAKIVDVIDGINS..LI.KLE.
  36 ..E....KEN....L.....PG.....PLLKRL.KF.D.....EAKIQEVIEGIHS..LI.ELE.
  37 ..R....AAG....L.....EA.....ALIDRL.TL.T.....AKGIEAMAEGLEQ..VA.GLP.
  38 ..R....ASG....L.....EP.....ALLDRL.AL.T.....PARIDGMITGLRQ..VA.SLP.
  39 ..A....THG....I.....SE.....TMQDRL.RL.T.....EERITAMAEGIRQ..VA.TLP.
  40 ..R....NKG....L.....EP.....AMIDRL.TL.T.....PKGIASMAAGLEQ..IA.ALS.
  41 ..R....KNG....L.....EP.....ALLDRL.AL.T.....PARIDGMITGLRQ..VA.SLP.
  42 ..R....ANG....L.....DE.....ALLDRL.AL.T.....PARIDSMIEGLRQ..VA.ALP.
  43 ..E....RRN....L.....KA.....SLVDRL.KL.D.....EKRIKAMAEGLKE..VA.SLK.
  44 ..Q....ANG....L.....EP.....AMLERL.AL.T.....PARIDSMIVGLRQ..VA.SLA.
  45 ..R....ANG....L.....EP.....ALLERL.EL.T.....PARIDGMIVGLRQ..VA.ALP.
  46 ..K....ERG....L.....EA.....AMIDRL.TL.T.....PKSVASMAEGLLQ..IA.ALA.
  47 ..E....KIG....T.....SK.....ALIDRL.TL.N.....DKRITDMAEALIK..TS.SLQ.
  48 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  49 ..Q....ANG....L.....EP.....AMLERL.AL.T.....PARIDGMIVGLRQ..VA.ALA.
  50 ..R....EQG....M.....SE.....ALLDRL.LL.T.....PERLTAIAHDVRQ..VC.GLS.
  51 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  52 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  53 ..C....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  54 ..R....ANG....L.....GE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  55 ..R....ENG....I.....SE.....AMIDRL.TL.T.....PARITAIADAVHE..IV.ELP.
  56 ..R....EKG....L.....SD.....AMLDRL.TL.T.....PERIQGMVEGLQQ..VA.SLP.
  57 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  58 ..R....ANG....L.....GE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  59 ..Q....NKG....I.....KG.....ALLDRL.KL.T.....EDRIRQICKGIED..VI.KLP.
  60 ..R....EKG....H.....DA.....AFIDRL.TL.S.....DKALKTMVEGLRQ..VA.ALA.
  61 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKAIADDVRQ..VC.NLA.
  62 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  63 ..R....ANG....L.....EA.....ALLDRL.TL.S.....DRSIALMAEGLRQ..IA.ALP.
  64 ..V....ENN....I.....SE.....TMQDRL.QL.T.....PERINAMATEIEK..IA.SLD.
  65 ..R....DNG....L.....SS.....AMIDRL.VL.N.....DDRITAMADGLRE..VA.ALP.
  66 ..R....ANG....L.....GE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  67 ..E....KQG....L.....TP.....ALLERL.AL.N.....ESRIKDMAQGLRE..IA.ALP.
  68 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  69 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
  70 ..Q....ANG....L.....EP.....AMLERL.AL.T.....PARIDSMIVGLRQ..VA.GLA.
  71 ..R....EKG....L.....DA.....AFVDRL.TL.S.....DKALNTMVEGLRQ..VA.SLA.
  72 ..R....ANG....L.....EA.....ALLDRL.TL.S.....DRSIALMAEGLRQ..IA.ALP.
  73 ..R....ERG....V.....KE.....SLVDRL.AL.N.....DKRIDEMIKACET..VI.GLK.
  74 ..R....EKG....L.....DA.....AFIDRL.TL.S.....DNALKTMVEGLRQ..VA.SLA.
  75 ..R....EKG....L.....DA.....AFVDRL.TL.S.....DKALNTMVEGLRQ..VA.SLA.
  76 ..R....EKG....L.....DA.....AFIDRL.TL.S.....DKALNTMVEGLRQ..VA.SLA.
  77 ..R....RHG....L.....EP.....AMLDRL.VL.S.....EKGIDTMAEGLEQ..IA.GLP.
  78 ..R....DKG....L.....DA.....AFIDRL.TL.S.....DKALKTMVEGLRQ..VA.SLA.
  79 ..R....ATG....M.....SE.....ALLDRL.LL.T.....PARLAAIANDVRQ..VC.RLN.
  80 ..R....AAG....Y.....DA.....ALLDRL.QL.S.....EKTVAGMAEGLEQ..IA.ALP.
  81 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAIAQGVQQ..VA.DLA.
  82 ..R....ANG....L.....EA.....ALLDRL.TL.S.....DRSIELMAEGLRQ..IA.ALP.
  83 ..R....ENG....I.....SE.....AMIDRL.TL.T.....PARITAIADAVHE..IV.ELP.
  84 ..R....ANN....L.....DP.....ALLDRL.EL.N.....DERIHGMAEGLRQ..IA.ALP.
  85 ..R....ERG....V.....KE.....SLVDRL.AL.N.....DKRIDEXIKACET..VI.GLK.
  86 ..R....KNA....L.....DS.....ALLDRL.EL.S.....EARIDAMLEGLRQ..VA.ALP.
  87 ..Q....KND....L.....DA.....ALLDRL.EL.N.....DARFDGMLQGLKD..VA.ALP.
  88 ..R....AAG....Y.....DA.....ALLDRL.QL.S.....EKTVAGMAEGLEQ..IA.ALP.
  89 ..E....KKG....L.....SS.....AMLDRL.ML.D.....EARIKAMADGLRE..VA.GLP.
  90 ..E....GKE....L.....AT.....PLLKRL.SL.S.....TSKLNSLAIGLRQ..IAaSSQ.
  91 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAIAQGVQQ..VA.DLA.
  92 ..K....EMG....L.....RP.....AVVDRL.VL.N.....DKRIDGMVKVLKD..VA.SLP.
  93 ..K....EMG....L.....RP.....AVVDRL.VL.N.....DKRIDGMVKVLKD..VA.SLP.
  94 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAMAQGVQQ..VA.DLA.
  95 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAIAQGVQQ..VA.DLA.
  96 ..T....RAG....L.....AA.....PMVDRL.RL.T.....DKVIALMAEGCEQ..VA.ALP.
  97 ..E....KNG....L.....TD.....AMLDRL.RL.T.....DQVIASMAEGIRQ..VA.ALP.
  98 ..R....AGG....L.....EP.....ALLDRL.GL.S.....DARIDDMAEGLRQ..IA.ALP.
  99 ..R....EAG....L.....DP.....ALIDRM.EL.T.....PGRIQAMADGLRE..IA.ALP.
 100 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAIAQGVQQ..VA.DLA.
 101 ..K....DKG....L.....DA.....AFVDRL.TL.S.....DKALKTMVEGLRQ..VA.TLP.
 102 ..K....AQG....L.....DS.....ALIDRL.TL.T.....SKGVTNMVEGLLQ..IA.SLA.
 103 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAIAQGVQQ..VA.DLA.
 104 ..K....QAG....L.....SE.....AMIDRL.SL.T.....DKRINAMADGVRQ..II.HLA.
 105 ..E....GRL....A.....PP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 106 ..R....ANG....Q.....DA.....AFVDRL.TL.S.....DKAIKTMAEGLEQ..IA.ALA.
 107 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 108 ..K....ASG....M.....LP.....AMLDRL.II.D.....QSRLEGIAKDTFA..IA.ALP.
 109 ..R....NNG....L.....DA.....AMLDRL.EL.T.....DARIDTMIEGLRQ..VA.ALP.
 110 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 111 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 112 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 113 ..E....GRL....A.....PP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 114 ..E....GRL....A.....TP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 115 ..K....KMG....L.....SP.....SLLDRL.AL.T.....SARIDGMVEGIKQ..VV.ELE.
 116 ..E....GRL....A.....TP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 117 ..T....--N....M.....PE.....KFIDRL.KI.D.....NDRIAAMAEGVRQ..VA.QLA.
 118 ..K....DKG....H.....DA.....AFVDRL.TL.S.....DKALKTMIEGLRQ..VA.TLA.
 119 ..K....ADG....L.....TE.....AMIDRL.LL.D.....DARLAGIIGDISD..VI.RLA.
 120 ..E....GRL....A.....TP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 121 ..K....DNG....L.....DA.....ALLDRL.EL.T.....PARIDGMIEGLKQ..VA.ALP.
 122 ..R....DTG....M.....SE.....ALLDRL.LL.T.....PARLAAIANDVRQ..VC.RLN.
 123 ..E....GRL....A.....TP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 124 ..R....ANG....Q.....DA.....AFVDRL.TL.T.....DRAIETMAAGLEQ..IA.ALP.
 125 ..K....ADG....L.....TE.....AMIDRL.LL.D.....DARLAGIIGDISD..VI.RLA.
 126 ..K....AEG....L.....ND.....AMIDRL.LL.N.....ESRLAGIIGDIGD..VV.RLA.
 127 ..R....SNN....L.....DA.....ALLDRL.AL.N.....ESRFEAMLQGLKD..VA.ALP.
 128 ..K....DNG....I.....SE.....IMVDRL.RL.N.....KDRIQAIANGIYQ..VA.DLA.
 129 ..R....NKG....L.....ES.....AMIDRL.TL.T.....SRGVVSMATGLEQ..IA.TLP.
 130 ..K....DKG....H.....DA.....AFVDRL.TL.S.....DKALKTMIEGLRQ..VA.TLA.
 131 ..R....DTG....M.....SE.....ALLDRL.LL.T.....PVRLAAIANDVRQ..VC.RLN.
 132 ..R....TNG....Q.....DA.....AFIDRL.TL.S.....DKAIATMAAGLEQ..IA.ALA.
 133 ..R....DSG....M.....SE.....ALLDRL.LL.S.....PARLAAIANDVRQ..VC.RLN.
 134 ..S....ENG....I.....SK.....IMQDRL.LL.T.....EDRIAGIAEGVRQ..VA.DLQ.
 135 ..K....AEG....L.....ND.....AMIDRL.LL.N.....ESRLAGIIGDIGD..VV.RLA.
 136 ..K....DKG....H.....DA.....AFVDRL.TL.S.....DKALKTMIEGLRQ..VA.TLA.
 137 ..K....ASG....M.....LP.....AMLDRL.II.D.....QSRLEGIAKDTFA..IA.ALP.
 138 ..R....DSG....M.....SE.....ALLDRL.LL.S.....PARLAAIANDVRQ..VC.RLN.
 139 ..K....DNG....I.....SE.....IMVDRL.RL.N.....KDRIQAIANGIYQ..VA.DLA.
 140 ..S....ENG....I.....SK.....IMQDRL.LL.T.....EDRIAGIAEGVRQ..VA.DLQ.
 141 ..S....ENG....I.....SK.....IMQDRL.LL.T.....EDRIAGIAEGVRQ..VA.DLQ.
 142 ..K....AEG....L.....ND.....AMIDRL.LL.N.....ESRLAGIIGDIGD..VV.RLA.
 143 ..K....EKG....L.....SD.....AMMDRL.HL.T.....EERVEGMATAIEE..II.DLK.
 144 ..K....AAG....M.....TA.....AMLDRL.II.T.....QSRLEGIAKDTLA..IA.ALP.
 145 ..R....EKG....T.....PE.....TMIDRL.RL.T.....EERIKEISEAVKQ..VV.ALK.
 146 ..R....RNG....L.....VD.....ALLDRL.LL.N.....PARLSAIAADVRQ..VC.RLT.
 147 ..R....QNG....M.....SE.....ALLDRL.LL.T.....QERLSAIASDVRQ..VC.RLT.
 148 ..K....QNG....L.....SD.....AIIDRL.LL.T.....PSRLNDIANDVHH..VI.SLA.
 149 ..K....ADG....L.....TD.....AMIDRL.LL.D.....EARLAGIIGDISD..VI.RLA.
 150 ..R....AAG....L.....ET.....AMLDRL.TL.S.....AKGVESMAEGVEQ..VA.TLA.
 151 ..R....EKG....T.....PE.....TMIDRL.RL.T.....EERIKEISDAVKQ..VV.ALK.
 152 ..R....EKG....T.....PE.....TMIDRL.RL.T.....EERIKEISEAVKQ..VV.ALK.
 153 ..Q....KND....L.....DA.....ALLDRL.EL.N.....DARFDGMLQGLKD..VA.ALP.
 154 ..R....ESG....M.....SE.....ALLDRL.LL.T.....PARLAAIANDVRQ..VC.RLN.
 155 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 156 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 157 ..R....ANG....Q.....DA.....AFIDRL.TL.T.....DRAIETMAAGLEQ..IA.ALP.
 158 ..Q....KND....L.....DA.....ALLDRL.EL.N.....DARFDGMLQGLKD..VA.ALP.
 159 ..P....EYG....L.....TA.....AEIDRL.KL.D.....SKRIEGIAAGLEE..IA.MLA.
 160 ..K....AKG....F.....SD.....SLLDRL.ML.N.....EQRIVDMTEGIKQ..LI.ELR.
 161 ..P....KYG....L.....TD.....AGIDRL.RL.D.....EARIAGIATGLRE..IA.SLN.
 162 ..R....DKG....L.....SD.....AMLDRL.ML.D.....EARIEGICAGLRA..VA.GQD.
 163 ..E....DNG....L.....DA.....PMVDRL.RL.D.....DERLGGIIQGVRD..VA.ALD.
 164 ..R....EAG....T.....SE.....AIIDRL.TL.T.....PERVRAIAADVRD..VV.ALP.
 165 ..K....AKG....F.....SD.....SLLDRL.ML.T.....ENRIIDMTEGIKQ..LI.ELR.
 166 ..R....ESG....M.....SE.....ALLDRL.LL.T.....PARLAAIANDVRQ..VC.RLN.
 167 ..K....EKG....L.....SD.....AMMDRL.EL.T.....PERVEGMASAIEE..II.ALK.
 168 ..R....DKG....L.....SP.....AMMDRL.ML.D.....EARIQGIVDGLRT..VA.DQD.
 169 ..-....-SA....L.....PE.....KFVDRL.AL.T.....KARIADMAAGVRQ..VA.TLD.
 170 ..K....AKG....F.....SD.....SLLDRL.ML.N.....EQRIVDMTEGIKQ..LI.ELR.
 171 ..R....EKG....L.....SP.....AMMDRL.ML.D.....EARIQGMCDGVRS..VA.AQD.
 172 ..R....EKG....L.....SA.....AMLDRL.AL.S.....DKVIEAMVGGLQE..VA.ALA.
 173 ..Q....AAG....L.....AG.....PLLDRL.RL.S.....PKDIETVALGCEQ..LA.AMP.
 174 ..K....GHG....I.....SE.....IMVDRL.RL.T.....AQRISDMATGLRQ..VA.ELP.
 175 ..Q....---....V.....PV.....KFVDRL.RL.T.....ADRIQDMAIGLKQ..VV.SLP.
 176 ..R....EKG....L.....DA.....AFVDRL.TL.S.....DKALKTMVEGLRQ..VA.SLA.
 177 ..S....AAG....L.....AG.....PLLDRL.KL.S.....AKDLETVALGCEQ..LA.AMP.
 178 ..R....EKG....L.....SD.....AMLDRL.AL.T.....DSVIESMVKGLKE..VI.ALP.
 179 ..R....EKG....L.....DA.....AFVDRL.TL.S.....DKALKTMVEGLRQ..VA.SLA.
 180 ..K....DNG....I.....SE.....IMVDRL.RL.N.....KDRIQAIANGIYQ..VA.DLA.
 181 ..R....ENG....L.....SE.....SIIDRL.LL.T.....KERLTGIADDVRH..VI.SLA.
 182 ..E....EAG....L.....SA.....SFMDRL.KL.T.....PARIRAMADGIRE..IA.ELK.
 183 ..K....AEG....L.....ND.....AMIDRL.LL.N.....ESRLAGIIGDISD..VV.RLA.
 184 ..K....QNE....L.....SD.....ALIDRL.LL.T.....QERLQGIANDVRH..VI.SLA.
 185 ..K....QNG....L.....SD.....AFIDRL.LL.T.....QERLQGIANDVRH..VI.SLA.
 186 ..E....TDG....M.....DA.....GKLDRL.KF.D.....QQRITAAAQGVRH..VA.SLP.
 187 ..R....QMG....L.....SE.....TLLDRL.KL.T.....PQRLEGMALSLEQ..IA.ALK.
 188 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 189 ..E....AKG....M.....KE.....SLVDRL.RL.T.....KDRVEGMIKGIQT..II.ELK.
 190 ..K....ADG....M.....TG.....SFLDRL.TL.T.....PARIAAMAEGVEQ..VA.ALS.
 191 ..R....EEG....L.....DD.....ALIDRL.VL.N.....PDRITKMADALRD..VA.SFA.
 192 ..K....AKG....F.....SD.....SLLDRL.ML.T.....ENRIIDMTEGIKQ..LI.ELR.
 193 ..I....QKG....T.....KK.....SLVNRL.AL.T.....SEGIRQMSDALKE..VV.NLG.
 194 ..R....DKG....L.....SS.....AMMDRL.ML.D.....EARIQGIVDGLRA..VA.AQA.
 195 ..R....KKG....Y.....DA.....AYIDRL.SL.N.....EDRVLDFADGLLE..VA.ELD.
 196 ..Q....EHG....I.....SA.....IMVDRL.RL.D.....EKRLQDIASGVRD..VA.ALG.
 197 ..E....AKG....L.....SK.....AMLDRL.ML.N.....PARVEAMAKGLED..IA.RLP.
 198 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 199 ..K....QNG....L.....SD.....ALIDRL.LL.T.....QERLQGIANDVRH..VI.SLA.
 200 ..K....AKG....F.....SD.....SLLDRL.ML.N.....EQRIIDMAEGIKQ..LI.ELR.
 201 ..T....--Q....M.....PT.....KFTDRL.MV.N.....SQRIADMANGLRT..IA.DLN.
 202 ..E....KNG....M.....AA.....SFVDRL.TL.N.....EARIDAIAEGIRA..IA.TLP.
 203 ..T....AKG....L.....SA.....SMLDRL.ML.N.....SARIEAMAKGLED..IA.RLP.
 204 ..T....AKG....L.....SP.....AMMDRL.KL.D.....AGRIGGVVEGLRA..VA.AQK.
 205 ..K....QNG....L.....SD.....ALIDRL.LL.T.....QERLQSIANDVRH..VI.SLA.
 206 ..E....KNG....M.....AA.....SFVDRL.TL.N.....EARIDAIAEDIRA..IA.TLP.
 207 ..R....EKG....L.....SD.....AMLDRL.ML.D.....EARVEGIVTGLRA..VA.GQE.
 208 ..K....EAG....L.....TD.....ALLDRL.LL.T.....AERLAGMCQDIEQ..LI.ALS.
 209 ..R....AAG....T.....AG.....AMVDRL.TL.T.....PARLAGMADGLRQ..VA.ALE.
 210 ..E....KNG....M.....AA.....SFVDRL.TL.N.....EARIDAIAEGIRA..IA.TLP.
 211 ..A....EKG....L.....TP.....AMMDRL.KL.D.....AARIDGIVEGLRA..VA.GQP.
 212 ..K....EKG....F.....SP.....ALLDRL.AL.T.....PERLNDIADAVML..LT.KLE.
 213 ..E....KNG....M.....AA.....SFVDRL.TL.N.....EARIDAIAEGIRA..IA.TLP.
 214 ..R....AGG....M.....VD.....GLIDRL.TL.T.....PERVAAVAEAVRD..IA.ALP.
 215 ..E....EKG....L.....SP.....AMLDRL.KL.D.....PARIRAMAEGLRS..VA.AQA.
 216 ..Q....AAG....L.....SK.....AKLDRL.RL.D.....EKVLRDLRTGLQQ..VA.EMP.
 217 ..A....EKG....L.....TP.....AMMDRL.KL.D.....AARIDGIVEGLRA..VA.GQP.
 218 ..R....ANG....L.....SE.....AMLDRL.AL.T.....PARLKGIADDVRQ..VC.NLA.
 219 ..R....DKG....L.....SD.....AMMDRL.LL.D.....DARISAIADSLRS..IA.AQD.
 220 ..R....AAG....T.....PS.....AMLDRL.AL.D.....TKRVEGIAAGLRQ..VA.GLP.
 221 ..K....NQG....I.....ST.....AIIDRL.LL.N.....ESRLQGIANDVRN..VA.KLA.
 222 ..A....EAG....M.....DA.....PRMDRL.RL.T.....PATIAEMAAACRH..VA.ALP.
 223 ..R....QAG....L.....SE.....AMLDRL.LL.N.....ESRLNGIANDVRN..VI.SLT.
 224 ..R....AKG....L.....TD.....ALLDRL.EL.T.....PARIEAMAKGLED..IA.ALP.
 225 ..T....--Q....M.....PT.....KFTDRL.MV.N.....SQRIADMANGLRT..IA.DLT.
 226 ..R....DKG....L.....SD.....AMMDRL.LL.D.....DARISAIADSLRS..IA.AQD.
 227 ..R....ESG....V.....AS.....AFIDRL.TL.T.....ESRIRDMADGIRA..IA.ELI.
 228 ..I....QKG....T.....KK.....SLVNRL.AL.T.....SEGIRQMSDALKE..VV.NLG.
 229 ..R....QAG....L.....SE.....AMLDRL.LL.N.....ESRLNGIANDVRN..VI.SLT.
 230 ..N....AEG....I.....PK.....PLYKRL.QL.D.....EHKLRDAIVGVQD..VG.KLD.
 231 ..T....AEG....I.....AK.....PLYKRL.QL.D.....EHKLRDAIAGVRD..VG.KLA.
 232 ..E....DKG....Rl....AA.....PLLKRL.SL.S.....TAKLNSLSIGLRQ..IAaSSQ.
 233 ..T....SKG....L.....SP.....AMMDRL.ML.D.....EIRIQGIVDGLRA..VA.EQA.
 234 ..R....EAG....L.....TD.....ALLDRL.LL.N.....EERLTAIANDVRN..VI.SLN.
 235 ..R....AAG....T.....SE.....AIVDRL.TL.T.....PERVRAIASDVRD..VV.ALP.
 236 ..K....QKG....T.....PE.....TMIDRL.RL.T.....EERIKEISEAVKQ..VV.ALK.
 237 ..T....AEG....I.....AK.....PLYKRL.QL.D.....EHKLRDAIAGVRD..VG.KLA.
 238 ..E....AMG....I.....AK.....PLYNRL.LL.G.....ESKLKSTIAGVKD..VE.HLP.
 239 ..V....QSG....L.....AA.....PMVDRL.KL.S.....PQVIETCAQGCEQ..LA.GMA.
 240 ..Q....QKG....T.....PE.....TMIDRL.RL.T.....EERIKEISEAVKQ..VV.ALK.
 241 ..Q....KRG....L.....TP.....DIIDRL.TL.D.....EKRLLDIADAVEL..LI.GLE.
 242 ..R....ESG....M.....TD.....ALIDRL.LL.N.....EERLTGIANDVRN..VI.SLN.
 243 ..E....AAG....L.....SA.....AILDRL.KL.D.....EKRVRAIAEGIRA..IA.DLD.
 244 ..K....AAG....K.....PA.....AFIDRL.IL.D.....EERVGAIADALDK..IA.ELP.
 245 ..E....NNQ....S.....SS.....AMVDRL.RL.T.....EARLENMASALEV..IA.HLE.
 246 ..V....AKG....L.....PA.....AKVDRL.RL.D.....AKVLEEMACGLKE..VA.RLS.
 247 ..T....AEG....I.....AK.....PLYKRL.QL.D.....EHKLRDAIAGVRD..VG.KLA.
 248 ..E....TDG....I.....AK.....PLYNRL.KM.D.....EAKLNSAIEGLRN..VA.TLR.
 249 ..R....ADN....L.....PD.....AMLDRL.ML.N.....EERIEAMATGIET..IA.TLP.
 250 ..R....TQQ....V.....GT.....AMLDRL.AL.D.....PQRLAAMADALRD..IA.ALP.
 251 ..E....KEG....I.....SR.....PLYNRL.KL.G.....KTKLEATIKGVRD..VI.NLS.
 252 ..K....QSG....L.....TE.....AMIDRL.ML.D.....EGRLGGIIADIDN..VI.ALA.
 253 ..E....DKGr...L.....AP.....PLLKRL.SL.S.....TAKLNSLAIGLRQ..IAaSSQ.
 254 ..R....ING....L.....ND.....AIIDRL.LL.T.....PERLRGIANDVRH..VI.SLA.
 255 ..R....EQG....L.....SP.....ALLDRL.QL.T.....NERLDQIIDGVRQ..VA.SLP.
 256 ..R....TQQ....V.....GT.....AMLDRL.AL.D.....PQRLAAMADALRD..IA.ALP.
 257 ..T....ADN....V.....AP.....AMLDRL.TL.T.....PERVEAMALGIET..IA.ALP.
 258 ..E....AAG....T.....EA.....SLLDRL.RL.T.....KARIDGIASGLRQ..VA.GLP.
 259 ..ErmknEGK....L.....SQ.....ALVDRL.KV.T.....DPKIDGMISGIRD..VI.KLE.
 260 ..K....GSG....A.....NS.....AFLDRL.TL.T.....PARVEAMAEGIAV..VR.GIA.
 261 ..Q....RAG....I.....SQ.....TLLDRL.LL.T.....DERVQAMAEGVEQ..VI.ALD.
 262 ..R....ASSn...M.....TA.....SFIDRL.TL.T.....PARVESMAEGIGI..VR.GIA.
 263 ..R....TQQ....V.....GT.....AMLDRL.AL.D.....PQRLAAMADALRD..IA.ALP.
 264 ..R....EAG....L.....SD.....AMLDRL.LL.N.....ESRLQAIANDVRN..VI.KLN.
 265 ..R....ESG....M.....TE.....ALIDRL.LL.N.....EDRLIGIANDVRN..VI.SLN.
 266 ..R....EAG....L.....SD.....AMLDRL.LL.N.....ESRLQAIANDVRN..VI.KLN.
 267 ..R....EAG....L.....SD.....AMLDRL.LL.N.....ESRLQAIANDVRN..VI.KLN.
 268 ..E....KAD....L.....GA.....AMIDRL.TL.T.....PERIESMAAGIET..VA.SLP.
 269 ..K....AKG....F.....SD.....SLLDRL.ML.N.....EQRIVDMTEGIKQ..LI.ELR.
 270 ..R....AGG....A.....TS.....AFVDRL.TL.T.....QARIDAMADGVKV..VR.AID.
 271 ..K....AKG....F.....SD.....SLLDRL.ML.N.....EQRIVDMTEGIKQ..LI.ELR.
 272 ..R....EAD....T.....PA.....AMLDRL.SL.N.....PQRVDGIAAGLRQ..VA.GLR.
 273 ..E....SAG....L.....AA.....SFVDRL.TL.N.....DARIAGIAEGIRS..VA.ALA.
 274 ..E....SAG....L.....AA.....SFVDRL.TL.N.....DARIAGIAEGIRS..VA.ALA.
 275 ..E....EKG....L.....SP.....AMMDRL.ML.D.....QGRVRAIVDGLRA..VA.EQT.
 276 ..E....EAG....L.....PG.....PMIARL.RL.D.....EGKLAGVIRGVRA..VA.ELP.
 277 ..R....DNN....L.....DD.....AMLDRL.LL.T.....PQRIQGIANAVFD..IA.AQA.
 278 ..L....ESG....M.....SD.....ALVDRL.LL.N.....ESRLAGIANDVRN..VI.NLN.
 279 ..E....EDN....L.....GS.....AMLDRL.LL.T.....PERIEAMAQGIET..IV.SLP.
 280 ..E....IKG....I.....SK.....SLLSRL.KL.S.....KEKLNLGIEGVRQ..VG.NLI.
 281 ..V....SKG....L.....SP.....AMLDRL.RL.D.....EERIRGIMDGLRT..VA.EQR.
 282 ..T....TEG....I.....AP.....ALYARL.KL.D.....ADKLAAAIAGVRD..LA.QLP.
 283 ..A....DRG....L.....DA.....PRMDRL.RL.T.....DAVIEEMARACEF..VA.GLP.
 284 ..-....--G....L.....DG.....SLRDRL.LL.T.....PERIATMAEGLRE..VA.ALA.
 285 ..R....AGG....A.....TA.....AFLDRL.TL.T.....QARVEAMADGVKV..VR.EID.
 286 ..R....EAG....L.....TD.....ALLDRL.LL.N.....EERLTAIANDVRN..VI.SLN.
 287 ..R....AGG....A.....TA.....AFLDRL.TL.T.....QARVEAMADGVKV..VR.EID.
 288 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 289 ..E....QAG....L.....SH.....AMIDRL.TL.D.....GDRIEAMAHGIEI..IA.TLP.
 290 ..R....ASG....L.....GD.....AMVDRL.LL.N.....DDRLKGIIADIDN..VI.SLA.
 291 ..R....ATD....T.....LA.....ATLDRL.AL.D.....RQRIDQIAGGLRQ..VA.ALP.
 292 ..A....ANG....L.....SA.....AMLDRL.KL.D.....EDRIAGAAAGVEQ..VA.ALP.
 293 ..R....ENG....L.....ND.....AMIDRL.LL.D.....ESRLSGVIADIEN..VV.ALA.
 294 ..K....KKG....L.....SE.....AVIDRI.RL.N.....EERLQDIADAILQ..VT.ILT.
 295 ..A....QNN....L.....NV.....AMVDRL.KL.D.....KVRLCTIIDSVRQ..VA.CLP.
 296 ..Q....ASG....L.....KG.....SMLERL.AL.D.....GPKIAGMARAIEE..IA.MLR.
 297 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 298 ..E....GSE....T.....LA.....SFVDRL.TL.N.....DKRIAEMAEGIRA..IA.ALA.
 299 ..R....DKG....L.....SE.....AMMDRL.AL.D.....EARIQGIVDGLRA..VA.AQD.
 300 ..R....AKG....T.....AS.....AMLDRL.AL.D.....DKRLAGIAAALRE..VA.LLP.
 301 ..R....AKG....T.....AS.....AMLDRL.AL.D.....DKRLAGIAAALRE..VA.LLP.
 302 ..L....ESG....M.....SD.....ALVDRL.LL.N.....ESRLAGIANDVRN..VI.NLN.
 303 ..R....EAG....L.....TD.....ALLDRL.LL.N.....EERLTGIANDVRN..VI.SLN.
 304 ..R....AKG....T.....AS.....AMLDRL.AL.D.....DKRLAGIAAALRE..VA.LLP.
 305 ..R....AKG....T.....GS.....AMLDRL.AL.D.....DKRMAGIAAALRE..VA.QLP.
 306 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 307 ..R....TQQ....V.....GT.....AMLDRL.AL.D.....PQRLAAMADALRD..IA.ALP.
 308 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 309 ..A....EAG....M.....AA.....SFVDRL.TL.T.....PDRINAMAEGLRA..IA.ALP.
 310 lkK....VGK....L.....TQ.....ALVDRL.KV.T.....DSKIDGMIAGIMD..VI.KLK.
 311 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 312 mvK....AGE....L.....SA.....SAYARL.KL.D.....AHKLADMVAGVRQ..VI.RLG.
 313 ..I....DNG....M.....NA.....GLLDRL.RL.D.....HDRIEAIATSVGT..II.DLD.
 314 ..K....AAG....T.....TS.....AFLDRL.TL.T.....PARVEAMAEGIAV..VR.GIA.
 315 ..R....TQQ....V.....GT.....AMLDRL.AL.D.....PQRLAAMADALRD..IA.ALP.
 316 ..K....ENG....L.....TP.....DIIDRL.SL.D.....EKRIRDIADAVEL..LI.DLA.
 317 ..I....ENG....L.....SE.....SLLSRL.KL.N.....ENKLDAAIEGVRK..VA.CLP.
 318 ..E....RSG....A.....TA.....AYLDRL.RL.D.....ANRVAAIAADVRK..VA.ALP.
 319 ..R....AAG....T.....PD.....AMLDRL.AL.N.....PQRIDGVAAGLRQ..VA.SLP.
 320 ..R....TEG....L.....AS.....ALMARL.RL.D.....ESKLNSAIEGLRQ..LA.QLT.
 321 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 322 ..K....ANQ....L.....NA.....SLYARL.EL.S.....PSKLAAAIAGVRQ..VA.ALP.
 323 lkK....AGK....L.....TQ.....ALVDRL.KV.T.....DSKVDGMIAGIRD..VI.KLK.
 324 ..R....DSG....M.....AE.....GLQDRL.RL.S.....TARIEQLSAAVRD..II.DLA.
 325 ..R....AAG....T.....SA.....ALVDRL.TL.T.....PERIEAMADGLRQ..VA.ALE.
 326 ..R....AKG....T.....GS.....AMLDRL.AL.D.....DKRLAGIAAALRE..VA.QLP.
 327 ..L....EHG....I.....SE.....IMDDRL.RL.N.....AQRISDMATGLRQ..VA.ELP.
 328 ..R....EKG....T.....GA.....AMLDRL.TL.T.....PARLSAVGAALRE..VA.VLP.
 329 ..T....QDN....L.....SP.....AMVDRL.TL.N.....QHRIEAMAQGIET..IA.ALP.
 330 ..E....RTG....L.....PK.....AKLDRL.AL.K.....EKDLKTLTEGLRQ..IA.RLP.
 331 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 332 ..R....EAG....L.....TD.....ALLDRL.LL.N.....EERLTGIANDIRN..VI.SLN.
 333 ..R....AAG....L.....TD.....ALLDRL.LL.N.....EERLTGIANDVRN..VI.SLN.
 334 ..E....GRL....A.....AP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 335 ..R....AAG....T.....PE.....AMLDRL.AL.N.....PARVEGIADGLRQ..VA.GLP.
 336 ..K....KNS....L.....SL.....ALMDRL.LL.D.....EVRIEAMAVAIEE..IA.ALK.
 337 ..T....QDN....L.....SP.....AMVDRL.TL.N.....QHRIEAMAQGIET..IA.ALP.
 338 ..A....QNN....M.....AA.....AMIDRL.KL.D.....ELRLCAMIDSVRQ..IA.CLP.
 339 ..Q....KKG....I.....SK.....ALLSRL.KL.S.....KEKLNSGIEGVRK..VG.DLA.
 340 ..V....NTGr...L.....SP.....AMLKRL.SL.S.....SSKLNSLSIGLRQ..IAvSSQ.
 341 ..R....AGG....A.....TA.....AFVDRL.TL.T.....QARVEAMADGVKV..VR.EID.
 342 ..E....KEG....L.....NK.....SLLSRL.QL.T.....KTKLKGCIDGVLK..VS.NLA.
 343 ..K....AAG....I.....TS.....SFLDRL.TL.T.....PARVAAMADGIAA..VR.EVA.
 344 ..E....ANG....V.....SG.....PMLDRL.AL.D.....AARLEGVAAGVEA..VA.AVP.
 345 ..N....ASG....A.....NS.....AFLDRL.TL.T.....PARVEAMAEGIAV..VR.GIP.
 346 ..K....KNG....L.....SD.....HLIDRL.LL.T.....KARIDAMATAIDH..LI.ELP.
 347 ..Q....TNG....L.....SG.....AMLDRL.RL.D.....EGRLAAIADAIEA..VA.ALP.
 348 ..E....RTG....L.....PK.....AKLDRL.AL.K.....EKDLKTLTEGLRQ..IA.RLP.
 349 ..R....EKG....T.....GA.....AMLDRL.TL.T.....PARLSAVGAALRE..VA.VLP.
 350 ..H....EAG....Y.....ES.....ALVSRL.TL.K.....PGKIASLAKSVRT..LA.NME.
 351 qvK....AGE....L.....SA.....SAYARL.KL.D.....AQKLADAVAGVRQ..VL.RLP.
 352 ..K....ENG....M.....DA.....GKLDRL.LF.D.....VPRVAAAAQGVRH..VA.TLP.
 353 ..H....EAG....Y.....ES.....ALVSRL.TL.K.....PGKIASLAKSVRT..LA.NME.
 354 ..K....ENG....M.....DA.....GKLDRL.LF.D.....VPRVAAAAQGVRH..VA.TLP.
 355 ..R....SSG....T.....PE.....AMLDRL.AL.T.....PARVEGIADGLRQ..VA.GLP.
 356 ..I....QDN....L.....SS.....AMVDRL.TL.N.....QHRIEAMAQGIET..IA.ALP.
 357 ..M....AEG....L.....AQ.....ALVARL.KL.D.....AGKLAGAIDGVRQ..VA.ALP.
 358 ..I....NTGs...L.....SA.....AMLKRL.SL.S.....PSKLNSLAIGLRQ..IA.VAAq
 359 ..Q....YAG....Y.....DR.....SLVARL.AM.N.....PDKISSLAKSIRV..LA.DME.
 360 ..K....ENG....M.....DA.....GKLDRL.LF.D.....VPRVAAAAQGVRH..VA.TLP.
 361 ..R....AGG....A.....TD.....AFIDRL.TL.T.....EARVAVMADGIGV..IH.DIA.
 362 ..S....TDN....I.....SP.....AMLDRL.TL.N.....PARVEAMAQGIET..IA.ALP.
 363 ..R....AGG....A.....TD.....AFIDRL.TL.T.....EARVAVMADGIGV..IH.DIA.
 364 ..T....QNN....L.....TV.....AMVDRL.KL.N.....EVRLCTIIDSVRQ..VA.CLP.
 365 ..Q....EAG....Y.....EE.....SLVARL.VM.K.....PGKISSLAASIRQ..LA.EME.
 366 ..Q....EAG....Y.....EK.....SLVARL.VL.K.....SEKIVGLANNIRI..IA.NME.
 367 ..-....AGK....I.....PD.....SMTDRL.LL.D.....GKRICAMADGIRA..VA.ALP.
 368 ..Q....QAG....Y.....EK.....SLISRL.AL.N.....PGKISSLANSVRV..LS.NMD.
 369 ..Q....VAG....Y.....EK.....PLVARL.TI.K.....PGKIASLAKSIRT..LA.NME.
 370 ..Q....VAG....Y.....EK.....PLVARL.TI.K.....PGKIASLAKSIRT..LA.NME.
 371 ..T....ADN....I.....SP.....AMLDRL.TL.N.....PARVEAMAQGIET..IA.ALP.
 372 ..A....AEG....L.....AP.....ALMARL.KL.D.....AAKLGGAIDGVRK..VA.SLR.
 373 ..Q....DIG....Y.....DK.....SLVARM.TI.K.....PGKIKSLAGSIRE..IA.DME.
 374 ..Q....G-K....I.....SQ.....VMQDRL.LL.T.....AERIEAMADGIRA..LI.GLP.
 375 ..R....DNN....L.....AA.....AMVDRL.TL.N.....DERVEAMAEGIEV..IV.SLD.
 376 ..K....ASG....A.....SS.....AFIDRL.TL.T.....PARIAAMADGIKV..IH.DIA.
 377 ..L....SED....R.....NA.....AFRDRL.TL.T.....PERVEAMARGLED..VA.GLP.
 378 ..E....-GK....K.....DE.....AFIDRL.KL.D.....EARVEGMASALEQ..IA.ELP.
 379 ..R....ANG....T.....SA.....ALLDRL.TL.N.....DARIEALAAALEN..LA.GLP.
 380 lkK....KGK....L.....TQ.....ALVDRL.KV.S.....DSKIDGMIAGIRD..VI.KLK.
 381 ..E....KKG....I.....SR.....ALLSRL.KL.S.....KAKLNSGIEGVRK..VG.DLA.
 382 ..V....EAG....I.....SE.....AMQDRL.LL.T.....EERLVGIANDVRN..VI.NLN.
 383 ..A....AEG....L.....AP.....ALMARL.KL.D.....AGKLRGAIDGVRK..LA.SLP.
 384 ..K....KSG....L.....AK.....PLLSRL.SL.T.....PSKLESLAKGLKQ..IAdDSH.
 385 ..E....QEG....L.....NQ.....ALLSRL.KL.T.....EEKLRISIEGIRQ..VA.SLS.
 386 ..R....ENG....L.....ST.....GLLDRL.TL.T.....PARLQGLADAVLE..IV.ALT.
 387 ..A....GEG....L.....AP.....ALMARL.KL.D.....DTKLAAAIDGVRK..VA.SLS.
 388 ..A....ADQ....L.....AP.....ALVARL.KL.D.....GAKLAGAIEGVRQ..LA.ELP.
 389 ..E....ANG....T.....PP.....NIVDRL.RL.T.....QERVAAMAQGLRD..VA.ALP.
 390 ..Q....VAG....Y.....EK.....PLVARL.TI.K.....PGKIASLAKSIRT..LA.NME.
 391 ..E....KGG....T.....PP.....AIVDRM.LL.T.....PARLAAIAGDCRQ..VA.SLP.
 392 ..E....KTG....L.....AK.....ALLSRL.SL.T.....PAKLKSLSSGLRQ..IAnDSL.
 393 ..K....KSG....V.....AK.....PLLSRL.SL.T.....PAKIESLAVGLKQ..IAdDSH.
 394 ..E....KDG....L.....GA.....AMIDRL.TL.N.....EERVESMAAGIET..IV.SLP.
 395 ..Q....QAG....Y.....EK.....SLISRL.AL.K.....SGKISSLAKSIRV..LA.NME.
 396 ..K....ENG....L.....SD.....AIIDRL.LL.T.....KERINSIANDVRH..II.SLP.
 397 ..A....ANG....L.....SS.....AMLDRL.KL.T.....PERLAGIADAVAQ..VA.GLA.
 398 ..Q....KNG....L.....AK.....PLLSRL.SL.N.....SAKLKNLAIGLKQ..IAeDSH.
 399 ..I....KNG....L.....SD.....ALLDRL.LL.D.....APRLAGIISDLRQ..VI.ALK.
 400 ..Q....EAG....L.....EE.....SMVARL.VM.T.....PGKISSLAASVRK..LA.DME.
 401 ..R....EAG....L.....SD.....AMLDRL.LL.N.....ESRLQAIANDVRN..VI.KLN.
 402 ..Q....EAG....L.....EE.....SMVARL.VM.T.....PGKISSLAASVRK..LA.DME.
 403 ..Q....EAG....L.....EE.....SMVARL.VM.T.....PGKISSLAASVRK..LA.DME.
 404 ..R....EKG....L.....SQ.....AMLDRL.VL.T.....DKGIKDMSSAIRE..IV.ALT.
 405 ..A....QKG....L.....SP.....AMMDRL.VL.T.....EPRIRAMAEGLRN..VA.AQH.
 406 ..R....AAG....Q.....NA.....AYLDRL.KL.D.....PKRLAGIAASLRE..IA.GLR.
 407 ..Q....EAG....L.....EE.....SLVARL.VM.T.....PAKISSLAASVRK..LA.DME.
 408 ..-....-EH....L.....PL.....AMRKRL.EL.N.....SIKVHSMADSMRD..IA.KLH.
 409 ..E....ANG....L.....TK.....AMLDRL.KL.D.....EERLEGIASAVEA..VA.NLP.
 410 ..K....EKK....L.....SS.....ALMDRL.LL.N.....EKRIFSMASAVRE..IA.ALP.
 411 ..R....DAG....M.....DE.....ALLDRL.TL.T.....PERIEGMAVGLEG..VA.HLD.
 412 ..K....EKK....L.....SS.....ALMDRL.LL.N.....EKRIFSMASAVRE..IA.ALP.
 413 ..K....ENG....L.....SD.....AIIDRL.LL.T.....KERINSIAKDVRH..II.SLS.
 414 ..-....AGN....I.....PE.....SMTDRL.LL.D.....GKRICAMADGIRA..VA.ALP.
 415 ..K....EAG....Y.....EK.....SLVARL.VL.K.....NEKLASLANNIRI..IA.NME.
 416 ..K....G-K....I.....SD.....VMLDRL.YL.D.....ADRIEAMARGIRE..VV.ALP.
 417 ..T....--Q....L.....SG.....PMRNRL.TL.D.....QKTIGGIAASLSA..VA.KLA.
 418 ..Q....KSG....L.....AK.....PLLSRL.SL.N.....PAKLKNLSVGLKQ..IAeDSH.
 419 ..T....KSG....-.....--.....AMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 420 ..V....LAG....Y.....EN.....SLISRL.TL.K.....HEKISKLAKSVRM..LA.AME.
 421 ..A....ADG....T.....SP.....HLLDRL.RL.D.....PQRVAAVAAAVRE..VA.ALP.
 422 ..T....KSG....-.....--.....AMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 423 ..T....KSG....-.....--.....KMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 424 ..T....KSG....-.....--.....AMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 425 ..Q....EAG....L.....EE.....SMVARL.VM.T.....PGKISSLAASVRK..LA.DME.
 426 ..-....-QD....L.....SS.....ALKDRL.KL.T.....SKSIENLCNSIKN..IA.NLK.
 427 ..K....SAN....L.....SP.....SLIKRL.DLsT.....GDKYDSMLQGILD..VA.SLD.
 428 ..K....G-K....I.....SD.....VMLDRL.YL.D.....ADRIEAMARGIRE..VV.ALP.
 429 ..Q....EAG....F.....EE.....SLVARL.VM.T.....PGKISSLAASVRK..LA.EME.
 430 ..T....KSG....L.....AK.....PLLSRL.SL.T.....PAKLRNLSVGLKQ..IA.DSSh
 431 ..EemleAGE....Y.....SQ.....ALVDRL.KL.S.....DAKLDSIIEMVRS..VA.GQE.
 432 ..-....AGN....I.....PE.....SMTDRL.LL.D.....GKRICAMADGIRA..VA.ALP.
 433 ..T....KSG....-.....--.....AMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 434 ..V....KGN....L.....SS.....SLVKRL.DLsN.....SGKFDTMLQGILD..VA.NLP.
 435 ..K....DNG....I.....SE.....IMVDRL.RL.N.....KDRIQAIANGIYQ..VA.DLA.
 436 ..E....AEG....L.....AS.....ALMARL.KL.D.....ATKLQAAIDGVRK..VA.SLP.
 437 ..T....KSG....-.....--.....AMKDRL.LL.D.....EKRILALCEGLEK..IA.YIE.
 438 ..Q....SQN....L.....SS.....SLIKRL.DLsN.....PGKYDSMLQGILD..VA.QLP.
 439 ..Q....EAG....Y.....EK.....SLVARL.VL.K.....SEKIVGLANNIRI..IA.NME.
 440 ..R....ESG....M.....AE.....SLIDRL.AL.D.....EGRIEGIAGGLRQ..VA.GLT.
 441 ..Q....GAE....R.....PD.....SFIDRL.RL.N.....EERIEGMAAALEQ..IA.ELP.
 442 ..N....KNN....I.....SE.....PMKMRL.LL.D.....ESKLKACISSVRD..VM.NLE.
 443 ..K....SAG....L.....DP.....QLLNRL.KM.T.....PEKIQDLHAGLNT..IA.DSAe
 444 ..K....SSG....I.....DP.....QLLNRL.KM.T.....PEKIQDLHAGLNT..IA.DSAe
 445 ..R....ANG....M.....EE.....SMIDRL.AL.D.....ESRIEGIAGGLRQ..VA.GLT.
 446 ..N....KNN....I.....SE.....PMKMRL.LL.D.....ESKLKACISSVRD..VM.NLE.
 447 ..K....SAG....L.....DP.....QLLNRL.KM.T.....PEKIQDLHAGLNT..IA.DSAe
 448 ..R....LSN....M.....TG.....PNLSRL.AL.T.....DAKLKSLSDGLRQ..IA.ATSh
 449 ..R....LDG....V.....VG.....AMYSRL.AF.S.....PQKIQALATGLKQ..IA.ATSy
 450 ..R....ARG....L.....SE.....ALIDRL.SL.D.....SARIAGIAGGLRQ..VA.ALS.
 451 ..K....ERG....F.....AD.....SLLDRL.AL.D.....TERISGIAGGLRQ..VI.GLS.
 452 ..R....LDG....V.....VG.....AMYSRL.AF.S.....PQKIQALATGLKQ..IA.ATSy
 453 ..R....LDG....V.....VG.....AMYSRL.AF.S.....PQKIQALATGLKQ..IA.ATSy
 454 ..Q....EAG....Y.....EE.....SLVARL.VM.K.....PGKISSLAASVRQ..LA.EME.
 455 ..R....ANG....M.....EE.....SMIDRL.AL.D.....ESRIEGIAGGLRQ..VA.GLT.
 456 ..K....LLAesgkL.....SS.....SMVKRLdLS.S.....SDKYDSMVQGVLD..VK.SLP.
 457 ..Q....EAG....Y.....EE.....SLVARL.VM.K.....PGKISSLAASVRQ..LA.EME.
 458 ..Q....KAA....Adgkl.SQs....LVSRLD.LS.R.....KGKWEDMLKGILD..VR.DLE.
 459 ..T....KSG....-.....--.....AMRDRL.LL.D.....KKRIFSLCDALEK..IA.YLE.
 460 ..Y....GAS....L.....SR.....PMQKRL.TL.D.....SDALTAIAESLAA..VA.TLP.
 461 ..R....AGG....L.....AD.....SLVKRL.DL.Fk....GDKFDVMLQGISD..VA.DLE.
 462 ..Q....LAG....Y.....EK.....SLVSRL.VL.K.....PGKISSLANSIRV..LA.NME.
 463 ..E....G--....-.....PP.....AMRDRL.LL.N.....EARIEAIAAGIDA..IA.DLP.
 464 ..E....RTG....L.....PK.....AKLDRL.AL.K.....EKDLKTLTEGLRQ..IA.RLP.
 465 ..E....RS-....-.....-N.....PMYDRL.LL.D.....EKRLEGIAADMRN..VA.SLP.
 466 ..S....QAAnngsLs....HS.....VLKRLD.LS.R.....PGKYDDMLKGILS..VR.DLE.
 467 ..T....QAV....NggslnHS.....VLKRLD.LS.R.....PGKYDDMLQGILS..VR.SLR.
 468 ..V....ESN....L.....AP.....SLLKRL.EL.T.....HGKIDTVVSGIKA..IA.EDK.
 469 ..R....EAG....L.....AA.....PLVARL.AL.S.....EHLLEDMLRSLTV..LS.LQR.
 470 ..R....EAG....L.....AA.....PLVARL.AL.S.....EHLLEDMLRSLTV..LS.LQR.
 471 ..-....--D....P.....AD.....PMFDRL.LL.N.....EKRLEIIAADIRN..VA.TLP.
 472 ..-....--D....P.....AD.....PRYDRL.LL.N.....EARLNSIATDLRN..VA.ALP.
 473 ..L....NKG....L.....KS.....NLIERL.TI.D.....EKKLIGIKNSINK..IA.KLK.
 474 ..S....RAA....A.....SGnlsqsILKRLD.LS.R.....PGKYDDMLKGILD..VR.DLQ.
 475 ..-....--D....K.....SN.....PKYDRL.KL.T.....EERLKGIAADTRN..VA.TLP.
 476 ..E....AAR....L.....PA.....HMVARL.RL.D.....AASLAAIADDVAA..VA.QLP.
 477 ..L....EQD....-.....--.....PRYDRL.LL.N.....KERILSLVNDVRK..VA.NLP.
 478 ..D....PND....-.....--.....PKYDRL.LL.T.....EERLKAIAADIEN..VV.TLP.
 479 ..-....--D....P.....AD.....PMVDRL.LL.N.....ASRLDAIAADIRN..VA.SLP.
 480 ..KkaaaEGG....L.....SQ.....ALVSRL.DLgK.....KGKWEDMLKGILD..VR.DLN.
 481 ..S....PDN....-.....--.....PKYDRL.RL.T.....EERLRGIASDIRN..VA.TLP.
 482 ..L....NKG....L.....KS.....NLIERL.TI.D.....EKKLIGIKNSINK..IA.KLK.
 483 ..L....EQD....-.....--.....PRYDRL.LL.N.....KERILSLANDVRK..VA.SLP.
 484 ..-....--D....S.....AN.....PMVDRL.LL.N.....EARLQAIAADIRN..VA.SLP.
 485 ..R....QAA....A.....DG.....KLSASL.VS.RldlgkTGKWEDMLKGIWD..VR.DLE.
 486 ..L....EQD....-.....--.....PRYDRL.LL.N.....KERILSLANDVRK..VA.SLP.
 487 ..TkavnEGT....L.....SQs....ILKRLD.LS.R.....PGKYDDMLQGILD..VR.SLE.
 488 ..D....PND....-.....--.....PKYDRL.LL.S.....TSRLESIASDIRN..VA.ELP.
 489 ..E....AAG....L.....PA.....PLVDRL.RL.S.....AGALAAIARDVEA..VA.ALP.
 490 ..K....ETG....L.....AD.....SLLKRL.DL.Fk....GDKFEVMLQGIKD..VA.ELE.
 491 ..R....-DD....L.....SL.....PMQKRL.QL.S.....KEKISTIASSLKA..LV.KLA.
 492 ..K....ETG....L.....AD.....SLLKRL.DL.Fk....GDKFEVXLQGIKD..VA.ELE.
 493 ..-....--D....P.....AD.....PKYDRL.LL.T.....KERLEAIAGDIRN..VA.ALS.
 494 ..K....STN....L.....SD.....SLVKRL.DL.Fk....GDKFETMLQGIVD..VA.NLQ.
 495 ..E....---....R.....SS.....PMYDRL.LL.N.....EKRLEGIAADIRN..VA.SLP.
 496 ..Q....KRG....L.....TP.....DIIDRL.TL.D.....EKRLLDIADAVEL..LI.GLE.
 497 ..E....ALA....AtgklsSS.....LVSRLD.LG.R.....PGKFEAMLQGITD..VA.ALP.
 498 ..K....ANA....T.....AD.....PLLRRL.EL.T.....PSKLATLIEGIST..LA.DMP.
 499 ..E....ALA....AtgklsSS.....LVSRLD.LG.R.....PGKFEAMLQGITD..VA.ALP.
 500 ..A....QNN....L.....AP.....ALVQRL.NL.Fk....GDKFEAMLQGILD..VA.ALE.
 501 ..T....ASGh...F.....SQ.....ALINRL.SL.S.....SAKLNSLAIGLRQ..LAvSSK.
 502 ..K....ENG....L.....TP.....DIIDRL.SL.D.....EKRIRDIADAVEL..LI.DLA.
 503 ..E....WTS....Y.....YE.....EVAHVL.DE.I.....DFTIKGLSDWAED..--.---.
 504 ..E....WTS....Y.....YE.....EVAHVL.EE.L.....DTTIKELPDWAED..--.---.
 505 ..-....-DG....S.....DL.....AMEERL.KV.D.....DKKVNEMILSLNQ..LA.SQE.
 506 ..E....WTS....Y.....YE.....EVAHVL.DE.I.....DFTIKGLSDWAED..--.---.
 507 ..E....WTS....Y.....YE.....EVAHVL.EE.L.....DTTIKELPDWAED..--.---.
 508 ..E....WTS....Y.....YE.....EVAHVL.DE.I.....DFTIKGLSDWAED..--.---.
 509 ..E....FNV....Y.....SQ.....EVITVL.GE.I.....DFMLENLPEWVTA..KP.VKK.
 510 ..E....CTA....Y.....SY.....EIMGLL.GE.I.....NLAIDNLTKWTEP..--.---.
 511 ..E....WTS....Y.....YE.....EVAHVL.DE.I.....DFTIKGLSDWAED..--.---.
 512 ..E....FNV....Y.....SQ.....EVITVL.GE.I.....DFMLENLPEWVTA..KP.VKK.
 513 ..E....FNV....Y.....SQ.....EVITVL.GE.I.....DFMLENLPEWVTA..KP.VKK.
 514 ..V....ESN....L.....AP.....SLLKRL.EL.T.....HGKIDTVVSGIKA..IA.EDK.
 515 ..N....RDD....-.....-Q.....ALYDRL.VV.N.....DAKISGMIQAIKE..VR.DQE.
 516 ..E....FNA....Y.....SQ.....EVITVL.GE.I.....DLMLEKLPEWAAA..KP.AQR.
 517 ..E....FNA....Y.....SQ.....EVITVL.GE.I.....DLMLEKLPEWAAA..KP.AQR.
 518 ..N....RND....-.....-Q.....ALYDRL.VV.N.....QSKVDGMIQAIKE..VK.EQE.
 519 lvE....EGK....L.....SS.....SLAARL.DL.Fsk...PGKWESLLDGVSE..VA.ALA.
 520 ..G....HNA....Y.....SH.....EIMGVL.GE.L.....ALAMEKLPSWAAP..RP.VKK.
 521 ..K....EKG....F.....SD.....SLLDRL.LL.N.....EQRIVDMTEGISS..LI.DXR.
 522 ..Q....EAG....Y.....EK.....SLVARL.AL.K.....PGKIASLANNMRI..IA.NME.
 523 ..R....EMA....V.....PE.....LILDWL.KL.T.....PTRLEITVEILQR..LG.EIS.
 524 ..Q....KED....-.....-Q.....AMYDRL.IL.N.....DQKIDGMITAINE..VK.AQE.
 525 ..R....EMA....V.....PE.....LILDWL.KL.T.....PTRLEITVEILQR..LG.EIS.
 526 ..E....GRL....A.....GP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 527 ..E....FNV....Y.....SQ.....EVITVL.GE.I.....DFMLENLPEWVTA..KP.VKK.
 528 ..R....EMA....V.....PE.....LILDWL.KL.T.....PTRLEMTVDVLQR..LG.ELS.
 529 ..I....AET....L.....AV.....DIATGA.DV.I.....EYYAGLATAIEGQ..QI.PLR.
 530 ..D....RDD....-.....-Q.....ALYDRL.VM.D.....SAKIDGMIRSVGE..VL.EQD.
 531 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 532 ..N....KDN....-.....-Q.....ALYDRL.VV.N.....DKKIDGMIQAIAE..VK.SQD.
 533 ..S....FES....Y.....VT.....EVAMVY.DE.I.....NMHIKNIKKWSKK..--.---.
 534 ..I....TFA....R.....TV.....DIPRAA.YN.F.....RFFASSVLHQLSE..CS.QMD.
 535 ..Y....FES....Y.....ET.....EIAMVI.DE.L.....NYTIKNLPKWIKT..--.---.
 536 ..M....HGT....S.....LF.....ELIGIE.ND.I.....KVAEREMTEWAAP..RP.VKK.
 537 ..F....SDA....Q.....GE.....VARGID.II.-.....------------E..FA.CGI.
 538 ..F....TDA....Q.....GE.....VTRGIE.IV.-.....------------E..FA.CGA.
 539 ..S....GDD....-.....-L.....AMRDRL.KV.D.....QSKIDGMVLSLQQ..LA.NAE.
 540 ..F....SDA....Q.....GE.....VARGID.IV.-.....------------E..FA.CGI.
 541 ..I....GET....L.....AV.....DIVTGA.DV.I.....EYYAGLATAIEGL..QV.P--.
 542 ..I....GET....L.....AV.....DIVTGA.DV.I.....EYYAGLATAIEGL..QV.P--.
 543 ..I....GET....L.....AV.....DIVTGA.DV.I.....EYYAGLATAIEGL..QV.P--.
 544 ..I....GET....L.....AV.....DIVTGA.DV.I.....EYYAGLATAIEGL..QV.P--.
 545 ..K....HEV....I.....TS.....ELAILY.SE.I.....DSMLKNLRQWMQ-..--.---.
 546 ..R....EMA....I.....PD.....ILIDWL.KL.T.....PERLKNTVEILES..LA.ELP.
 547 ..K....YES....L.....IS.....EVDYLK.ND.A.....LNMIYNLSTWMEP..--.---.
 548 ..L....SDA....I.....AE.....VREAID.FL.R.....YYAMIAK-NELSD..WK.KLP.
 549 ..L....EDA....A.....GE.....LKRGIE.NV.-.....------------E..YA.CAA.
 550 ..V....SDA....L.....GE.....VSRGLE.VV.-.....------------E..FA.CGI.
 551 ..L....SDA....I.....AE.....VREAID.FL.R.....YYAMIAK-NELSD..WK.KLP.
 552 ..L....NNA....I.....AE.....VREAVD.FC.R.....YYAQEARKLGNE-..--.---.
 553 ..L....EDA....A.....GE.....LKRGIE.NV.E.....-------------..YA.CAA.
 554 ..E....LEA....F.....LA.....EISNTK.SS.C.....MLAIKELKNWMA-..--.---.
 555 ..E....LEA....F.....LA.....EISNTK.SS.C.....MLAIKELKNWMA-..--.---.
 556 ..K....EHG....I.....SD.....IMMDRL.RL.T.....SERIKAMAQGVQQ..VA.DLA.
 557 ..L....EDA....A.....GE.....LKRGIE.NV.E.....-------------..YA.CAA.
 558 ..V....TLA....R.....SM.....DIPRAV.QN.V.....RFFASSVLHHTSE..CT.QA-.
 559 ..I....NET....R.....AL.....VASAAS.TF.R.....YFAACAQTLDEAL..TP.SRG.
 560 ..I....NET....R.....AL.....VASAAN.TF.R.....YFAACAQTLDEAL..TP.SRG.
 561 ..A....AET....F.....LT.....ETEFLR.GE.I.....ESALRNLKRWMK-..--.---.
 562 ..I....NET....R.....AL.....VASAAN.TF.R.....YFAACAQTLDEAL..TP.SRG.
 563 ..F....SNA....I.....AE.....VREAVD.FL.R.....YYAVQVRASFSND..--.---.
 564 ..L....TLA....R.....TM.....DIPRSV.LN.F.....RFFASSNLHHVSE..CT.QMS.
 565 ..I....NET....R.....AL.....VASAAS.TF.R.....YFAACAQTLDEAL..TP.SRG.
 566 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYSAQIRDEFSN-..--.---.
 567 ..P....FEA....W.....LA.....DIASTA.GE.A.....AYAAKNVGKWMKR..RY.RLL.
 568 ..Q....DSE....M.....PD.....LLRRWL.KL.T.....PERLDRTVEILER..LS.VRS.
 569 ..F....SNA....I.....AE.....VREAVD.FL.R.....YYAAEVRRSFD--..--.---.
 570 ..E....LEA....Y.....ST.....EIGILY.EE.I.....GYTLKHLKKWMKA..--.---.
 571 ..M....PNA....I.....AE.....VREAID.FL.R.....YYAEQTR------..--.---.
 572 ..R....FES....I.....FA.....ELMGTT.NE.I.....VEAVTKIDKWAKP..AK.PWA.
 573 ..L....ANA....V.....AE.....IREAID.FL.R.....YYSTQIREEFSN-..--.---.
 574 ..M....PNA....I.....AE.....VREAID.FL.R.....YYAEQTR------..--.---.
 575 ..M....PNA....I.....AE.....VREAID.FL.R.....YYAEQTR------..--.---.
 576 ..E....FEI....H.....QT.....EIVMIQ.TE.L.....DETISHLESWNK-..--.---.
 577 ..Q....DSE....M.....PD.....LLRRWL.KL.T.....PERLDRTVEILER..LS.VRS.
 578 ..F....EDA....R.....GD.....VWRGIE.VV.E.....HACNVPSLLMGET..VE.NVA.
 579 ..F....EDA....K.....GD.....VWRGIE.VV.E.....HACNVPSLLMGET..VE.NVA.
 580 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYAAQIRDEFSN-..--.---.
 581 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYAAQIRDEFSN-..--.---.
 582 ..F....EDA....K.....GD.....VWRGIE.VV.E.....HACNVPSLLMGET..VE.NVA.
 583 ..L....AES....R.....GE.....IGYANS.FI.R.....WFAEEGKRVYGDV..IP.A--.
 584 ..L....AES....R.....GE.....IGYANS.FI.R.....WFAEEGKRVYGDV..IP.A--.
 585 ..A....LNA....I.....AE.....VREAID.FL.R.....YYAEQTRRT----..--.---.
 586 ..L....SDA....K.....GE.....IGRGLE.VI.-.....------------E..FA.CGI.
 587 ..Y....SET....R.....YV.....DIVTGA.DV.L.....EYYAGLVPAIEGE..QI.PLR.
 588 ..L....NNA....I.....AE.....VREAVD.FC.R.....YYANQVK------..--.---.
 589 ..I....KSA....R.....AE.....VERTAD.FL.R.....YTADVGKNMEGE-..A-.---.
 590 ..E....AET....L.....LS.....EIYPVL.KE.I.....TYAKKNLSRWAK-..--.---.
 591 ..E....FEV....L.....TT.....ELYVAY.KE.L.....NLFIKKIKKWSK-..--.---.
 592 ..E....QQA....R.....AL.....DIRRGV.LN.F.....RTFADLASQAG--..--.---.
 593 ..I....GET....R.....AL.....VASAAN.TF.R.....YYAACAETLDEEL..TP.SRG.
 594 ..I....GET....R.....VL.....VASAAN.TF.R.....YFAACLETLDEEL..TP.SRG.
 595 ..Y....SET....R.....YV.....DIVTGA.DV.L.....EYYAGLVPAIEGE..QI.PLR.
 596 ..F....SNA....V.....AE.....VREAVD.FL.R.....YYACQIAQDFDND..--.---.
 597 ..K....KSA....L.....SE.....VSRTAD.YI.R.....FTADAAKSMDGES..IP.S--.
 598 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYAAQIR------..--.---.
 599 ..I....GET....R.....VL.....VASAAN.TF.R.....YFAACLETLDEEL..TP.SRG.
 600 ..I....TDT....R.....GN.....DVPRSA.QN.F.....RFFADHARLSAGE..--.---.
 601 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYAAQIR------..--.---.
 602 ..R....EMS....V.....AD.....CLCEWL.KL.T.....PERLQNTVTILKR..LA.SLP.
 603 ..R....KSS....K.....SE.....IHRTAD.FI.R.....FTADTAKN-----..--.-MS.
 604 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 605 ..L....KES....R.....GE.....ITYANS.FI.R.....WFAEEGKRVYGDV..IP.STK.
 606 ..S....TEA....F.....RD.....ELGVVL.RT.A.....TVAINCLDKWAV-..--.---.
 607 ..A....QET....F.....LT.....ETSFLA.GE.I.....RYALKHLKAWMRP..SR.RGV.
 608 ..Y....HVA....L.....EE.....DLTEAI.TT.I.....RYYSGWADKIAGQ..TI.S--.
 609 ..L....PNA....I.....AE.....VREAID.FL.R.....YYAAQARSTFGP-..--.---.
 610 ..F....SNA....I.....AE.....VREAVD.FL.H.....YYAGQVRDDFD--..--.---.
 611 ..R....FEA....M.....FG.....EILTSC.EK.L.....RYLIQNGEKALKT..--.---.
 612 ..F....PNA....V.....SE.....IREAVD.FL.R.....YYSNQI-------..--.---.
 613 ..L....SDA....L.....GE.....VSRGQ-.--.-.....---------EVVE..FA.CGI.
 614 ..L....PDA....R.....GD.....VQRGLE.VI.-.....------------E..VC.MGA.
 615 ..W....SEA....D.....AD.....VCEAID.FL.E.....YYGREMIRLSRP-..--.---.
 616 ..Y....TES....Y.....VH.....EIALVK.SS.C.....KFALKNLKKWMK-..--.---.
 617 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 618 ..E....LGT....E.....LF.....ETLGLE.AE.I.....RLALEKLAEWAAP..RP.VEK.
 619 ..L....PNA....I.....AE.....VREAID.FL.R.....YYARQAHATFGAQ..--.---.
 620 ..V....TDA....R.....AV.....DVA---.--.-.....-----FSIELLRY..MA.GWS.
 621 ..S....AES....F.....LY.....ENKVVQ.GE.I.....HYALRHLTAWTT-..--.---.
 622 ..Y....RSE....A.....IP.....DIEETA.EN.F.....RVAAEDVKRLET-..--.---.
 623 ..R....YEA....I.....GD.....VDEAID.FM.R.....YYAMNLI------..--.---.
 624 ..L....PDA....E.....GE.....VGRGLE.VV.E.....HACSIANLQLGEY..AE.NAA.
 625 ..H....VEA....F.....RD.....EVGTLK.KS.I.....DLAIKSFKKWMA-..--.---.
 626 ..L....PDA....E.....GE.....VGRGLE.VV.E.....HACSIANLQLGEY..AE.NAA.
 627 ..P....LDT....V.....AE.....LREAVD.FL.R.....YYGANAP------..--.---.
 628 ..Y....NAS....V.....TE.....VVRTAD.LI.R.....YAAEEGIRLSTS-..--.---.
 629 ..Y....NAS....V.....TE.....VVRTAD.LI.R.....YAAEEGIRLSTS-..--.---.
 630 ..L....GDA....V.....SE.....LREAVD.FL.R.....YYAAEGAAD----..--.---.
 631 ..I....IKA....S.....IE.....WGAT--.--.-.....--------LQTIK..VA.ATF.
 632 ..Y....NAS....V.....TE.....VVRTAD.LI.R.....YAAEEGIRLSTS-..--.---.
 633 ..Y....NAS....V.....TE.....VVRTAD.LI.R.....YAAEEGIRLSTS-..--.---.
 634 ..V....QNT....I.....DE.....IREAID.FL.R.....YYAKQAVGLQT--..--.---.
 635 ..Y....TKG....A.....AE.....F-----.--.-.....-----EASVGITD..EA.ASF.
 636 ..L....ADA....R.....GE.....IGAAVQ.CA.R.....FFAGEGQRLFGRT..MP.S--.
 637 ..P....NWI....G.....FN.....VMLAAN.ML.R.....EAAAMTTQIDGSV..--.---.
 638 ..F....AEG....R.....GE.....IYRSGQ.FF.H.....YFAAEVLRQMGD-..--.-LA.
 639 ..I....PDA....V.....GE.....LREAVD.FL.R.....YYANEGEK-----..--.---.
 640 ..I....KQS....R.....TD.....MIMAAR.YF.E.....FYGSAADKLHG--..--.---.
 641 ..V....SNA....I.....AE.....VREAVD.FL.R.....YYASQAPA-----..--.---.
 642 ..L....ESL....-.....--.....------.--.-.....--RLRVILRGAAN..FR.NYA.
 643 ..Y....SNA....I.....AE.....VREAID.FL.Y.....YYSAQVANDFD--..--.---.
 644 ..R....YEA....M.....GD.....VDEAID.FM.K.....YYSMSMI------..--.---.
 645 ..L....EDA....T.....NE.....AVYAAD.IT.R.....YHAEWARRIEGE-..--.---.
 646 ..L....KEA....A.....GE.....IAYAAS.FM.R.....WFAEEARRVYGDT..IP.AAK.
 647 ..L....PDA....V.....AE.....LREAVD.FL.R.....YYATQATADMQ--..--.---.
 648 ..L....ADA....V.....AE.....LREAVD.FL.R.....YYAAEGEASP---..--.---.
 649 ..P....FIS....F.....MT.....SYKITV.SE.I.....EHTLKNLDQWVKA..--.---.
 650 ..N....FEA....E.....VS.....EIWPIL.KE.L.....KLYIKNLKKWSKNkvVN.HPG.
 651 ..I....PDA....V.....AE.....LREAVD.FL.R.....YYAANAP------..--.---.
 652 ..V....SSA....M.....GD.....MAGAIG.CI.R.....HHAESIDKLYGEI..AP.TGE.
 653 ..R....FEA....L.....AE.....IHEAID.VL.R.....YYVELIH------..--.---.
 654 ..Q....MDA....V.....AE.....LREAVD.FL.R.....YYASRIP------..--.---.
 655 ..F....ADA....K.....GD.....VLRGLQ.VA.E.....QA-----------..-C.SIP.
 656 ..R....YEA....I.....GD.....VDEAID.FM.R.....YYAINLIE-----..--.---.
 657 ..V....GET....K.....IG.....ELLTCL.EH.V.....GYYSKHLTQWMK-..--.---.
 658 ..R....FET....E.....LT.....EVLFVR.DE.F.....STVIKNLRKWVKE..--.---.
 659 ..L....SEA....I.....GE.....IRFAAD.HA.D.....WHAEEARRIYGRV..IP.A--.
 660 ..L....PDA....K.....GD.....VFRGLE.VV.E.....HSVNVASLMMGET..VE.NVS.
 661 ..R....PGA....L.....FT.....EIMGAL.PV.I.....EHTRSHVAKWMRR..--.---.
 662 ..L....DDG....V.....AE.....VREAVD.YC.R.....YYASEGRRLFGEP..QA.---.
 663 ..K....HLI....A.....SE.....EVTVGA.DQ.I.....RFFAGA-------..--.---.
 664 ..W....GDA....V.....SE.....VREAVD.FL.R.....YYANEAERIMAP-..-V.ALP.
 665 ..L....PDA....V.....AE.....LREAVD.FL.R.....YYAANIPD-----..--.---.
 666 ..R....SHA....F.....EE.....VADCAI.VS.R.....HYARAAAAYLKDT..RV.RGG.
 667 ..L....PNA....I.....AE.....IREAVD.FL.R.....YYAAQIR------..--.---.
 668 ..L....GDC....V.....AE.....LREAVD.FC.R.....YYALQARDTLGP-..--.---.
 669 ..R....EQT....L.....PE.....WILNGL.KL.T.....PERLQRSAQLLAL..LA.QQP.
 670 ..A....FES....L.....SY.....DVSDVK.NT.I.....LTMLKNVDTWSQG..AP.PPE.
 671 ..I....KDA....K.....GE.....VTRLID.TF.K.....IAAEESVRINGET..--.---.
 672 ..A....LEV....E.....LS.....ELLPVV.DE.I.....AAAIAGLPRWMRP..--.---.
 673 ..R....EQT....V.....PE.....WILNGL.KL.T.....PERLQRSAQLLTL..LA.QQP.
 674 ..R....SEA....M.....GE.....TMGSIS.EV.R.....YYGGLAR------..--.---.
 675 ..T....SEG....L.....GE.....VQEMID.IC.D.....FAVGLSRQLYGLT..IA.S--.
 676 ..T....SEG....L.....GE.....VQEMID.IC.D.....FAVGLSRQLYGLT..IA.S--.
 677 ..E....GRL....A.....SP.....LLKRLS.LS.T.....SKLNSLAIGLRQI..AA.SSQ.
 678 ..V....TLA....R.....SM.....DIPRAV.QN.V.....RFFASSVLHHTSE..CT.QA-.
 679 ..I....SDA....R.....VE.....LDRAFN.TT.I.....ASAEEARQIAGEA..LD.SDA.
 680 ..T....SEG....L.....GE.....VQEMID.IC.D.....FAVGLSRQLYGLT..IA.S--.
 681 ..T....SEG....L.....GE.....VQEMID.IC.D.....FAVGLSRQLYGLT..IA.S--.
 682 ..T....SQG....E.....QE.....V-----.--.-.....-----DLCVGICE..YT.AKN.
 683 ..F....LEI....D.....PE.....VS----.--.-.....-------------..--.EAI.
 684 ..F....LEI....D.....PE.....VS----.--.-.....-------------..--.EAI.
 685 ..F....LEI....D.....PE.....VS----.--.-.....-------------..--.EAI.
 686 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 687 ..I....EKG....T.....SN.....AMLDRL.KL.D.....EERVKSIANAVAD..VV.KLD.
 688 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 689 ..F....LEL....D.....SE.....VSEAID.FL.E.....FY-----------..--.---.
 690 ..F....LEI....D.....PE.....VS----.--.-.....-------------..--.EAI.
 691 ..V....WET....R.....TE.....VG----.--.-.....-------AMMGKV..AI.SER.
 692 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 693 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 694 ..I....SEA....K.....AE.....IALSAD.IF.D.....YYADNAQKLLAPQ..KL.PVA.
 695 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 696 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 697 ..I....DQG....D.....PE.....VSEAVD.FA.H.....YYAESARRLDDV-..--.---.
 698 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 699 ..A....AQA....N.....EA.....HRFKAV.TL.A.....QIEALEE------..--.---.
 700 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 701 ..L....AEG....D.....VE.....VSEAID.FA.A.....WYVDRAE------..--.ELE.
 702 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 703 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 704 ..I....TLA....R.....TM.....DIPRAV.HN.F.....RFFASSILHHTSE..CT.QMD.
 705 ..K....WED....K.....VI.....KNTFAS.MG.V.....YETLKNT------..--.---.
 706 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 707 ..I....YED....K.....II.....KNAFAS.KV.V.....YDEMKDK------..--.---.
 708 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 709 ..N....VED....K.....VI.....KNHFGT.QV.V.....Y------------..--.---.
 710 ..K....WED....K.....II.....KNTFAS.RG.V.....YESIKDL------..--.---.
 711 ..R....DLA....V.....SQ.....IVLGWL.RL.T.....HERLQRIRQWLEH..LY.HAA.
 712 ..E....LEA....F.....LA.....EISNTK.SS.C.....MLAIKELKNWMA-..--.---.
 713 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 714 ..R....TEA....I.....MA.....DVDTSV.GE.A.....KIMLSSADLWLQE..ES.VPA.
 715 ..K....VAD....K.....TI.....KNYFGS.TV.I.....WNDMKG-------..--.---.
 716 ..V....FED....K.....AT.....KNLFA-.--.C.....EYVVNNMRHL---..--.---.
 717 ..V....VED....K.....DI.....KNHFAT.EY.V.....YERIKNE------..--.---.
 718 ..V....VNH....R.....VQ.....KIL---.--.-.....----------LGT..ME.VAA.
 719 ..V....VAD....K.....V-.....------.--.-.....------IKNRACS..RG.ILD.
 720 ..V....VAD....K.....VL.....------.-K.N.....QACSRGILD----..--.---.
 721 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 722 ..K....VED....K.....TY.....KNHLAA.TI.L.....YDSIKDM------..--.---.
 723 ..K....ARG....R.....ST.....---TRL.LA.D.....ERMRRDMIAGLRA..WR.DAP.
 724 ..V....VED....K.....VV.....KNRA--.--.-.....--CSRGIVEFYR-..--.---.
 725 ..F....MMA....F.....QA.....GGPHAQ.DC.G.....VEAVTYAWQEMSR..IP.GVA.
 726 ..F....MMA....F.....QA.....GGPHAQ.DR.G.....VEAVTYAWQEMSR..IP.GVA.
 727 ..F....QAG....G.....PH.....AQDRGV.EA.V.....TYAWQEMSRIPG-..VA.LWE.
 728 ..K....DNN....L.....DA.....AMIDRL.IL.N.....EERIESMAEGIEV..IV.ELD.
 729 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 730 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 731 ..Q....QAG....Y.....EK.....SLISRL.AL.K.....PGKISSLANSIRV..LA.NME.
 732 ..T....GAD....-.....-I.....SMLERL.KV.A.....HYKVDEMIFAAKH..LA.AQE.
 733 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 734 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 735 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 736 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 737 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 738 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 739 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 740 ..E....GKE....Q.....AA.....------.--.-.....-------------..--.---.
 741 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 742 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 743 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 744 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 745 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 746 ..-....---....-.....--.....------.--.-.....-------------..--.---.
 747 ..-....---....-.....--.....------.--.-.....-------------..--.---.


       90        100            110       120         130       140    
       |          |              |         |           |         |    
   1 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
   2 DPVGEVLGMTRR.PNG.....LVIGQVRVPLGVVGIIYESRPNVTVDA..AALCLKAGNAVILRG
   3 DPVGVITDMTYR.PSG.....IQVGKMRVPLGVIGIIYESRPNVTVEA..ASLCLKSGNATILRG
   4 DPVGEVTSMWTR.PNG.....LQIGRVRVPLGVIGIIYEARPNVTVDA..AGLCLKTGNAVILRG
   5 DPIGEIRDMRYV.PSG.....IQIGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
   6 DPIGEIRDMRYV.PSG.....IQIGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
   7 DPIGEISDMNYL.PSG.....IQVGKMRVPLGVVGIIYESRPNVTIDA..AALCLKSGNAALLRG
   8 DPVGEIDDMCYR.PSG.....IQLGKMRVPLGVVGIIYEARPNVTADA..AGLCLKSGNATILRG
   9 DPIGEISDMNYL.PSG.....IQVGKMRVPLGVVGIIYESRPNVTIDA..AALCLKSGNAALLRG
  10 DPVGAISELSYR.PSG.....IQVGRMRVPLGVIGIIYESRPNVTADA..AGLCLKSGNAVILRG
  11 DPVGEVIKMWKR.PNG.....LQIGQMRVPLGVIGMIYEARPNVTVDA..AGLCLKTGNAVILRG
  12 DPIGEIRDMRYV.PSG.....IQIGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  13 DPVGEIRDMRYM.PSG.....IQVGKMRVPLGVIGIVYESRPNVTIDA..ASLCLKSGNATILRG
  14 DPVGEVTRMWTR.PNG.....LRVGKMRIPLGVIGIIYEARPNVTADA..AALCLKSGNSVILRG
  15 DPVGEVTKMWKR.PNN.....LMVGKMRIPLGVIGIIFEARPNVTADA..AALCLKAGNAVILRG
  16 DPIGEIRDMRYL.PSG.....IQVGKMRVPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  17 DPIGEVVRQWRR.PNG.....LEIGQVRVPLGVVGIIYEARPNVTVDA..AGLCLKTGNAVLLRG
  18 DPIGEIRDMRYL.PSG.....IQVGKMRVPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  19 DPIGEVTSMFKR.PNG.....LRIGVQRVPLGVVGIIYEARPNVTADA..AALCLKTGNAVILRG
  20 DPIGEVLNMWKR.PNG.....INIGVKRVPLGVIGIIYEARPNVTVDA..TALCLKSGNAVILRG
  21 DPIGEVTDLQDR.PSG.....IKLGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  22 DPVGEISGLTYR.PSG.....IQVGRMRVPLGVIGIIYESRPNVTADA..AGLCLKSGNACILRG
  23 DPVGKVTSMWRR.PNG.....LLVGRMRIPLGVIGIIYESRPNVTADA..AALCLKSGNAVILRG
  24 DPVGQVIDGGLL.DSG.....LRLERRRVPLGVVGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  25 DPVGSIEKMWKR.PNG.....LQIGKMRVPIGVIGIIYESRPNVTADA..AGLCLKSGNAVILRG
  26 DPVGQVIDGGLL.DSG.....LRLERRRVPLGVVGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  27 DPIGEVISMWQR.PNG.....LQIGQKRVPLGVIGIIYEARPNVTCDA..AGLCIKTGNAVILRG
  28 DPVGQVIDGGLL.DSG.....LRLERRRVPLGVVGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  29 DPCGEITDLKYR.PSG.....IQLGKKRTPLGVVGIIYESRPNVTVDA..ASLCLKSGNAAILRG
  30 DPVGEITGLNYR.PSG.....IQVGKMRVPLGVVGIIYESRPNVTVEA..ASLCLKSGNATILRG
  31 DPVGEVTGMWRR.PNG.....IQVGRMRIPLGVIGIIYESRPNVTADA..AGLCLKSGNAVVLRG
  32 DPVGAIRDMSYR.PSG.....IQVGKMRTPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  33 DPVGEITDMAYR.PSG.....IQIGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  34 DPIGEITDLAYR.PSG.....IQLGKMRVPLGVIGMIYESRPNVTLEA..ASLALKSGNAIILRG
  35 DPVGKTLLSTEL.DEG.....LELYRVTCPIGVVGIIFESRPDALVQI..STLCLKSGNGVLLKG
  36 DPVGRTLLSTEL.DDG.....LELYKVTCPIGVIGVIFESRPDALVQI..STLCLKSGNGVLLKG
  37 DPIGEITDVKRR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AALCLKSGNAAILRG
  38 DPVGAIRDMSYR.PSG.....IQVGKMRTPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  39 DPIGEVDKMWRN.EAG.....LLIGQQRVPLGVIGIIYESRPNVTTDA..ASLCFKSGNAVILRG
  40 DPIGAVTDLDYR.PSG.....IQVGRMRVPLGVIAIIYEARPNVTADA..AGLCLKAGNAAILRG
  41 DPVGAIRDMSYR.PSG.....IQVGKMRVPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  42 DPVGEIRDMRYL.PSG.....IQVGKMRVALGVVGIVYESRPNVTVDA..ASLCLKSGNATILRG
  43 DPVGDIEEMWIR.PNG.....LQIGKMRVPIGVIGMIYESRPNVTADA..AGLCLKAGNAVILRG
  44 DPVGAIRDMSYR.PSG.....IQVGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  45 DPVGAIRDMSFR.PSG.....IQVGKMRVPLGVIGIIYESRPNVTIDA..ASLCLKSGNATILRG
  46 DPVGEISDLNYR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AGLCLKAGNAAILRG
  47 DPIGEVIKMWKT.PDE.....LQIGQMRVPLGVIGIIYEARPNVTVDA..AALCIKSGNSVILRG
  48 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  49 DPVGAIRDMSYR.PSG.....IQVGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  50 DPVGEVIDGSLL.DSG.....LRLERRRVPLGVVGVIYEARPNVTIDV..ASLCLKTGNAVILRG
  51 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  52 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  53 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  54 DPVGQVIDGGIL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  55 DPVGEVVRGKTL.PNG.....LELRQIRVPLGVIGIIYEGRPNVTVDA..AALCLKSGNAVLLRG
  56 DPVGSISEMDYR.PSG.....IQLGKMRVPLGVIGIIYESRPNVTIEA..ASLCLKSGNAVILRG
  57 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  58 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  59 DPVGEVISMWKR.PNG.....LIIGQKRVPIGAIGIIYEARPNVTVDA..AVLCLKAGNSVLLRG
  60 DPIGEISNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  61 DPAGQVIDGGLL.DSG.....LRLERRRVPLGVVGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  62 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  63 DPVGSITATSVR.PNG.....MRVAQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  64 DPIGKVDEMWTN.TDG.....LRIGKKRVPLGVTGIIYESRPNVTTDA..ASLAFKSGNAVILRG
  65 DPVGEVTGMWRR.PNG.....IQVGRMRIPLGVIGIIFESRPNVTADA..AALCLKSGNAVVLRG
  66 DPVGQVIDGSVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  67 DPVGEVLGMWRR.PNG.....LEVGRIRTPIGVIGIIYESRPNVTADA..AGLCLKAGNAILLRG
  68 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  69 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
  70 DPVGAIRDMSYR.PSG.....IQVGKMRVPLGVVGIIYESRPNVTIDA..ASLCLKSGNATILRG
  71 DPIGEISNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  72 DPVGSITATSVR.PNG.....MRVAQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  73 DPVGEVIDSWVR.EDG.....LRIARVRVPIGPIGIIYESRPNVTVET..TILALKSGNTILLRG
  74 DPIGEIGNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  75 DPIGEISNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  76 DPIGEIGNLKFR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  77 DPIGEMSDFKYR.PSG.....IQIGKMRVPLGVIGIIYEARPNVTVDA..AGLCIKSGNAAILRG
  78 DPIGEISNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  79 DPVGHVLDGNLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
  80 DPVGEIDGLKFR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AALCLKSGNAAILRG
  81 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
  82 DPGGSITATSVR.PNG.....MRVAQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
  83 DPVGEVVRGKTL.PNG.....LELRQIRVPLGVIGIIYEGRPNVTVDA..AALCLKSGNAVLLRG
  84 DPVGAIRDLAFR.PSG.....IQVGRMRVPLGVIGIIYESRPNVTADA..AALCLKSGNAAILRG
  85 DPVGEVIDSWVR.EDG.....LRIARVRVPIGPIGIIYESRPNVTVET..TILALKSGNTILLRG
  86 DPVGAIRDMSPR.PSG.....IRVGKMRVPLGVIGIIYESRPNVTADA..ASLCIKSGNAAILRG
  87 DPIGEVTDMTYR.PSG.....IHLGKMRVPLGVVGMIYESRPNVTLEA..ASLALKSGNAIILRG
  88 DPVGEIDGLKFR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AALCLKSGNAAILRG
  89 DPVGEVTRMWKR.PNN.....LMVGKMRIPLGVIGIIYEARPNVTADA..AALCLKAGNSVILRG
  90 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
  91 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
  92 DPVGEIIKMWNL.PNG.....LKVGRMRVPLGVIFIVYESRPNVTIEA..SSLCMKSSNAVILRG
  93 DPVGEIIKMWNL.PNG.....LKVGRMRVPLGVIFIVYESRPNVTIEA..SSLCMKSSNAVILRG
  94 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
  95 DPIGQVIKGYTN.LNG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
  96 DPIGEMTNLRRR.PSG.....ITVGQMRVPLGVFGMVYESRPNVTIDA..ASLAIKSGNAAILRG
  97 DPIGEINHMRRL.ANQ.....LQVGKMRVPLGVIGIIYESRPNVTADA..AALCVKSGNAVILRG
  98 DPIGAVRDLHSR.PSG.....IQVGRMRVPLGVVGIIYEARPNVTADA..AGLCLKSANAVILRG
  99 DPVGAVRELASR.PSG.....IQVGRMRMPIGVIGIIYESRPNVTADA..AGLCIKSGNATILRG
 100 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
 101 DPIGEMSNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 102 DPVGEISDLNYR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AGLCIKAGNAAILRG
 103 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTNNAIILRG
 104 DPVGEIIHGHTR.PNG.....LQIKKIRTPIGVIVIIYESRPNVTADA..AALCLKAGNAVILRG
 105 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 106 DPIGEISNMKFR.PTG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 107 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 108 DPVGEIFDMNTM.PNG.....LIIGKKRVPLGVIAAIYESRPNVTVDI..ASLCLKAGNAVILRG
 109 DPVGAINDLKFL.PSG.....IQVGKMRVPLGVIGIIYESRPNVTVEA..ASLCLKSGNATILRG
 110 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 111 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 112 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 113 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 114 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 115 DPVGQVMETWQR.PNG.....LEIAKVRVPMGVIGMVYEARPNVTVDT..CALCLKAGSAVVLRG
 116 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 117 DPIGKIDAGWVN.YAG.....LQIEKKRVPLGVVGMIFEARPNVTVDA..SALCFKSGNAVILRG
 118 DPIGEMSNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 119 DPVGEEFGSKLL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 120 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 121 DPVGGMTDLDYR.PSG.....IQVGKMRVPLGVIGIIYESRPNVTIEA..ASLCLKSGNAAILRG
 122 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 123 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 124 DPIGEISNAKFR.PTG.....IQVGQMRVPLGVIGIIYESRPNVTVDA..AALCIKSGNATILRG
 125 DPVGEEFGSKLL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 126 DPVGEEFGSRVL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 127 DPIGEVTDMTYR.PSG.....IQLGKMRVPLGVVGMIYESRPNVTLEA..ASLALKSGNAIILRG
 128 DPIGQVVSGYTN.LDG.....LKILKKRVPLGVIAMIFESRPNVSVDA..FSLAFKTGNAIILRG
 129 DPIGAMTDLDYR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AGLCLKAGNAAILRG
 130 DPIGEMSNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 131 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 132 DPIGEISNMKFR.PTG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNSTILRG
 133 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 134 DPIGQVVRGYTN.LDG.....LKIVQKRVPMGVIAMIFESRPNVSIDA..FSLAFKTNNAIILRG
 135 DPVGEEFGSRVL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 136 DPIGEMSNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 137 DPVGEIFDMNTM.PNG.....LIIGKKRVPLGVIAAIYESRPNVTVDI..ASLCLKAGNAVILRG
 138 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 139 DPIGQVVSGYTN.LDG.....LKILKKRVPLGVIAMIFESRPNVSVDA..FSLAFKTGNAIILRG
 140 DPIGQVVRGYTN.LDG.....LKIVQKRVPMGVIAMIFESRPNVSIDA..FSLAFKTNNAIILRG
 141 DPIGQVVRGYTN.LDG.....LKIVQKRVPMGVIAMIFESRPNVSIDA..FSLAFKTNNAIILRG
 142 DPVGEEFGSRVL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 143 DPVGDSYLLEER.PNG.....LKIEKMRIPLGVICMIYEARPNVTADA..GALCFKSGNAVILRC
 144 DPVGEIFDMNTM.PNG.....LVIGKKRVPLGVIAAIYESRPNVTVDI..AALCLKAGNAVILRG
 145 DPIGEVTNMWKN.EAE.....LTIGKTRVPLGVIGIIYESRPNVTVDA..SVLCFKTGNAVILRG
 146 DPVGQVIDGQRL.DSG.....LSLERRRVPLGVVGVIYEARPNVTVDV..AALCLKTGNAVILRG
 147 DPVGQVIDGSML.DNG.....LKLERRRVPLGVVGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 148 DPVGQLIDGGIL.DSG.....LKIERVRVPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 149 DPVGEEFGSKLL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 150 DPIGEMTDIKYR.PSG.....IQVGKMRVPLGVIGIIYEARPNVTADA..AALCLKSGNAAILRG
 151 DPIGEVTNMWKN.EAE.....LTIGKTRVPLGVIGIIYESRPNVTVDA..SVLCFKTGNAVILRG
 152 DPIGEVTNMWKN.EAE.....LTIGKTRVPLGVIGIIYESRPNVTVDA..SVLCFKTGNAVILRG
 153 DPIGEVTDMTYR.PSG.....IHLGKMRVPLGVVGMIYESRPNVTLEA..ASLALKSGNAIILRG
 154 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 155 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 156 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 157 DPIGEISNVKFR.PTG.....IQVGQMRVPLGVIGIIYESRPNVTVDA..AALCIKSGNATILRG
 158 DPIGEVTDMTYR.PSG.....IHLGKMRVPLGVVGMIYESRPNVTLEA..ASLALKSGNAIILRG
 159 DPIGSVIDSTVR.PNG.....LDIQKIRVPLGVVFFIYESRPNVTADA..AAICVKSGNAVILRG
 160 DPVGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 161 DPIGEVLDGFAR.PGG.....MRIEKRRVPLGVVFFIYESRPNVTADA..AGICVKSGNAVILRG
 162 DPVGEVLAEWER.PTG.....LSIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVILRG
 163 DPVGDVLAEWER.PNG.....LKMSRIRVPLGVIGVIYESRPNVTVDA..SVLCLKSGNAVMLRP
 164 DPVGEVVRGSTL.PNG.....IDLRQVRVPLGVVGIIYEARPNVTVDA..AALCLKSGNAVLLRG
 165 DPVGECVREWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNTVILRG
 166 DPVGRVIDGSLL.DSG.....LKLERRRVPLGVIGVIYEARPNVTIDV..ASLCLKTGNAVILRG
 167 DPVGDSYVLDER.PNG.....MKIEKMRIPLGVICMIYEARPNVTADA..GALCFKSGNAVILRC
 168 DPVGEVLAEWDM.PSG.....IHIQRVRTPLGVIGVIYESRPNVTADA..GALCLKSGNAVILRG
 169 DPTAQTDRAWVN.EAG.....LTIAQKRVPLGVVGMIYEARPNVTVDA..AALTFKSGNAVILRG
 170 DPVGDCVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 171 DPVGAVMSEWDR.PSG.....LHIKRVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 172 DPVGEVAEMVRR.PSG.....ILVGRMRIPLGVIGMIYESRPNVTVDA..AALCLKAGNAVVLRG
 173 DVIGEIIGMKEQ.PSG.....IRVGQMRVPIGVFGMIYESRPNVTIEA..ASLAIKSGNACILRG
 174 DPIGQVLQGFTN.LDG.....LKIVQKRVPLGTVGMIFESRPNVTIDA..FSLCFKTGNSVLLRG
 175 DPIGNVDRAWRN.EAG.....LMIAKERVPLGVIGMIFEARPNVTVDA..SALCFKTGNAVILRG
 176 DPIGEIGNLKYR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 177 DVIGEIIGMKEQ.PSG.....IRVGQMRVPIGVFGMIYESRPNVTIEA..ASLAIKSGNACILRG
 178 DPVGRTLGSVKR.PNG.....LSVGRMCVPLGVIAMIYESRPNVTIDA..AALCLKAGNAIILRG
 179 DPIGEIGNLKFR.PSG.....IQVGQMRVPLGVIGIIYESRPNVTIDA..AALCLKSGNATILRG
 180 DPIGQVVSGYTN.LDG.....LKILKKRVPLGVIAMIFESRPNVSVDA..FSLAFKTGNAIILRG
 181 DPVGKIIDGGVL.DSG.....LKLERIRTPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 182 DPVGDVIAAWER.PNG.....LRIERVRTPLGVVGVIYESRPNVTADA..GALCLKAGNPVILRG
 183 DPVGEEFGSRVL.DNG.....LRLTRRRVPLGVIGVIYEARPNVTVDI..AVLALKTGNAVILRG
 184 DPVGKIIDGGTL.DSG.....LKIERVRTPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 185 DPVGKIIDGGTL.DSG.....LKIERVRTPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 186 DPIGEIVRGYHL.ENG.....LRLQQVRVPIGVLGMIYEARPNVTVDV..ASLCIKSGNAVLLRG
 187 DPVGEIVGGWRH.PEG.....LEIVRVRVPLGLIGIIYEARPNVTADA..IGLCLKSGNGVLLKG
 188 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 189 DPVWKSNEVWTL.ENG.....LTVSKMTVPIGVIGIIYESRPNVTVDA..FCLTLKSGNGVLLRG
 190 DPVGEVTESWTR.PNG.....LKIERVRTPLGVIGVIYESRPNVTADA..AALCLRAGNAVILRG
 191 DPVGEMGGTTKR.PSG.....IEVGKMRIPLGVIGMIYEARPNVTADA..AGLCFKAGNAVLLRG
 192 DPVGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 193 DPVGEGE-FWTR.PNG.....LRIQRTRVPLGVVAMIYEARPNVTVDA..AALCLKSGNAVILRG
 194 DPVGAVLDEWTQ.PSG.....LRIQRVRTPLGVIGVIYESRPNVTADA..GALCLKSGNAVILRG
 195 DPVGETLSSWTL.DNG.....LKAEKVSVPLGVIGMIYEARPNVTVDA..TGLALKSGNAIVLKG
 196 DPIGQVVRGYTN.MVG.....LKIIQKRVPLGVIAMIFESRPNVSVDA..FSLAFKTGNAIILRG
 197 DPVGRSLAEWTR.PNG.....MSIARIAVPLGVIGIIYESRPNVTADA..AALCLKSGNATILRG
 198 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 199 DPVGKIIDGGTL.DSG.....LKIERVRTPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 200 DPVGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 201 DPTSQIDKGWIT.KDG.....LQILQRRVPLGVIGIIFEARPNVTVDA..TGLTFKSGNAVILRG
 202 DPVGEVIAEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 203 DPVGRSLAEWTR.PNG.....IHISRVAVPLGVIGIIYESRPNVTADA..AALCLKSGNATILRG
 204 DPVGEVIAEWDR.PSG.....LHIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVVLRG
 205 DPVGKIIDGGTL.DSG.....LKIERVRTPLGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 206 DPVGEVIAEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 207 DPVGHVMTEWEM.ESG.....LHIKRVRTPLGVIGVIYESRPNVTADA..GALCLKSGNAVILRG
 208 DPIGEEYQGKQL.ESG.....LFLKKRTVPLGVIGVIYEARPNVTIDI..ACLALKTGNAAILRG
 209 DPVGEVVRGRVL.PNG.....MELRQIRVPLGVVGIIYEARPNVTVDA..AGLCLKSGNAALLRG
 210 DPVGEVIAEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 211 DPVGQVIAEWDR.PSG.....LHIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVILRG
 212 DPVGETLETIRK.DNG.....LFIENVRVPLGVVGMIYEARPNVTVDA..ATLCLKTGNAVILRG
 213 DPVGEVIAEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 214 DPVGEIVRGSTP.ANG.....LQIRQVRVPMGVIGMIYEARPNVTVDA..AGLGLKSGNAVILRG
 215 DPVGKVLAEWDR.PNG.....LNIRRVATPLGVIGVVYESRPNVTADA..AALALKAGNAVILRG
 216 DPVGEIEGLQIR.PNG.....LQVGRMRVPLGVIGFIYESRPNATVEA..SALCLKAGNAILLRG
 217 DPVGQVIAEWDR.PSG.....LHIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVILRG
 218 DPVGQVIDGGVL.DSG.....LRLERRRVPLGVIGVIYEARPNVTVDV..ASLCLKTGNAVILRG
 219 DPVGQVLTEWDQ.PTG.....LNIQRVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 220 DPVGEVLRGYTL.PNG.....LQLRQQRVPLGVVGMIYEGRPNVTVDA..FGLALKSGNAVLLRG
 221 DPVGQVIDGGVL.NSG.....LKIERQRVPLGVILTIYEARPNVTIDV..ASLCLKTGNAVILRG
 222 DPVGAIETQWQR.PNG.....LLVGKMRIPLGVIAMIYESRPNVTIDS..AILCLKAGNAVILRG
 223 DPVGSEIDSKVL.ENG.....MQLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 224 DPVGTVLAGWQR.PNG.....LRIERVRVPIGVIGVIYESRPNVTADA..GALCLKAGNAAILRG
 225 DPTSQIDKGWIT.KDG.....LQILQRRVPLGVTGIIFEARPNVTVDA..TGLTFKSGNAVILRG
 226 DPVGQVLTEWDQ.PTG.....LNIQRVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 227 DPVGEVISEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 228 DPVGEGE-FWTR.PNG.....LRIQRTRVPLGVVAMIYEARPNVTVDA..AALCLKSGNAVILRG
 229 DPVGSEIDSKVL.ENG.....MQLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 230 DPVGKVQIHREL.DTG.....LILKRITCPLGVLGIIFEARPEAAIQI..ASLAIKSGNGVILKC
 231 DPIGQVQIQREL.DTG.....LVLKRITCPLGVLGIIFEARPEAAIQI..ISLAIKSGNGVILKC
 232 DSVGRVLRRTRI.AKD.....LELEEVTVPIGVLLVIFESRPDCLPQV..SALAIASGNGLLLKG
 233 DPVGEILDQWEQ.PSG.....LMIQRVRTPLGVIGVIYESRPNVTADA..GALCLKSGNAVILRG
 234 DPVGSEIDSKVL.ENG.....MSLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 235 DPVGEIVRGSTL.PNG.....IDLRQVRVPLGVVGIIYEGRPNVTVDA..AALCLKSGNAVLLRG
 236 DPIGEVTNMWKN.EAE.....LTIGKTRVPLGVIGIIYESRPNVTVDA..SVLCFKTGNAVILRG
 237 DPIGQVQIQREL.DTG.....LVLKRITCPLGVLGIIFEARPEAAIQI..ISLAIKSGNGVILKC
 238 DPLGQVTLHRQL.DEG.....LVLKRVGCPLGVLGVIFEARPEALIQI..SSLAIKSGNAVILKG
 239 DVIGEIIGMKQQ.PSG.....IRVGQMRVPIGVFGMIFESRPNVTIEA..ASLSIKSGNACILRG
 240 DPIGEVTNMWKN.EAE.....LTIGKTRVPLGVIGIIYESRPNVTVDA..SVLCFKTGNAVILRG
 241 DPVGESLETIQK.ENG.....LSIEKIRVPLGVVGMIYEARPNVTVDA..ATLCLKTGNAVVLRG
 242 DPVGAELDSRVL.ENG.....MRLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 243 DPVGTVIAEWDR.PNG.....LHIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 244 DPVGRVLHTTER.PNG.....LTIERVATPLGVIGMIYESRPNVGADA..GALCLKSGNAVILRG
 245 DPVGQIIDKRTR.PNG.....LELTRIRVPIGVIGIIYESRPNVTIDA..AALTLMSGNAAILRG
 246 DPVGEITRMWTR.PNG.....LRVGRMRIPLGVIGIIYESRPNVTVDA..AALCIKAGNAVILRG
 247 DPIGQVQIQREL.DTG.....LVLKRITCPLGVLGIIFEARPEAAIQI..ISLAIKSGNGVILKC
 248 DPIGVVQIHREL.DAG.....LILKRITCPLGVIGVVFEARPDAVIQI..SALAIKSGNGVILKG
 249 DPVGKLRDLGTQ.PNG.....LKISKMRMPLGVICMIFEARPNVTADA..AALCFKSGNAVILRG
 250 DPVGQVTRDDRR.PNG.....IHIQKIRVPLGVIAMIYEARPNVTADA..AALCIKAGNGIILRG
 251 DPVGHISIHREL.DEG.....LILKRLSCPLGVLGIIFEARPEALIQI..TSLAIKSGNGVILKG
 252 DPVGKEADSRVL.DNG.....LRLTRRSVPLGVVGVIYEARPNVTVDI..AVLALKTGNAVILRG
 253 DSVGRVLRRTRI.AKD.....LELEQVTVPIGVLLVIFESRPDCLPQV..SALAIASGNGLLLKG
 254 DPVGKLIDGGIL.DSG.....LKLERIRVPVGVIGTIYEARPNVTIDV..ASLCLKTGNAVILRG
 255 DPVGEIIAEWTR.PNG.....LRIQTVRVPLGVIGMVYEARPNVTVDA..ASLCLKTGNAVLLRG
 256 DPVGQVTRDDRR.PNG.....IHIQKIRVPLGVIAMIYEARPNVTADA..AALCIKAGNGIILRG
 257 DPIGNERYIGQR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 258 DPVGGVVRGSTL.PNG.....LEIRQVRVPLGVVGMVYEARPNVTVDA..FGLALKSGNAALLRG
 259 DPSGRTINTLEL.DKG.....LELYQVSSPIGLIGVIFESRPDVVPQV..MSLCLKSGNATVFKG
 260 DPVGAVTESWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVTADA..GVLCLKSGNAVILRG
 261 DPIGDQIDEFTR.PNG.....LNIRQVRVPLGVIGMIYEARPNVTVDA..SVLCLKSGNAVLLRG
 262 DPVGIVTESWQR.PNG.....MTIERVRVPLGVVGVIFESRPNVAADA..GVLCLKSGNAVILRG
 263 DPVGQVTRDDRR.PNG.....IHIQKIRVPLGVIAMIYEARPNVTADA..AALCIKAGNGIILRG
 264 DPVGSEIDSRVL.ENG.....MSLARRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNAAILRG
 265 DPVGAELDSRVL.ENG.....MRLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 266 DPIGSEIDSRVL.ENG.....MSLARRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNAAILRG
 267 DPVGSEIDSRVL.ENG.....MSLARRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNAAILRG
 268 DPVGMVREICER.PNG.....LNIQKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 269 DPVGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 270 DPVGKVTERWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVCADA..GALCLKSGNAVILRG
 271 DPVGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 272 DPVGEVLRGYTL.PNG.....LQLRQQRVPLGVVGMIYEGRPNVTVDA..FGLTLKSGNAALLRG
 273 DPVGEVIAAWDR.PNG.....LKIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 274 DPVGEVIAAWDR.PNG.....LKIERVRTPLGVIGVIYESRPNVTADA..GALCLKAGNAVILRG
 275 DPVGEVITEWDR.PSG.....LNIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVILRG
 276 DPLAVEPQAWIR.PNG.....LRIQRVRVPLGVVGIIYESRPGVTVDA..AVLCLKAGNAVLLKG
 277 DPVGSIDHMQQM.PSG.....IQVGRMRIPLGVIAMIYESRPNVTIDA..AALCLKAGNAVVLRG
 278 DPVGAELDSRVL.ENG.....MRLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 279 DPVGITRDLSER.PNG.....IKIRKMRIPLGVVCMIYEARPNVTADA..GALCFKSGNAVVLRG
 280 DPVGQIQIKREL.SKG.....LILERKTVPIGVLGVIFESRPDAVMQI..SSLAIRSGNGVMLKG
 281 DPVGDVITEWDM.ASG.....LNIRRVRTPLGVVGVIYESRPNVTADA..GALCLKSGNAVILRG
 282 DPLGQIQIDREL.DEG.....LILQRLTCPVGVLGVIFEARPDAVIQI..ASLAIKSGNGAILKG
 283 DPIGATEKQWQR.PNG.....LLVGKMRIPLGVISMIYESRPNVTVDS..GILCLKAGNAVILRG
 284 DPVGETLAEWER.PNG.....LRIRKVRVPLGVVAIIYEARPNVTIDV..IGLALKSGNAVVLRG
 285 DPVGRVTERWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVCADA..GVLCLKSGNAVILRG
 286 DPVGSEIDSKVL.ENG.....MSLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 287 DPVGRVTERWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVCADA..GVLCLKSGNAVILRG
 288 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 289 DPIGVQRDLSTR.PNG.....LAISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 290 DPIGEEFDSRLL.DNG.....MRLCRRRVPLGVIGVIYEARPNVTVEI..AVLALKTGNAVILRG
 291 DPIGEVLRGYTL.PNG.....LQLRQQRVPLGVVGMIYEGRPNITVDA..FGLAFKSGNAALLRG
 292 SPLGSVIDRQVR.PNG.....LELSRVRVPLGVIGIIYESRPNVTADA..AALCLRAGNAVILRG
 293 DPIGSELESQLL.DNG.....LRLSRRRVPLGVLGVIYEARPNVTVDI..AVLALKTGNAVILRG
 294 DPIGEALEIIEK.DNG.....LFITKKRVPIGVIGMVYEARPNVTVDA..ASLAIKTGNSVVLRG
 295 DPVGQVMSEWTR.PNG.....LHIRRVRTPLGVIGIIYESRPSVTIDA..SILCLKSGNAAILRG
 296 NPLGRIVDGWVV.ENG.....LRIEKVSTPIGVVGIIYESRPNVTSDT..AALCFKSGNVCVLKG
 297 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 298 DPVGEVIAAWDR.PNG.....LKIERVRTPLGVIGVIFESRPNVTADA..GALCLKAGNAVILRC
 299 DPVGEVLAEWDR.PSG.....LHIRRVRTPLGVVGVIYESRPNVTADA..GALCVKSGNAVILRG
 300 DPVGRITREDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 301 DPVGRITREDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 302 DPVGAELDSRVL.ENG.....MRLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 303 DPVGSEIDSKVL.ENG.....MSLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 304 DPVGRITREDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 305 DPVGQITRQEVR.PNG.....IRVQKMRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 306 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 307 DPVGQVTRDDQR.PNG.....IHVQKIRVPLGVIAMIYEARPNVTADA..AALCIKAGNGIILRG
 308 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 309 DPVGATVAAWDR.PNG.....LAIERVRTPLGVIGVIYESRPNVTADA..GALCLKSGNAVILRG
 310 DPVGETLSTLEL.DND.....LILYQISCPIGLIGVIFESRPDVVPQV..MSLCLKSGNATIFKG
 311 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 312 DPVGRALLIREL.DEG.....LILERRTYPLGVLGVIFESRPDALVQI..AALAVKTGNSVLLKG
 313 DPVGNVVVGRVL.PNG.....IRLTQNRVPMGVIGAIYEARPNVTVDI..AILALKAGNATVLRG
 314 DPVGTVTESWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVAADA..GVLCLKSGNAVILRG
 315 DPVGQVTRDDQR.PNG.....IHVQKIRVPLGVIAMIYEARPNVTADA..AALCIKAGNGIILRG
 316 DPIGDSLETIEK.ENG.....LFIEKIRVPLGVVGMIYEARPNVTVDA..ATLCLKTGNAVVLRG
 317 DPIGIRQLHRQL.DEG.....LYLERLTVPLGVIGVIFEARPDALIQI..ASLALRSGNAAILKG
 318 DPVGEIVRGGVL.ANG.....LELRQVRVPLGVVGIIYEGRPNVTVDA..ASLCVKSGNAVLLRG
 319 DPVGEVLRGNTL.VNG.....LQLRQQRVPLGVVGIVYEGRPNVTVDA..FGLTLKSGNAVLLRG
 320 DPLGLRQLHREL.DQD.....LVLERITVPLGVLGVIFEARPDAVIQI..TSLAIRSGNGALLKG
 321 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 322 DPLGQRQLHREL.DTG.....LILSRVTCPLGVLGVIFEARPDAVVQI..ASLAIKSGNGAILKG
 323 DPVGETLSTLEL.DDD.....LILYQVSCPIGLIGVIFESRPDVVPQV..MSLCLKSGNATIFKG
 324 DPVGTVVRGSVL.PNG.....LSVSQVRVPFGVIGAIYEARPNVTIDI..AALALKSGNAVVLRG
 325 DPVGEVVRGRVL.PNG.....LELRQVRVPLGVIGIIYEARPNVTVDA..AGLCIKSGNAVLLRG
 326 DPVGRITREDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 327 DPIRQVLQGFTN.LDG.....LKILQKRVPLGTVGMIFESRPNVTIDA..FSLCFKTGNSVLLRG
 328 DPVGQVTRDDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 329 DPVGRERFIGKR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 330 DPLGRIEGLAKR.PNG.....LRVGRMRVPLGLIGFIYEARPGATVEA..VSVALKAGNAMLLRG
 331 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 332 DPVGSEMDSKVL.ENG.....MSLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 333 DPVGSEMDSKVL.ENG.....MSLSRRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNASILRG
 334 DSVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCPTPG..GSFAIASGNGLLLKG
 335 DPIGEVIRGRTL.PNG.....LQLRQQRVPLGVVGIVYEGRPNVTVDA..FGLTLKSGNAVLLRG
 336 EPVGRVLDGWVT.EAG.....LKIEKVSIPIGVIGIIYESRPNVTSDT..AALCFKSSNVCVLKG
 337 DPVGRERFIGKR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 338 DPVGQVINAWTR.PNG.....LHISCVRTPLGVIGIIYESRPNVTIDA..SCLCLKSGNAAILRG
 339 DPVNQVQIKREL.AKG.....LILERKTVPIGVLGVIFESRPDAVMQI..SSLAIRSGNGVMLKG
 340 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 341 DPVGRVTERWQR.PNG.....MTIERVRVPLGVVAVIFESRPNVCADA..GALCLKSGNAVILRG
 342 DPIGKRQLHREL.NEN.....LILERVTVPLGVLGVIFESRPDALIQI..ASLAVRSGNGALLKG
 343 DPIGIVTESWQR.PNG.....MTIERVRVPLGVIGVIFESRPNVAADA..GVLCLKSGNAVILRG
 344 DPVGVATSRWTR.PNG.....LDIARVRTPIGVIAMIYESRPNVTADA..AALCVRSGNAVILRG
 345 DPVGAVTESWQR.PNG.....MTIERVRVPLGVVAVIYESRPNVTADA..GVLCLKSGNAVILRG
 346 EPIGAVKEEIKR.PNG.....LVIKEMVVPFGVVGMIYEARPNVTVDA..CTLAVKTGNAVVLRG
 347 DPVGREIDRFTR.PNG.....LELSRVRVPLGVIGIIYESRPNVTADA..AALGLMAGNAVILRG
 348 DPLGRIEGLAKR.PNG.....LRVGRMRVPLGLIGFIYEARPGATVEA..VSVALKAGNAMLLRG
 349 DPVGQVTRDDVR.PNG.....IRVQKVRVPLGVIAMIYEARPNVTADA..AALCIKAGNGVILRG
 350 DPINEILKRTEV.ADG.....LVLEKTSCPLGVLLIIFESRPDALVQI..ASLAIRSGNGLLLKG
 351 DPVGQALLIREL.DEG.....LVLERRTYPLGVLGVIFESRPDALVQI..AALAVKTGNSVLLKG
 352 DPVGEIVRGYNL.PNG.....LRLTQTRVPMGVIGMIYEARPNVTVDV..ASLCLKSGNAALLRG
 353 DPINEILKRTEV.ADG.....LVLEKTSCPLGVLLIIFESRPDALVQI..ASLAIRSGNGLLLKG
 354 DPVGEIVRGYNL.PNG.....LRLTQTRVPMGVIGMIYEARPNVTVDV..ASLCLKSGNAALLRG
 355 DPVGEVLRGRTL.PNG.....LQLRQQRVPLGVVGIVYEGRPNVTVDA..FGLTLKSGNAVLLRG
 356 DPVGHERYIGKR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 357 DPLGVRQLHREL.DEG.....LVLERVSVPLGVLGVIFEARPDAVIQI..ASLAIRSGNGAILKG
 358 HSVGRVLRRIRV.AHN.....LILEQITVPIGVLLVIFEARPDCLPQV..SALSIASGNALLLKG
 359 EPIGRILKRTEI.ADG.....LILEKTSCPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 360 DPVGEIVRGYNL.PNG.....LRLTQTRVPMGVIGMIYEARPNVTVDV..ASLCLKSGNAALLRG
 361 DPVGQVTERWQR.PNG.....MTIERVRVPLGVIAVIFESRPNVAADA..GVLALKSGNAVILRG
 362 DPIGNERYIGQR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 363 DPVGQVTERWQR.PNG.....MTIERVRVPLGVIAVIFESRPNVAADA..GVLALKSGNAVILRG
 364 DPVGQVMDEWTR.PNG.....LHISRVRTPLGVIGIIYESRPNVTIDA..STLCLKAGNAAILRG
 365 DPIGRVLKKTEV.ADG.....LILEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 366 DPIGRVLKRTEL.AEG.....LILEKTSSPLGVLLIIFESRPDALVQI..ASLAIRSGNGLLLKG
 367 DPVGEILETSTL.PNG.....LEIVKKRVAMGVIGIIYESRPNVTSDA..AALALKSGSAVVLRS
 368 EPLGHTLKRTEI.ADG.....FILEKSSSPLGVVLIIFESRPDALVQI..ASLAVRSGNGLMLKG
 369 DPINQILKKTEV.ADD.....LVLEKTSCPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 370 DPINQILKKTEV.ADD.....LVLEKTSCPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 371 DPIGNERYIGQR.PNG.....LSISKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 372 DPLGRRDLHREL.DQG.....LALERVSVPLGVLGVIFEARPDAVIQI..ASLAIRSGNAALLKG
 373 DPISHTLKRTEV.AKD.....LVFEKTYCPLGVLLIIFESRPDALVQI..ASLAIRSGNGLLLKG
 374 DPVGLILEESAR.TDG.....LNICKKSIPFGLVGMIYESRPNVTSDA..AALAIKSGNAVILRG
 375 DPVGQLRDITER.PNG.....IKIRKMRVPLGVVCMIYEARPNVTADA..GALCFKSGNSVILRG
 376 DPVGAVTERWQR.PNG.....MTIERVRVPLGVIGVIFESRPNVTADA..GVLGLKSGNAVMLRG
 377 DPVGRVLAEWDR.PNG.....LHFRRVATPLGVIGMIYESRPNVGADA..AALCIKSGNAVILRG
 378 DPVGRVLAQFDR.PNG.....LRIERVAVPIGVIGMIYESRPNVGADA..SALCLKSGNAVILRG
 379 DPVGNVVRGQTL.PNG.....LRLRQVNVPMGVVAAIYEARPNVTVDI..AGLALKSGNAVILRG
 380 DPVGDTLSTLEL.DKD.....LILYQVSCPIGLIGVIFESRPDVVPQV..MSLCLKSGNATIFKG
 381 DPVNQVQIKREL.SKG.....LILERKTVPIGVLGVIFESRPDAVMQI..SSLAIRSGNGVMLKG
 382 DPVGSEIDSKVL.ENG.....MSLSRRRVPIGVIGVIYEARPNVTIDI..ASLCLKTGNASILRG
 383 DPLGRRQLHREL.DQG.....LVLERISVPLGVVGVIFEARPDAVVQI..ASLAIRSGNGAMLKG
 384 RNVGRVVKRTKL.ADG.....LELKQVTVPIGVLLVIFESRPDSLPQV..AALAMASGNGLLLKG
 385 DPIGIRQLHREL.NTN.....LYLQRVTVPLGVIGVIFESRPDAVMQI..ASLAIRSGNGAILKG
 386 DPVGQTVRGSAL.PNG.....VKITQIRVPFGVVGAIYEARPNVTIDI..AALALKSGNAAVLRG
 387 DPLGCRQLHREL.DQG.....LVLERVSVPLGVVGVIFEARPDAVMQI..ASLAIRSGNGALLKG
 388 DPVGRRQLHTEL.DAG.....LVLERVTVPLGVVGVIFEARPDALIQI..ASLAIRSGNGALLKG
 389 DPVGEVLRGSTL.ANG.....LEMRQVRVPFGVVGMIYEARPNVTADA..AGICLKSGNAVLLRG
 390 DPINQILKKTEV.ADD.....LVLEKTSCPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 391 DPVGEIFDRREL.PSG.....LRLYKRRVPIGVIGAIYEARPNVTVDI..ASLCLKAGNAVILRG
 392 TNVGRVLRRTKL.AEG.....LELRQITVPIGVLLVIFESRPDSLPQV..AALAMSSANGLLLKG
 393 KNVGRVLRRTKL.ADG.....LELKQITVPIGVLLVIFESRPDSLPQV..AALAMASGNGLLLKG
 394 DPAGQERIIGER.PNG.....LKISKMRIPLGVVCMIYEARPNVTADA..GALCFKSGNGVILRG
 395 EPIGHVLKRTEI.TDG.....LVLEKTSSPLGVLLIIFESRPDALVQI..ASLAIRSGNGLVLKG
 396 DPIGQIIDGGIL.ESG.....TKLERVRVPLGVIGVIYEARPNVTVDV..ATLCLKTGNAVILRG
 397 DPVGEVISEAAR.PNG.....MVLQRVRIPVGVIGIIYESRPNVTADA..AALCVRSGNAAILRG
 398 KNVGRVLRRTRL.AEG.....LELKQVTVPIGVLLVIFESRPDSLPQV..AALAMASGNGLLLKG
 399 DPVGEEFESQVL.ENT.....LRLCKRRVPVGVIGVIYEARPNVTIDI..ATLCLKTGNACILRG
 400 DPIGRVLKKTEV.ADG.....LVLEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 401 DPVGSEIDSRVL.ENG.....MSLARRRVPLGVVGVIYEARPNVTIDI..AALCLKTGNAAILRG
 402 DPIGRVLKKTEV.ADG.....LVLEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 403 DPIGRVLKKTEV.ADG.....LVLEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 404 DPVGDVDKLSLR.PNG.....IQVGKMRIPLGVIAMIYEARPNVTAEA..AALCIKSGNAVILRG
 405 DPVGAVIAEWDM.PSG.....LHIRRVRTPLGVVGVIYESRPNVTADA..GALCLQSGNAVILRG
 406 DPVGEVTASWRR.PNG.....LEIRKVRIPLGVVLMVYEARPNVTVDA..AALCLKSGNAAILRP
 407 DPIGRVLKKTEV.ADG.....LVLEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 408 CSVGQVIKSWKN.KAG.....LEITQVSVPLGVIGVIYESRPNVTSDV..SALCFKSGNVCVLKG
 409 DPVGQVIDQSER.PNG.....LKMSRVRVPIGTIGIIYESRPNVTADA..AALCVRAGNAALLRG
 410 DPIGEVTRGITL.PNG.....LELVTRRVPLGVVMVIYESRPNVTIDV..GALSFKSGNACILRG
 411 DPVGEVVRGWHT.PLG.....VKIEQVRVPIGVIGIIYEARPNVTSDA..AGICLKSGNACLLRG
 412 DPIGEVTRGITL.PNG.....LELVTRRVPLGVVMVIYESRPNVTIDV..GALSFKSGNACILRG
 413 DPIGQIIDGGIL.ESG.....TKLERVRVPLGVIGVIYEARPNVTVDV..ATLCLKTSNAVILRG
 414 DPVGEILETSTL.PNG.....LEIVKKRVAMGVIGIIYESRPNVTSDA..AALALKSGSAVVLRS
 415 DPIGRVLKRTEL.AEG.....LILEKTSSSLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 416 DPIGEVLETSQL.ENG.....LVITKKRVAMGVIGIIYESRPNVTSDA..AALTLKSGNAVVLRS
 417 DPLAGPYDNWKN.HTG.....FKIVKKTVPLGVVAMIFEARPNVTVDA..AALTFKSGNAVILRG
 418 KNVGRVLRRTRL.ADQ.....LELKQVTVPIGVLLVIFESRPDSLPQV..AALAMASANGLLLKG
 419 DPIGKISKGWKN.YAG.....LSIQKMSIPLGLICVIYEARPSLSAEI..AALMIKSSNACVFKG
 420 EPIGQILKRTEI.ADK.....LILEKISCPLGVLLVIFESRPDALVQI..AALAIRSGNGLLLKG
 421 DPVGEVVRGSTL.PNG.....LRLRQLRVPMGVLGVVYEARPNVTVDV..AVLALKSGNAVVLRG
 422 DPIGKISKGWKN.YAG.....LSIQKMSIPLGLICVIYEARPSLSAEI..AALMIKSSNACVFKG
 423 DPIGKISKGWKN.YAG.....LNIQKISIPLGLICVIYEARPSLSAEI..AALMIKSSNACVFKG
 424 DPIGKISKGWKN.YAG.....LSIQKMSIPLGLICVIYEARPSLSAEI..AALMIKSSNACVFKG
 425 EPIGRVLKKTEV.ADG.....LVLEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 426 DVIGVIKDGWQT.KSG.....LKIEKITIPLGNIATIYESRPNVTAEV..AALCIKSANGCALKG
 427 DPVGKVTLARKL.DDN.....LELYRLTCPVGVLLVIFEARPEVIANI..TALAIKSGNAAILKG
 428 DPIGEVLETSQL.ENG.....LVITKKRVAMGVIGIIYESRPNVTSDA..AALTLKSGNAVVLRS
 429 DPIGRVLKKTEV.ADG.....LLLEKTSSPLGVLLVIFESRPDALVRI..ASLAIRSGNGLLLKG
 430 QNVGRVLRRTKL.ADG.....LDLTQITVPIGVLLVIFESRPDSLPQV..AALAIASANGLLLKG
 431 DPLGKTLTAREL.DDG.....LDLYKVSVPIGVIGTVFESRPDALVQI..AALSLRSGNAVILKG
 432 NPVGEILETSTL.PNG.....LEIVKKRVAMGVIGIIYESRPNVTSDA..AALALKSGSAVVLRS
 433 DPIGKISKGWKN.YAG.....LNIQKISIPLGLICVIYEARPSLSAEI..AALMIKSSNACVFKG
 434 DPVGKCTLAKKI.DEG.....LNLYRVSAPIGVLLIIFESRPEVIANI..TALAVKSGNAAILKG
 435 DPIGQVVSGYTN.LDG.....LKILKKRVPLGVIAMIFESRPNVSVDA..FSLAFKTGNAIILRG
 436 DPLGLRQLHREL.DTD.....LVLERITVPLGVVGVIFEARPDAVVQI..ASLAIRSGNGALLKG
 437 DPIGKISKGWKN.YAG.....LSIQKMSIPLGLICVIYEARPSLSAEI..IALMIKSSNACVFKG
 438 DPMGKITLAKKL.DEG.....LNLYRVTAPIGVLLIIFESRPEVIANI..TALAIKSGNSAILKG
 439 DPIGRVLKRTEL.AEG.....VILEKTSSPLGVLLIIFESRPDALVQI..ASLAIRSGNGLLLKG
 440 DPVGEVLQGRVM.ENG.....IQMRQVRVPLGVMGMVYEARPNVTVDA..FGLALKSGNVALLRG
 441 DPVGRELMDTTR.PNG.....LSIKRVATPIGVIGMIYESRPNVGADA..GALCLKSGNAVILRG
 442 DPLGKYTLSREItSNG.....LKLYRRTCPIGVILVIFEARPEVAIQI..SSLTIKSGNAVILKG
 443 TLVGRVLKKVKI.SEG.....LFLEQVTVPIGSLMVIFESRPDCLPQV..ASLAMASGNALLLKG
 444 TLVGRVLKKVKV.SEG.....LFLEQVTVPIGSLMVIFESRPDCLPQV..ASLAMASGNALLLKG
 445 DPVGEVLRGHVM.ENG.....IQMKQVRVPLGVMGMVYEARPNVTVDA..FGLALKSGNVALLRG
 446 DPLGKYTLSREItSNG.....LKLYRRTCPIGVILVIFEARPEVAIQI..SSLTIKSGNAVILKG
 447 TLVGRVLKKVKI.SEG.....LFLEQVTVPIGSLMVIFESRPDCLPQV..ASLAMASGNALLLKG
 448 KNVGREIKRTLL.SDG.....MLLRQVTVPIGVLMVIFESRPDCLPQV..AALAISSANGLLLKG
 449 QNVGKVVRRTKV.SDT.....MDLVQRTVPIGVLMVIFESRPDALPQV..ASLAIASANGLLMKG
 450 DPVGEVVGGSVM.PNG.....MQMRKVRVPLGVMGMVYEARPNVTIDA..FGLALKSGNVALLRG
 451 DPVGEIVRGHTR.PNG.....LRMKQVRVPLGVMGMVYEARPNVTVDA..FGLAIKSGNVPLLRG
 452 QNVGKVVRRTKV.SDT.....MDLVQRTVPIGVLMVIFESRPDALPQV..ASLAIASANGLLMKG
 453 QNVGKVVRRTKV.SDT.....MDLVQRTVPIGVLMVIFESRPDALPQV..ASLAIASANGLLMKG
 454 DPIGRVLKKTQV.ADD.....LILEKTSSPIGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 455 DPVGEVLRGHVM.ENG.....IQMKQVRVPLGVMGMVYEARPNVTVDA..FALALKSGNVAFVRG
 456 DPLGRVTYARSL.DDG.....LDLYKVSCPVGLLLVIFEARPEVIINI..TSLAIKSGNAVVLKG
 457 DPIGRVLKKTQV.ADD.....LILEKTSSPIGVLLIVFESRPDALVQV..SSLAIRSGNGLLLKG
 458 DPVGKVTLRTRI.DNG.....LDLERVTCPIGVLLIIFEARPEVIANI..AALAVKSGNAAILKG
 459 DPIGKISKGWVN.YAG.....LKIEKISIPIGLISVIYEARPSLSAEI..IALMIKSSNACVLKG
 460 DPLAGPYDTWEN.HAG.....LKIVKKIVPLGVVAMIYEARPNVTVDA..AALALKSGNAVILRG
 461 DPVGKVKMAREI.DNG.....LMLYQVTAPVGVILVIFESRPEVIANI..TALCIKSGNAGILKG
 462 RPIGHVLKKTEV.ADG.....LILEKMSCPLGVLLIVFESRPNALVQI..ASLAIRSGNGLLLKG
 463 DPLAGSLAEWTR.PNG.....LVIRRVPQPLGVIGMIYESRPNVGADA..AAICIKSGNAVILRG
 464 DPLGRIEGLAKR.PNG.....LRVGRMRVPLGLIGFIYEARPGATVEA..VSVALKAGNAMLLRG
 465 SPLDITLEERTL.SSG.....LSLRKASVPIGVIGIIYEARPNVTFDV..FALCLKSGNATVLKG
 466 DPVGRVTLRTLL.DDG.....LILERVSCPIGVLLIIFEARPEVIANI..AALSIKSGNAAILKG
 467 DPIGNVTLRTLL.DDG.....LTLEKVACPIGVLLIIFEARPEVIANI..AALSIKSGNAAILKG
 468 DPLARVLSARML.DQN.....LVLCKETASIGVLLVIFESRPDSMPQI..AALALSSGNGLLLKG
 469 DPIGEIIEGYTL.ANG.....LEIRKVRVPLGVVAVIYESRPNVTVDA..FALAYKSGNAVLLRA
 470 DPIGEIIEGYTL.ANG.....LEIRKVRVPLGVVAVIYESRPNVTVDA..FALAYKSGNAVLLRA
 471 SPLDIVLEQRRL.PNG.....LELKKITVPIGVIGIIYEARPNVTFDV..FALCLKSGNATVLKG
 472 SPLHRVLEERTL.PNG.....LELKKVSVPLGVIGIIYESRPNVTFDV..FALCLKSGNATVLKG
 473 DPVDATLEKWSR.PNG.....LTISRVSIPIGVIGVVYESRPNVTADV..ASLCFKSGNAVILKG
 474 DPIGHVTLRTLL.DDG.....LVLERVSCPIGVLLIIFEARPEVIANI..AALSIKSGNAAILKG
 475 SPLGRILKETSR.PNG.....MKLTKVSVPFGVIGIIYEARPNVSFDV..FSLCLKSGNACILKG
 476 DPVGETTPERIL.PSG.....IRVSQRRVPLGVLGVIYESRPNVTVDV..AALALMSGNAVILRG
 477 NPLGVNLFEKSM.PNG.....LSIKKITVPLGVIAVIYESRPNVTIDI..FSLCFKSGNVCILKG
 478 APTGRILEQRTL.PNG.....LELRRQTVPLGVIGIIYESRPNVTFDV..FALCLKSGNATVLKG
 479 SPLDALLEERVL.PNG.....LNLKKVTVPIGVIGIIYEARPNVTFDV..FALCLKSGNATVLKG
 480 DPVGQIQMRTKL.DDD.....LMMERVSCPIGVLLIIFEARPEVIANI..ASLAIKSGNAAILKG
 481 SPLGRILKESIR.PNG.....MRLTKISVPFGVIGIIYEARPNVSFDV..FSLCLKSGNACILKG
 482 DPVDATLEKWSR.PNG.....LTISRVSIPIGVIGVVYESRPNVTADV..ASLCFKSGNAVILKG
 483 NPLGVSLLEKSM.PNG.....LSIKKITVPLGVIAVIYESRPNVTIDI..FSLCFKSGNVCILKG
 484 TPLDAVLEKRTL.PNG.....LELKKVSVPMGVIGIIYEARPNVTFDV..FALCLKSGNATVLKG
 485 DPVGRVTLRTKL.DDG.....LELERVTCPIGVLLIIFEARPEVIANI..AALAVKSGNAAILKG
 486 NPLGVNLLEKSM.PNG.....LSIKKITVPLGVIAVIYESRPNVTIDI..FSLCFKSGNVCILKG
 487 DPLGNVSLRTLL.DDG.....LVLERVSCPIGVLLIIFEARPEVIANI..TALAIKSGNAAILKG
 488 TPVGRILEKRTL.PNG.....LALKKTTVPLGVVGIIYESRPNVTFDV..FALCLKSGNATVLKG
 489 DPVGEQTDEKTL.PSG.....IRVSQRRVPLGVLGVIYESRPNVTVDV..AALALMSGNAAILRG
 490 DPVGKVKMAREL.DDG.....LTLYQVTAPVGVLLVIFESRPEVIANI..TALSIKSGNAAILKG
 491 DPLSEGNTSWQA.KAG.....FKVVKKTVPLGVVAMIYEARPNVTIDA..AALTIKSANAVILRG
 492 DPVGKVKXAREL.DDG.....LTLYQVTAPVGVLLVIFESRPEVIANI..TALSIKSGNAAILKG
 493 SPLDLVLEQRIL.KNG.....ISLHKVTVPLGVIGIIYESRPNVTFDV..FALSLKSGNATVLKG
 494 DPVGKVNFAREI.DEN.....LTLYQITAPVGVLLVIFESRPEVIANI..TALSIKSGNAAILKG
 495 SPLDMTLEERTL.ENG.....LRLRKASVPMGVIGIIYEARPNVTFDV..FALSLKSGNATVLKG
 496 DPVGESLETIQK.ENG.....LSIEKIRVPLGVVGMIYEARPNVTVDA..ATLCLKTGNAVVLRG
 497 APTGIVTFAKEI.GPE.....LELHRVTCPVGVLLVIFEARPEVVVNI..AALAIKSGNAAILKG
 498 DPIGQILSAREL.DNN.....LLLLKQTAPIGVVLVVFESRPESLPQI..ASLALCSGNGLLLKG
 499 APTGIVTFAKEI.GPE.....LELHRVTCPVGVLLVIFEARPEVVVNI..AALAIKSGNAAILKG
 500 DPVGKLQMVREL.DEG.....LTLYKVTAPVGVMLIIFESRPEVIANI..SALCIKSGNAGILKG
 501 DSVGRVLRRTRV.ANN.....LELEQITVPIGVLLVIFESRPDCLPQV..SALAIASGNALLLKG
 502 DPIGDSLETIEK.ENG.....LFIQKIRVPLGVVGMIYEARPNVTVDA..ATLCLKTGNAVVLRG
 503 ----EPVGKTRQ.TQE.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAIAAGNAVVLKP
 504 ----EPVAKTRQ.TQQ.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAVAAGNAVILKP
 505 DPVGVERFHFTH.DNG.....IKVVNKTAAFGTILIIYESRPDVTIEA..GGIAFKSGNKILLKG
 506 ----EPVAKTRQ.TQE.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAIAAGNAVVLKP
 507 ----EPVAKTRQ.TQQ.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAVAAGNAVILKP
 508 ----EPVAKTRQ.TQE.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAIAAGNAVVLKP
 509 NVLTMLD-----.---.....-EAYIQPQPLGVVLIIGAWNYPFVLTIqpLIGAIAAGNAVIIKP
 510 ----KHVKKNIM.TMR.....DEVYIKYEPLGVVLVIGAWNYPVVVLLqpVVGAIAAGNAVVIKP
 511 ----EPVRKTRQ.TQE.....DDLYIHSEPLGVVLVIGAWNYPFNLTIqpMVGAIAAGNAVVLKP
 512 NVLTMLD-----.---.....-EAYIQPQPLGVVLIIGAWNYPFVLTIqpLIGAIAAGNAVIIKP
 513 NVLTMLD-----.---.....-EAYIQPQPLGVVLIIGAWNYPFVLTIqpLIGAIAAGNAVIIKP
 514 DPLARVLSARML.DQN.....LVLCKETASIGVLLVIFESRPDSMPQI..AALALSSGNGLLLKG
 515 DPVSQEISNTTL.ESG.....LKIINKTAPFGTIMIIYESRPDVTIEA..AVLAFKANNKILLKG
 516 NLLTMLD-----.---.....-EAYIQPEPLGVVLIIGAWNYPFALTIqpLIGAIAAGNAVIIKP
 517 NLLTMLD-----.---.....-EAYIQPEPLGVVLIIGAWNYPFALTIqpLIGAIAAGNAVIIKP
 518 DPVGKTISEKTL.DNG.....LKIVNKTDPFGTIMIIYESRPDVTIEA..AVLAFKANNKIFLKG
 519 SPLDQVQWAKRL.AHEts6aaIDLYRITCPIGVLLCIFEARPEVVVNI..ASLAIKSGNAAILKG
 520 N---------LL.TLR.....DEAYINPEPLGVVLVIGAWNYPFVLVMqpLIGAIAAGNAVVVKP
 521 DPIGECVSAWER.PNG.....LSIQEMRVPLGVVGMIYEARPNVTVDA..ATICLKTGNAVILRG
 522 DPIGRVLKRTEL.SDG.....LILEKTSSPLGVLLIVFESRPDALVQI..ASLAIRSGNGLLLKG
 523 DPLRRVRNADYQ.PED.....SQSYSQLMPLGVIGFIYEAFPDLGAIA..AGLCIKTGNSIILKG
 524 DPVNQIISDKKL.ANG.....LIVTNKTVPFGTIMIIYESRPDVTVEA..AVLAFKSNNRILLKG
 525 DPLRRVRNADYQ.PED.....SQSYSQLMPLGVIGFIYEAFPDLGAIA..AGLCIKTGNSIILKG
 526 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 527 NVLTMLD-----.---.....-EAYIQPQPLGVVLIIGAWNYPFVLTIqpLIGAIAAGNAVIIKP
 528 DPLRRVRTADYQ.LED.....SQSYTQLMPLGVIGFIYEAFPDLGAIA..AGFCIKTGNSIILKG
 529 P-----------.--T.....SFVYTRREPLGVCAGIGAWNYPIQIACwkSAPALAAGNAMIFKP
 530 DPVNREISRRTV.SDG.....LEVINRTAPFGTILIIYESRPDVTVEA..AVLAFKSNNKILLKG
 531 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 532 DPVSNEISNTTL.DNG.....LNIVNKTAPFGTIMIIYESRPDVTIEA..AVLAFKANNKILLKG
 533 ----RRVKTPLV.QLP.....AKSFIQLEPYGVVLIIGPFNYPFMLTMdpLIGAIAAGNTAVIKP
 534 HL----------.--G.....CLNYTIRCPVGVAGLISPWNFPLYLLTwkIAPAIAAGNTVVAKP
 535 ----KRIKSSIL.SFP.....SKGYIYSEPYGVVLIMSPWNYPFQLSImpLIGAIAAGNCCIVKP
 536 N---------LN.SAL.....DDVYVKPEPLGVVLIIGTWNYPWAMIFqpLVGAIAAGNAAVVKP
 537 PQLLKGDYTDQV.STG.....IDNWTMRQPLGVVAGITPFNFPCMVPCwmFPVAIAAGNTFVLKP
 538 PQLLKTDFTDQV.GTG.....IDNWVLRQPLGVVAGITPFNFPVMVPMwmFPMAIATGNSFVLKP
 539 DPLGVERFAFTH.ENG.....INVSNKTAPFGTILIIYESRPDVTIEA..AGIAFKSGNKILLKG
 540 PQLLKGDYTDQV.STG.....IDNWTMRQPLGVVAGITPFNFPCMVPCwmFPVAIAAGNTFVLKP
 541 -----------L.RAE.....SFVYTRREPLGVCAGIGAWNYPIQIACwkTAPALAAGNAMVFKP
 542 -----------L.RAE.....SFVYTRREPLGVCAGIGAWNYPIQIACwkTAPALAAGNAMVFKP
 543 -----------L.RAE.....SFVYTRREPLGVCAGIGAWNYPIQIACwkTAPALAAGNAMVFKP
 544 -----------L.RAE.....SFVYTRREPLGVCAGIGAWNYPIQIACwkTAPALAAGNAMVFKP
 545 ---PDKVTNPIT.HKG.....SKSYIMKEPLGVILVIAPWNYPLQLSLapVIGAIAAGNTVIIKP
 546 DPIQQVFNAPYR.LNM.....AGTYSQLKPLGVVALVYETFPELGAIA..AGFCLKTGNSLLLRG
 547 ----EKPEKTLV.NIM.....DQVIIHKEPYGVVLIIGAWNYPLQLVFapLAGAIAAGNCALLKP
 548 G-----------.PTG.....EDNFIFFEGRGVFLCISPWNFPLAIFIgqVSAALAAGNAVLAKP
 549 PEVLKGEYSRNV.GPN.....IDAWSDFQPLGIVAGITPFNFPAMVPLwmYPLAIACGNCFILKP
 550 PHLLKGGYSENV.STR.....VDAYSILQPLGVVTGITPFNFPAMVPMwmFPIAIACGNTFVLKP
 551 G-----------.PTG.....EDNFIFFEGRGVFLCISPWNFPLAIFIgqVSAALAAGNAVLAKP
 552 ------------.---.....------NPPRGIVVAISPWNFPLAIFIgeVCSALVTGNVVIAKP
 553 PEILKGEYSRNV.GPN.....IDAWSDFQPLGIVAGITPFNFPAMVPLwmYPLAIACGNCFILKP
 554 ---PETVKTSVT.TFP.....SSAQIVSEPLGVVLVISAWNFPFLLSVepVIGAIAAGNAVVLKP
 555 ---PETVKTSVT.TFP.....SSAQIVSEPLGVVLVISAWNFPFLLSVepVIGAIAAGNAVVLKP
 556 DPIGQVIKGYTN.LDG.....LKILQKRVPLGVIAMVFESRPNVSVDA..FSLAFKTNNAIILRG
 557 PEILKGEYSRNV.GPN.....IDAWSDFQPLGIVAGITPFNFPAMVPLwmYPLAIACGNCFILKP
 558 -----------D.PAG.....CVHYTVRAPVGIAGLISPWNLPLYLLTwkVAPAIAAGNTVIAKP
 559 DY----------.---.....-LSMSVHEPLGVVAAITPWNSPIASDAqkLGPALAAGNAVVLKP
 560 DY----------.---.....-LSMSVHEPLGVVAAITPWNSPIASDAqkLGPALAAGNAVVLKP
 561 ---PERVHVPLH.YQF.....GRASVRREPFGVVLVIGAWNYPLNLSLvpLVSAVAAGNCVLVKP
 562 DY----------.---.....-LSMSVHEPLGVVAAITPWNSPIASDAqkLGPALAAGNAVVLKP
 563 ------------.---.....-----THRPLGPVVCISPWNFPLAIFTgqVAAALAAGNPVLAKP
 564 HL----------.--G.....CMHYTVRTPVGIAGLISPWNLPLYLLTwkIAPAIAAGNTVIAKP
 565 DY----------.---.....-LSMSVHEPLGVVAAITPWNSPIASDAqkLGPALAAGNAVVLKP
 566 ------------.---.....----DTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 567 EMSQLPGR----.---.....--GWVEYEPYGTVLVIGAWNFPFALTLgpAVGAIAAGNTVVLKP
 568 DPIQQVMRASFQ.HEH.....SQAYSQLMPLGVIAFVYEALPELAAIA..TGLCLRVGNSILLKG
 569 ------------.---.....---NETHRPLGPVVCISPWNFPLAIFTgqVAAALAAGNTVLAKP
 570 ----KKVKTAMT.HIG.....SKGYIIPEPYGAALIIAPWNYPVQLALspLIGAIAAGNTAVIKP
 571 ------------.---.....RTLGVGHKALGPVVCISPWNFPLAIFTgqIAAALVAGNPVLAKP
 572 GAAWAMH-----.---.....-GATIRSEPKGTVLVLGAWNYPITVQIgpVIGAIAAGNTVILKP
 573 ------------.---.....----DTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 574 ------------.---.....RTLGVGHKALGPVVCISPWNFPLAIFTgqIAAALVAGNPVLAKP
 575 ------------.---.....RTLGVGHKALGPVVCISPWNFPLAIFTgqIAAALVAGNPVLAKP
 576 ---TEKVYSPLH.FKP.....ASSYILKEPLGVVLIMSPWNYPVNLALipLIGAIAGGNCALLKL
 577 DPIQQVMRASFQ.HEH.....SQAYSQLMPLGVIAFVYEALPELAAIA..TGLCLRVGNSILLKG
 578 R-----------.--N.....IDTYSITQPLGVCVGITPFNFPAMIPLwmFPLAIACGNAFILKP
 579 R-----------.--N.....IDTYSITQPLGVCVGITPFNFPAMIPLwmFPLAIACGNAFILKP
 580 ------------.---.....----DTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 581 ------------.---.....----DTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 582 R-----------.--N.....IDTYSITQPLGVCVGITPFNFPAMIPLwmFPLAIACGNAFILKP
 583 -----------T.NSQ.....LRYVVLKQPVGVCAAITPWNFPAAMITrkAAPALAAGCTIIIKP
 584 -----------T.NSQ.....LRYVVLKQPVGVCAAITPWNFPAAMITrkAAPALAAGCTIIIKP
 585 ------------.---.....--LGPGHGPLGPIVCISPWNFPLAIFTgqIAAALVAGNPVLAKP
 586 PTLLKGDYSDQV.STG.....IDVFSFREPLGVVAGITPFNFPVMVPLwmAPMAIATGNAFILKP
 587 ------------.-ES.....SFVYTRREPLGVTVGIGAWNYPIQIALwkSAPALAAGNAMIFKP
 588 ------------.---.....RNPQAYQNPRGIIVAISPWNFPLAIFTgeVVSALVAGNVVLAKP
 589 ---ISGDNFPGG.TRN.....KMSYVSRVPLGTVLAISPFNYPVNLSMskIAPALIGGNAVVLKP
 590 ---GRRVPTPLT.LFG.....SKSYIVPEARGVCLLIAPWNYPFQLAFspLVSAIASGNCAIMKP
 591 ---PKSISSAWL.NFP.....SSDKIYYVPWGKILVIAPWNYPFQLAItpVIGAIACGNTVVLKP
 592 ---GDYFDMRTA.EGD.....VFSYTVRKPHGVVGIISPWNLPMLLMTwkVAPALACGNAVVVKP
 593 DYL---------.---.....--TMSVYEPIGVVAAITPWNSPIASDAqkLAPALAAGNAVVLKP
 594 DYL---------.---.....--TMSVYEPIGVIAAITPWNSPIASDAqkLAPALAGGNAVVLKP
 595 ------------.-ES.....SFVYTRREPLGVTVGIGAWNYPIQIALwkSAPALAAGNAMIFKP
 596 ------------.---.....-----NYRPLGPVVCISPWNFPLAIFLgqIAAALAAGNTVLAKP
 597 ------DNFPGF.NRS.....KISVVTREPLGVVLAISPFNYPVNLSAskIAPAIVAGNSVVLKP
 598 ------------.--G.....EFSNDTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 599 DYL---------.---.....--TMSVYEPIGVIAAITPWNSPIASDAqkLAPALAGGNAVVLKP
 600 --------ALPM.DTG.....HHAYTRFEPAGVVAAIAPWNFPLMLETwkVAPALAWGNTVVLKP
 601 ------------.--G.....EFSNDTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 602 DPLQRVMASPYQ.FNL.....AQTYCQLMPLGVVALVYESFPELAAIA..AGFCLKTGNSLVLRS
 603 GESIPGDTFPGF.KRN.....KISVVNREPLGVVLAISPFNYPINLSAskIAPAIIVGNSLVLKP
 604 ------------.---.....---YIQPQPLGVVLIIGAWNYPFVLTIqpLIGAIAAGNAVIIKP
 605 ------------.-ST.....QRITVLKQPVGVCAAITPWNFPSAMITrkAAPALAAGCTMIVKP
 606 ---PKHSKLPLL.FYP.....AKGKVISEPYGTVLVLSSWNFPISLSLdpLIGAIAAGNTVLLKS
 607 PPHYQFGHG---.---.....---AVHPEPRGVVLIIGAWNYPLQLVLapLAAALAAGNCAVLKP
 608 -----------T.TSS.....KFAYTIRQPIGVVGQIIPWNYPLSMATwkLGPALACGNTVVLKP
 609 ------------.---.....-----AQEPLGPVVCISPWNFPLAIFTgqVAAALVAGNAVLAKP
 610 ------------.---.....---NETHRPLGPVVCISPWNFPLAIFTgqIAAALAAGNSVLAKP
 611 ----EDRIVPML.MGT.....KSARLEYHPLGVIGIIIPWNYPIHSIIsaAAAAIFAGNAALVKV
 612 ------------.--K.....PFNNKTHIPLGCVLCISPWNFPLAIFLgqISAALASGNAVIAKP
 613 PHLLKGGNSPQV.STG.....VDVHSIRQPLGVVGIISPFNFPAMVPMwfFPIAIAAGNAVVLKP
 614 PALLKGEFTDNG.GPG.....IDLYSMRQPLGVVAGITPFNFPAMIPLwkMGPALASGNAMILKP
 615 -------KRMGH.APG.....EISHLFYEPRGVAAVIAPWNFPMAISTgmTSAALVTGNTVVYKP
 616 ---PQKVTAPLM.TFP.....STARVAAEPLGVVLVISAWNYPFLLSIdpIIGAIAAGNAVVLKP
 617 ------------.---.....----------GVLLMVFESRPDALVQI..ASLAIRSGNGLLLKG
 618 NL---------L.TVS.....DEVYIQPEPLGLVLIIGAWNYPWAITLqpLVGAIAAGNAAVIKP
 619 ------------.---.....------QQSLGPVVCISPWNFPLAIFTgqVAAALMAGNPVLAKP
 620 NKIYGETIPLTN.PAD.....FHAYTLREPVGVVGQIVPWNFPLMMAVwkVAPALAAGCTVILKP
 621 ---LRRPKVPLL.YQP.....AKAQVVREPYGVALIMGAWNYPLQLCLapLVSALAAGNCAIIKP
 622 ------AVIPSQ.DAN.....KRIFTFREPNGVYACITPWNFPTVIPSelIAPAIAAGNAVVAKP
 623 ENQGFIRFTGKA.YRN.....EESISIMKPYGVFGVISPFNFFSIGVGm.SSAPLVTGNAVILKP
 624 ------------.-GG.....IDVYTLIQPLGVCAGITAFNFPVMLPCfmFPIAVACGNTFVLKP
 625 ---GKEAKLPQI.ALL.....SSAEIVAEPLGLVLIISSWNFPFGLSLepLIGAIAAGNVAVLKP
 626 ------------.-GG.....IDVYTLIQPLGVCAGITAFNFPVMLPCfmFPIAVACGNTFVLKP
 627 ------------.---.....-----QDPPVGLFTCISPWNFPLAIFTgqIAAALAAGNAVLSKP
 628 --ADEGGKMDAS.TGH.....KLAVIRRQPVGIVLAIAPYNYPVNLSGskIAPALIGGNVVMFKP
 629 --ADEGGKMDAS.TGH.....KLAVIRRQPVGIVLAIAPYNYPVNLSGskIAPALIGGNVVMFKP
 630 ------------.---.....-----TRPPRGAVVAISPWNFPLAIFTgqVAAALMAGNAVLAKP
 631 PLRMEGKILPSN.IPG.....KENRIYRSAKGVIGVISPFNFPLVLAMrsVAPALATGNAVVLKC
 632 --ADEGGKMDAS.TGH.....KLAVIRRQPVGIVLAIAPYNYPVNLSGskIAPALIGGNVVMFKP
 633 --ADEGGKMDAS.TGH.....KLAVIRRQPVGIVLAIAPYNYPVNLSGskIAPALIGGNVVMFKP
 634 -----EDHILEG.PTG.....EINALSYSPKGHILCISPWNFPVAILIgqISAALACGNKVTVKP
 635 PTRMNGDHKQSV.VEG.....KENIVVREPQGVVGIISPWNFPLNLSIraVAPAVAAGNSVVLKP
 636 -----------G.MVG.....RWAMTIRRPCGVAGLIIAANTPAPNFAwkVFPALICGNAVVLKT
 637 --------IPSD.VPG.....SLALAVRQPCGVVLGIAPWNAPVILATraLAMPLACGNTVVLKA
 638 DS---------V.RPG.....VKIEVTREAVGVVAIISPWNFPTATAVwkIAPALAFGNSVIWKP
 639 ------------.---.....----LTAGPRGVIAAISPWNFPLAIFTgqIAAALAAGNAVIAKP
 640 -------EVIPF.MNN.....YDVAMYREPHGVVAVILPWNYPAQQVGrsIAPALAMGNTVVLKP
 641 ------------.---.....---MSGSRPLGVALCISPWNFPLAIFTgqVAAALMAGNPVLAKP
 642 DLATGHEERVWS.SRG.....TLNRVIRMPAGPALIITPWNAPFMLSTwkCAPALAAGNTVILKP
 643 ------------.---.....---NNTHRPLGPVVCISPWNFPLAIFSgqIAAALAAGNTVLAKP
 644 ENHGFIKFTGKA.YEN.....EESMSFMKPYGLFAVISPFNFFSIGVGm.TTGPLITGNAVLLKP
 645 -------IIPSD.SPS.....ENLLLQREPIGVVACLIPFNYPVYTLLrkIAPALITGNSVVVRP
 646 A-----------.--N.....QRIVVLKQPVGVVGAITPWNFPSSMITrkAAAALAAGCPIVIKP
 647 ------------.---.....--------ARGLWTCISPWNFPLAIFLgqVSAALAAGNAVIAKP
 648 ------------.---.....------GAPRGIVGAISPWNFPLAIFTgqIAAALMAGNAVIAKP
 649 ----RPLDTTVL.SGP.....AKTYLKPEPYGVALVMSAWNYPLFTAIppFAQALAAGNCVVLKP
 650 KLFSKKFKLFDF.LKN.....KRTYTVFEPYGQVLIITPWNYPFYLTFvpIINALSAGNTLLVKP
 651 ------------.---.....-----EGTPIGTFTCISPWNFPLAIFTgqIAAALAAGNAVLSKP
 652 ES----------.---.....-LGLVLREPLGVVASIVPWNFPLMMTAwkIGPALAAGNSVILKP
 653 KMDGYVLQMRSP.IPN.....ERPLSVLRPYGAWFVISPFNFPIALAKgmLTGVLLMGNTAVWKP
 654 ------------.---.....-----DAAPAGIFTCISPWNFPLAIFTgqVSAALATGNAVLAKP
 655 N--TLMGESLEV.AKN.....MRTEMYREPLGVVAAIAPFNFPAMVPLwsIPLALVTGNTLILKP
 656 -NQGFIKLTGKA.YKN.....EESMSVMKPYGVFGVISPFNFFSIGVGm.SSGPLVTGNAVILKP
 657 ---PSKRHISIL.HQP.....AKGWVEYQPLGVIGIITPWNYPLLLSVgpLICALAAGNHAMIKI
 658 ---EKVENPGGP.FQF.....ANPRIRPVPLGVVLVITPWNYPVMLNIspVIAAIAAGCPIVLKM
 659 -----------R.DPR.....VQQMVLREPVGVCIAFTPWNFPFSQALrkVVAALASGCTIILKG
 660 ------------.-KN.....VDIYSYVQPLGVCAGITPFNFPAMIPLwmFPLAIACGNTFVLKP
 661 ----TTLLRPAR.LAG.....LRAEVEPVPVGVVGIVGPWNFPVNLVVlpAAAAFAAGNRVMIKM
 662 ---------LPG.PTG.....ERNTLALRGRGVFVAISPWNFPLAIFLgqITAGLMAGNAVVAKP
 663 ARIMEGLASGEY.MEN.....MNSVIRREPIGVVGQVTPWNYPLMMAIwkIGPALAAGNTIVLKP
 664 GP----------.-TG.....ETNELRLTARGAWVCISPWNFPLAIFTgqVAAALATGNAVLAKP
 665 ------------.---.....------AASAGIFTCISPWNFPLAIFSgqIAAALATGNAVLAKP
 666 -----------I.PVL.....SQTVVSHRPKGVVGIVSPWNYPLSLAItdALPALMAGNAVVLRP
 667 ------------.--G.....EFSNDTHRPLGPVVCISPWNFPLAIFMgqVAAALAAGNTVLAKP
 668 -------RELPG.PTG.....ESNTLHLHGRGVFVCISPWNFPLAIFAgqVVAALVAGNSVAAKP
 669 DPIGSLERGCRQ.DNG.....LFIGRYRVPLGLIALVYEIYPEFALNG..IGMCLKTSNGVILAG
 670 A----GLFF---.RYV.....GKAWIRKEPRGVVLIIGAWNYPLSTLLsvAAAAIAAGNSVILKP
 671 ----VNLEISAR.AKG.....YQGMTKKVPIGPCSFISPFNFPLNLAAhkVAPAIAAGCTFVLKP
 672 ----RKVSPTLL.TLG.....THAQIGYQPKGRCLIIGPWNYPVATVLgpLVSALAAGNTAILKP
 673 DPIGKLEKGHRQ.ENG.....LFIGRYRVPLGLIALVYEIYPEFALNG..IGMCLKAGNGVILAS
 674 ---NLRGTMQEI.SPG.....QMSLFHREAAGVAGIIVPWNAPVTLLVrsLGPALAAGCTCLIKP
 675 -----------E.RPG.....HRMMETWHPIGVCGVISAFNFPVAVWAwnAALAFVCGDSVVWKP
 676 -----------E.RPG.....HRMMETWHPIGVCGVISAFNFPVAVWAwnAALAFVCGDSVVWKP
 677 ESVGRVLRRTRI.AKN.....LELEQVTVPIGVLLVIFESRPDCLPQV..AALAIASGNGLLLKG
 678 -----------D.PAG.....CVHYTVRAPVGIAGLISPWNLPLYLLTwkVAPAIAAGNTVIAKP
 679 YPPTR-------.--E.....RIGVVVWRPLGTVLCITPFNFPLNIAMhkLGPAFAAGNAVLFKP
 680 -----------E.RPG.....HRMMETWHPIGVCGVISAFNFPVAVWAwnAALAFVCGDSVVWKP
 681 -----------E.RPG.....HRMMETWHPIGVCGVISAFNFPVAVWAwnAALAFVCGDSVVWKP
 682 GPEVLKDEERTL.PDG.....GKGLITNAPIGVIYGIQPWNFPTYQVIryAIANLMAGNGVLLKH
 683 DFIEFYPHSLEE.LKK.....QNPKVTFTPKGIGVTIAPWNFPIGISVgtIAAPLAAGNVVIYKP
 684 DFIEFYPHSLEE.LKK.....QNPKVTFTPKGIGVTIAPWNFPIGISVgtIAAPLAAGNVVIYKP
 685 DFIEFYPHSLEE.LKK.....QNPKVTFTPKGIGVTIAPWNFPIGISVgtIAAPLAAGNVVIYKP
 686 ------------.---.....---------------------------..-----------LLKG
 687 DPIGEVTSMFKR.PNG.....LRIGVQRVPLGVVGIIYEARPNVTADA..AALCLKTGNAVILRG
 688 ------------.---.....---------------------------..---------------
 689 ------PYSLKE.LRR.....ANPKTRFSPKGVGLVIAPWNFPIGISVgsISSMLASGNVVIYKP
 690 DFIEFYPHSLEE.LKK.....QNPKVKFAPKGIGVTIAPWNFPVGISVgtIAAPLAAGNVVIYKP
 691 AYHERTGTVEND.MPG.....AKAFIRHKPHGVVAVYGPYNFPGHLPNghIVPALIAGNTVVFKP
 692 ------------.---.....---------------------------..---------------
 693 ------------.---.....---------------------------..---------------
 694 D-----------.---.....ADAEILCEPLGVLLAIEPWNFPFYQVVriAAPQISAGNTLLLKH
 695 ------------.---.....---------------------------..---------------
 696 ------------.---.....---------------------------..---------------
 697 ------------.---.....--DGATFVPANLTVVTPPWNFPVAIPAgsTLAALAAGSAVVIKP
 698 ------------.---.....---------------------------..---------------
 699 ----LDDERYPS.DAQ.....VTRFVRRNGQGVHLSIAPWNYPVGLLPwlIVTPILGGNTVILKH
 700 ---------PAR.LAG.....LRAEVEPVPVGVVGIVGPWNFPVNLVVlpAAAAFAAGNRVMIKM
 701 G-----------.---.....-VDGAQFVPPRVTVVTPPWNFALSITAgsTLAALAAGSSVLLKP
 702 ------------.---.....---------------------------..---------------
 703 ------------.---.....---------------------------..---------------
 704 HL----------.--G.....CLHYTVRAPVGIAALISPWNLPLYLLTwkIAPAIAAGNTVIAKP
 705 ----KTIGIIGE.DKE.....ANTIDIATPVGVVAGLIPSTNPTSTVIykTIISLKAGNTIVFSP
 706 ------------.---.....---------------------------..---------------
 707 ----ATVGVIHD.DAA.....KKVTEIAVPVGVIAGLIPSTNPTSTVIykALISLKAANSIVFSP
 708 ------------.---.....---------------------------..---------------
 709 DYMKDKRSVGII.EED.....DGIISIAEPFGVIAAITPVTNPAATTLfkSLIALKGRNVICLAF
 710 ----KTVGIINE.NKE.....KKYFEVGVPVGVVAGLIPSTNPTSTTIykTLISLKSGNAIVISP
 711 DPWQQPL-----.PTR.....PERFQYAVPLGVVALVYEGLPTLSLML..AGMALKTGNALVLWS
 712 ---PETVKTSVT.TFP.....SSAQIVSEPLGVVLVISAWNFPFLLSVepVIGAIAAGNAVVLKP
 713 ----------RR.TDR.....LEVYELSVPLGMVGILSRFRPRISIDT..VAMGLFAGNTVLLDG
 714 SFITLLD-----.---.....-KVTIQRQPYGVVLIISPWNFPFVLAFqpLIGAIAAGNTVLLKP
 715 -----VKTVGVI.KDE.....NNIIEIAEPVGVIAGVCPTTNPTSTVAfkVLSALKCRNAIIFGF
 716 ----KTAGIISE.DNV.....TGITEIADPVGVVCGITPTTNPTSTTIfkALIALKTRNPIVFAF
 717 ----KTVGIIGE.DKV.....SGSIQIAAPLGVLAGIVPTTNPTSTTMfkILVALKTRNAIVFAF
 718 SLMGQTGSGALQ.IES.....PMVDAMSVPMGVILGLIPVTNPVETLVfkTLISLKSRNAIILSS
 719 YYRGQDFVSPRV.DTV.....NKIVEIPRPAGVVLALTPTTNPVSTVYfkVLLALMTRNAVVVAP
 720 YYREQDFVSPRV.DPD.....SKIVEIPRPAGVVLALTPTTNPVSTVYfkVLLALMTRNAVVVAP
 721 ------------.---.....---------------------------..---------------
 722 ----KTIGVISE.DKV.....NKMIEIAEPVGLIMGIVPSTNPTSTAIfkSIIAIKSRNAIVFSP
 723 ATRGKVISSV-D.HDG.....WKVEQVVSPLGIVAFVFEGRPNVFADA..A-GVLRTGNTAVLRI
 724 ---DQDYVTPRV.DTA.....RKIVEIPRPAGVVLALTPTTNPVATVYfkVILALMTRNAVVVAP
 725 --LWEKPQGKHD.PIK.....MEKRFTVVPRGIALVIGCSTFPTWNGYpgLFASLATGNTVIVKP
 726 --LWEKPQGKHD.PIK.....MEKRFTVVPRGIALVIGCSTFPTWNGYpgLFASLATGNTVIVKP
 727 -----KPQGKHD.PIK.....MEKRFTVVPRGIALVIGCSTFPTWNGYpgLFASLATGNTVIVKP
 728 DPVGKERVIGTR.PNG.....IEIKKMRIPLGVVCMIYEARPNVTADA..GALCFKSGNAVILRG
 729 ------------.---.....---------------------------..---------------
 730 ------------.---.....-------------------RPDALVQI..AALAIRSGNGLLLKG
 731 EPIGHVLNRTEI.ASG.....FVLEKKSSSLGVLLVIFESRPDALVQI..ASLAIRSGNGLLLKG
 732 DLICVECFSFKH.DNG.....LQVDKKTASFGSVLIIYESRSDITQEA..AGIAFKSRNKILLKG
 733 ------------.---.....---------------------------..---------------
 734 ------------.---.....---------------------------..---------------
 735 ------------.---.....---------------------------..---------------
 736 ------------.---.....---------------------------..---------------
 737 ------------.---.....---------------------------..---------------
 738 ------------.---.....---------------------------..---------------
 739 ------------.---.....---------------------------..---------------
 740 ------------.---.....---------------------------..---------------
 741 ------------.---.....---------------------------..---------------
 742 ------------.PTG.....ERNTYTLGPRGTVLCVAA-TPGGARAQ..FAAVLATGNRALFAG
 743 ------------.PTG.....ERNTYTLGPRGTVLCVAA-TPGGARAQ..FAAVLATGNRALFAG
 744 -----------G.PTG.....ERNTYTLGPRGTVLCVAAT-PSGARAQ..FAAVLATGNRALFAG
 745 ------------.--G.....EKNTYLLLPRERILCLSNDENDLLIQL..AAV---------TSI
 746 -----------G.PTG.....ERNTYTLGPRGTVLCVAAT-PSGARAQ..FAAVLATGNRALFAG
 747 ------------.---.....---------------------------..---------------


         150         160                       170            180      
          |           |                         |              |      
   1 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVN.....TREEVELDKM
   2 GKEAFNSN.LALVT.LMEEAL....R....S.E.....E.I.PEGAVGMIkt7daANYLMRLNGY
   3 GSEAIHSN.QAIAR.CLKQGL....S....E.A.....G.L.PETAVQVVst7aaVGELITMPQF
   4 GSEAFYSN.QALTR.VISRAA....T....A.A.....G.A.PEGAIQLIet7eaVNLLLRANDY
   5 GSEAIHSN.QAIAR.CIQQGL....A....E.A.....G.L.PAAAVQVVet7aaVGALISMPEY
   6 GSEAIHSN.QAIAR.CIQQGL....A....E.A.....G.L.PAAAVQVVet7aaVGALISMPEY
   7 GSEAAYSN.RALAK.CIQSAL....H....E.S.....G.L.LPTAVQVVet7aaVGEMIAMPEY
   8 GSEAFHSN.QAIAA.CVHEGL....A....A.A.....G.L.PAEAVQVLat7aaVGELIAMPEY
   9 GSEAAYSN.RALAK.CIQSAL....H....E.S.....G.L.LPTAVQVVet7aaVGEMIAMPEY
  10 GSEAFHSN.QAIAC.CIHQGL....E....Q.A.....G.L.PQEAVQVVet7laVGALITQEEH
  11 GSEAINSN.KILAR.IIEDTA....V....A.A.....G.L.PEGCVQLIqt7kaVKVLFNLTEY
  12 GSEAIHSN.QAIAR.CIQQGL....A....E.A.....G.L.PAAAVQVVet7aaVGALISMPEY
  13 GSEAIHSN.QAIAR.CIRLGL....A....E.A.....G.L.PAAAVQVVet7aaVGALIGMPEF
  14 GSEAIHSN.LAIAR.ILGEEL....K....R.A.....G.I.PAAALSVVpf7egVLEMLKQEEF
  15 GKEAINSN.RAIAA.ILREAM....V....S.K.....G.V.PAGALALIpf7qgVLEMLKQEEC
  16 GSEAIHSN.RAIAT.CIQQGL....A....A.A.....D.L.PPHVVQVVet7aaVGALITMPEF
  17 GSEAIRSN.MAIVK.VIAAAA....E....E.A.....G.L.PSGSIQLVed7evAQQMMTMNKY
  18 GSEAIHSN.RAIAT.CIQQGL....A....A.A.....D.L.PPHVVQVVet7aaVGALITMPEF
  19 GSEAINSN.LKIVE.IISDAL....K....E.A.....G.L.PEGSVQILed7etATDFMRLNDY
  20 GSEAINTN.KAIGK.ILENSA....I....E.S.....G.L.PEGTIQLIet7eiVNKMLKLNEY
  21 GSEAIQSN.QAIAD.CISQGL....S....K.V.....G.L.PEAVVQVVnt7eaVGELITMTES
  22 GSEAIHSN.RAIAA.CIRRGL....E....A.G.....G.L.PADAVQLIet7aaVGALLAADEY
  23 GSEAIHSN.IAIGR.LLKDVL....K....E.T.....S.L.PEAAIQVVet7eaVYELLQLEEY
  24 GKETYRTN.AATVR.VIQKAL....K....A.C.....G.L.PEAAVQAIdn7slVNEMLRMDKY
  25 GSDAINSN.IAISS.ILAKAA....Y....E.T.....G.I.PEGAIQLIen7eeVNRMMKLNGL
  26 GKETHRTN.AATVR.VIQKAL....K....A.C.....G.L.PEAAVQAIdn7slVNEMLRMDKY
  27 GSEAINSN.KAIVK.ALTKGI....E....R.S.....G.L.PKASVQLVed7evATEMMRLNEF
  28 GKETHRTN.AATVR.VIQKAL....K....A.C.....G.L.PEAAVQAIdn7slVNEMLRMDKY
  29 GSEAIHSN.KAVAV.CIAAGL....K....A.A.....G.L.PETAVQVVet7aaVGELITMTKY
  30 GSEAIHSN.QAIAA.CIENGL....K....T.A.....G.L.PASVVQVIkt7aaVGELITMPDY
  31 GSEAIHSN.RAIAG.VLKGVL....A....A.L.....G.L.PAGALQLVgt7aaVTELLKQEDY
  32 GSEAIHSN.RAIAT.CIQRGL....A....E.A.....G.L.PAAVVQVVet7eaVGALISMPEF
  33 GSEAYYSN.QAIAK.AVVEGL....K....V.A.....N.L.PEHAVQVInt7aaVGELITMPEY
  34 GSEALQSN.KAIAT.AIQHGL....K....V.A.....G.L.PEHAIQVIet7aaVGQLITMTEY
  35 GSEARETN.KILAQ.IITEAT....E....E.V.....G.I.PPNWIKLLetradVNEMLKMDKY
  36 GSEARETN.RVLAA.IIAGAT....H....K.A.....G.L.PPDWIALLetrsdVGEMLKMDKY
  37 GKEALHCN.QAIAQ.CVRTGL....A....A.A.....G.L.PETSVQVVet7aaVGHLITMPEF
  38 GSEAIHSN.RAIAT.CIQRGL....A....E.A.....G.L.PAAVVQVVet7eaVGALISMPEF
  39 GKEAFHSN.QILVT.ILQEAL....I....Q.E.....A.V.SPHLIQFVdd7etAQQLMRLNDY
  40 GSEAIQSN.QAIAA.CVQEGL....R....S.A.....G.L.PEHAVQVVet7aaVGELITMSEY
  41 GSEAIHSN.RAIAT.CIQRGL....A....E.A.....G.L.PPAVVQVVet7eaVGALISMPEY
  42 GSEAIQSN.RAIAD.CIRQGL....A....A.A.....D.L.DAACVQVVat7aaVGALIAMPEY
  43 GSDAINSN.IAIAS.ILAEAA....Y....K.S.....G.I.PEGAIQLIen7eeVNRMMKLNGL
  44 GSEAIHSN.RAIAA.CIARGL....A....E.A.....G.L.PAAVVQVVet7aaVGALITMPEY
  45 GSEAIHSN.RAIAA.CIQRGL....A....A.A.....E.L.PAAVVQVVet7aaVGALITMPEY
  46 GSEAIYSN.QAIAA.CVREGL....K....T.A.....G.L.PETAIQVIet7aaVGELVTMKEF
  47 GKEAINSN.TAIAK.IIKNAV....V....T.A.....G.L.PDGSIEFIdi7etVNVMMRLNGL
  48 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  49 GSEAIHSN.RAIAA.CIERGL....A....E.A.....G.L.PAAVVQVVet7aaVGALISMPEY
  50 GKETHNTN.QATVK.VIQQAL....E....Q.S.....G.L.PAAAVQAIdk7elVIQLLKLDRY
  51 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  52 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  53 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  54 GKETCRTN.AATVA.VIQDAL....N....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  55 SSSAYSSN.TVLTD.VIRQAL....A....S.T.....R.V.PVDAVQMVpg7esVKHLMRARGL
  56 GSEAIHSN.NALAG.CIQQGL....E....V.A.....G.L.PQAVVQVVdt7eaVGYLISMPEY
  57 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  58 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  59 GSEAINSN.VALVK.TMKEGL....I....E.A.....G.I.DEGSIEIVed7etAVAMMKLNEY
  60 GSEALECN.TALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
  61 GKETHRTN.AATVL.VIQKAL....K....A.C.....D.L.PEAAVQAIdn7slVSEMLRMDKY
  62 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  63 GSEALHSN.VALGR.IVQAGL....Q....A.A.....G.L.PTAAVQVIdt7aaVGKLVTMTEH
  64 GKEAFFSN.QLLVQ.LLQQVL....V....S.A.....G.E.SPYAIQFVdd7etAGQLMRLTEY
  65 GSEAIHSN.TAIGA.ILKNEL....K....G.M.....G.L.PEAALQVVtt7qaVNELLKLDEE
  66 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  67 GEEALNSN.RIIAR.IIAQSA....K....D.C.....G.I.PEGAVQLVds7qaAVYMMKMNDY
  68 GKETCRTN.AATVV.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  69 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
  70 GSEAIHSN.RAIAA.CIERGL....A....E.A.....R.L.PAAVVQVVet7aaVGALITMPEY
  71 GSEALESN.TALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
  72 GSEALHSN.VALGR.IVQAGL....Q....A.A.....G.L.PTAAVQVIdt7aaVGKLVTMTEH
  73 GSDALNSN.KAIVS.AIREAL....K....E.T.....E.I.PESSVEFIen7slVLEMIRLREY
  74 GSEALESN.AALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTDY
  75 GSEALESN.TALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
  76 GSEALESN.AALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
  77 GSEAIQCN.RALAA.IVHEGL....A....A.A.....A.L.PASAVQVVat7aaVGELITMKDY
  78 GSEALESN.AALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
  79 GKETHNTN.QATVK.VIQQAL....E....Q.C.....G.L.PAAAVQAIds7alVNELLRLDRY
  80 GSEALRCN.QAVAA.CVREGL....E....A.A.....G.L.PAAVVQVVet7aaVGELITMKDY
  81 GKDALHSN.KALVK.LIRQSL....E....K.S.....G.I.TPDAVQLVed7avAEELMQATDY
  82 GSEALHSN.VALGR.IVQAGL....Q....A.A.....G.L.PTAAVQVIdt7aaVGKLVTMTEH
  83 SSSAYSSN.TVLTD.VIRQAL....A....S.T.....R.V.PVDAVQMVpg7esVKHLMRARGL
  84 GSEARHSN.AAIAA.CVRAGL....K....R.A.....G.L.PGEAVQVVet7aaVGELIRMDEY
  85 GSDALNSN.KAIVS.AIREAL....K....E.T.....E.I.PESSVEFIen7slVLEXIRLREY
  86 GSEALHSN.AVIAS.AMADGL....A....A.A.....G.L.DAAAVQLVqt7aaVGALLALEGL
  87 GSEAFESN.QAIAK.CILEGL....K....N.V.....G.M.SEYSVQVLet7aaVGELITMTEY
  88 GSEALRCN.QAVAA.CVREGL....E....A.A.....G.L.PAAVVQVVet7aaVGELITMKDY
  89 GSEAIHSN.LAIAR.ILGEEM....E....R.A.....G.I.PKAALSVIpf7egVLEMLKQEEF
  90 GKEASHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
  91 GKDALHSN.KALVK.LIRQSL....E....K.S.....G.I.TPDAVQLVed7avAEELMQATDY
  92 GKEAINSN.KALVN.LIKEAC....R....E.T.....G.F.PEDAVQFIdr7eiVWEILKMEGK
  93 GKEAINSN.KALVN.LIKEAC....R....E.T.....G.F.PEDAVQFIdr7eiVWEILKMEGK
  94 GKDALHSN.KALVK.LIRQSL....E....K.S.....G.I.TPDAVQLVed7avAEELMQATDY
  95 GKDALYSN.KALVK.LIRQSL....E....E.S.....G.I.TPDAVQLVed7avAEELMQATDY
  96 GSEALHSN.TALMA.LVVRAL....A....E.A.....G.L.PGDAVQLVpt7aaVGRLIAMPQY
  97 GSEAFHSN.RAIAA.ALAQGM....E....K.G.....R.V.PSDAVQVVst7aaVSALLKADQY
  98 GSEAIHSN.QAIAD.CIRRGL....A....V.S.....E.L.PREAVQVVei7aaVGELITMDEY
  99 GSEAIRSN.RAIAE.QIRAGL....E....D.A.....G.L.PGDGVQVVgt7daVGALIQMPES
 100 GKDALHSN.KALVK.LIRQSL....E....K.S.....G.I.TPDAVQLVed7avAEELMQATDY
 101 GSEALESN.TALAK.LIGEGL....A....E.A.....G.L.PQDTVQVVet7aaVGRLITMTEY
 102 GSEAYNCN.QAIAA.CVKEGL....K....I.S.....G.L.PETVIQVInt7daVGELITMKEF
 103 GKDALYSN.KALVK.LIRQSL....E....E.S.....G.I.TPDAVQLVed7avAEELMQATDY
 104 GKEAIHSN.IALYK.ILTAAL....E....K.A.....G.L.DKNGIQLVei7eaIDYLLTSDKY
 105 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 106 GSEAIESN.TALAA.LVAEGL....A....S.A.....G.L.PPEAVQVVet7aaVGRLITMTEY
 107 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 108 GKETIHSN.TILAK.LIRQAV....E....Q.A.....G.L.PKEAVQFIen7nlVNHLLKLSDQ
 109 GSEAINSN.KAVAE.CIQQGL....K....L.A.....G.L.PENAVQVVet7eaVGQMITMPEY
 110 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 111 GKEATHSN.RILHL.LAQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKM
 112 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 113 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 114 GKEASHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 115 SSSALNSN.RALVS.AIKKGL....A....K.T.....A.I.PEDTVQFVds7gaVDEMLRLNGL
 116 GKEASHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 117 GKEALQTN.IKITK.VIRQAL....E....Q.E.....G.I.NPDAVQVIte7elANEFMQLTDY
 118 GSEALESN.TALAK.LIGEGL....A....A.A.....G.L.PQDAVQVVgt7aaVGKLITMTEY
 119 GKETLESN.KLISD.VIRGAI....V....A.Q.....G.L.PIDAVQFIds7alVTGLLKLDKY
 120 GKEASHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 121 GSEAIESN.QALAA.CIKQGL....A....K.A.....D.L.PETVVQVIet7aaVGELITMTET
 122 GKETHHTN.QATVK.VIQQAL....E....Q.C.....G.L.PAAAVQAIes7elVNQLLRMDRY
 123 GKEASHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 124 GSEAIESN.GALAA.LIEEGL....A....D.A.....G.L.PANAVQVVat7aaVGKLITMTEY
 125 GKETLESN.KLISD.VIRSAI....V....A.Q.....G.L.PIDAVQFIds7alVTGLLKLDQY
 126 GKETLESN.KLISE.VIRGAI....A....S.Q.....G.L.PVDAVQLIds7alVTGLLKLDQY
 127 GSEAYESN.QAIAK.YILSGL....K....Q.A.....G.L.PEHGVQVLqt7aaVGELITLTEY
 128 GKDAIFSN.TALVN.CMRQTL....Q....D.T.....G.H.NPDIVQLVed7vvAEELMQATDY
 129 GSEAIQSN.QAIAI.CVREGL....R....S.A.....G.L.PEQTMQVVet7aaVSALITMSEY
 130 GSEALESN.TALAK.LIGEGL....A....A.A.....G.L.SQDAVQVVgt7aaVGKLITMTEY
 131 GKETHHTN.QATVK.VIQQAL....E....Q.C.....G.L.PAAAVQAIes7elVNQLLRMDNY
 132 GSEAIESN.TALAA.LVAEGL....A....A.A.....G.L.PSEAVQVIet7aaVGRLITMTEY
 133 GKETHHTN.QATVK.VIQQAL....E....Q.C.....G.L.PAAAVQAIes7elVNELLRMDRY
 134 GRDAINSN.KALVT.VARKAL....K....N.A.....G.I.TADAVQFVed7evAEELMVATKY
 135 GKETLESN.KLISE.VIRGAI....A....S.Q.....G.L.PVDAVQLIds7alVTGLLKLDQY
 136 GSEALESN.TALAK.LIGEGL....A....A.A.....G.L.SQDAVQVVgt7aaVGKLITMTEY
 137 GKETIHSN.TILAK.LIRQAV....E....Q.A.....G.L.PKEAVQFIen7nlVNHLLKLSDQ
 138 GKETHHTN.QATVK.VIQQAL....E....Q.C.....G.L.PAAAVQAIes7elVNELLRMDRY
 139 GKDAIFSN.TALVN.CMRQTL....Q....D.T.....G.H.NPDIVQLVed7vvAEELMQATDY
 140 GRDAINSN.KALVT.VARKAL....K....N.A.....G.I.TADAVQFVed7evAEELMVATKY
 141 GRDAINSN.KALVT.VARKAL....K....N.A.....G.I.TADAVQFVed7evAEELMVATKY
 142 GKETLESN.KLISE.VIRGAI....A....S.Q.....G.L.PVDAVQLIds7alVTGLLKLDQY
 143 GREAIESS.KAIAD.ALHEAL....E....Q.S.....G.L.PKDVITVVpt7evMTELLQQKDY
 144 GKETIHSN.TILAR.LIRQAV....E....E.A.....G.L.PQEAVQFIen7slVNHLLKLSDQ
 145 GSDAIDSN.KALMS.VIQDSL....E....A.S.....G.F.PRSSVQLIed7etARDMMRLNRF
 146 GKETYRTN.AATVK.VIQQAL....T....D.C.....G.L.PACAVQAIed7alVNALLRLDRY
 147 GKETYRTN.AATVK.VIQQAL....S....Q.C.....D.L.PAAAVQAIes7elVNQLLKLDRY
 148 GKETQYSN.KILVD.VVQHAL....V....Q.A.....G.L.PKYAIQAItd7hlVMELLKLDRY
 149 GKETLASN.KLISD.VIRGAI....V....A.Q.....G.L.PIDAVQFIds7alVTGLLKLDQY
 150 GSEAIRSN.RAIAA.LVHEGL....K....A.A.....G.L.PAESVQVIdt7aaVGELITMREF
 151 GSDAIDSN.KALMS.VIQDSL....A....A.S.....G.F.PRSSVQLIed7etARDMMRLNRF
 152 GSDAIDSN.KALMS.VIQDSL....E....A.S.....G.F.PRSSVQLIed7etARDMMRLNRF
 153 GSEAFESN.QAIAK.CILEGL....K....K.V.....G.M.SEYSVQVLet7aaVGELITMTDY
 154 GKETHHTN.QATVN.VIQRAL....E....Q.C.....G.L.PAAAVQAIes7qlVNELLRLDRY
 155 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 156 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 157 GSEAIESN.GALAA.LIEEGL....A....D.A.....G.L.PATAVQVVat7aaVGKLITMTEY
 158 GSEAFESN.QAIAK.CILEGL....K....K.V.....G.M.SEYSVQVLet7aaVGELITMTDY
 159 GKEAAHSS.RAIVE.VMQETA....L....D.F.....D.I.PSSAVQLVnt7aaVGHFLKLNQY
 160 SSSAIHSN.KAIVA.VIHRAL....K....Q.T.....S.L.PQESVQLIed7dsAKQLFTMNDY
 161 GKEAAHSS.RAIIE.VLHEVG....R....R.V.....G.I.PDDAVQLVgt7aaVGHFLKQSDN
 162 GSESFHSS.GAIHG.CLVEGL....V....S.A.....G.L.PQEAIQLVpt7aaVAELLTMTDY
 163 GSDSFHTS.RRLVE.CVRAGL....K....E.A.....G.L.PEGAVFMVpt8avGHLLSGLEGN
 164 SASAYESN.TALVR.VLRDAV....G....G.A.....G.L.PADAVQLVpg7dsVRELMRARGL
 165 SSSAIHSN.KAIVA.VIHRAL....K....Q.T.....S.L.PEESVQLIed7dsAKQLFTMNDY
 166 GKETHYTN.QATVN.VIQRAL....E....Q.C.....G.L.PAAAVQAIes7qlVNELLRLDRY
 167 GREAIESS.KAIAE.ALHEAL....E....A.S.....N.L.PKDVITVVpt7elMTELLQQKDY
 168 GSESFHSS.GAIHA.CLVAGL....R....A.A.....G.L.PEDAIQLVpt7aaVSELLTMTDY
 169 GKEALHSN.LALAT.VLQDAL....A....A.K.....E.L.PRDAVQLItd7avATQMMHLNGY
 170 SSSAIHSN.KAIVA.VIHRAL....K....Q.T.....S.L.PQESVQLIed7dsAKQLFTMNDY
 171 GSESFHSS.GAIHA.CLVEGL....K....A.A.....G.L.PEDAIQRVpt7eaVRELLTMTDY
 172 GSEAHNSN.LALAK.VLQACL....A....A.E.....Q.L.DPAAIQVIpv7aaITAMLACEEE
 173 GSEAIESN.KALAS.LVQQAL....L....D.A.....G.L.PADAVQLVpt7eaVGLLIAMPQY
 174 GSDAIYSN.MVLVE.IIKENL....L....S.A.....K.I.TDGVVELLsd7aeAEKMMQADKF
 175 GKEALHSN.QALVQ.VLRGAL....R....A.E.....A.V.DENAIQLItd7atAAKFMQLTDY
 176 GSEALESN.AALAK.LIGEGL....A....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
 177 GSEAIESN.KALAA.LVRQAL....E....Q.A.....G.L.PADAVQLVgt7eaVGQLIAMPQY
 178 GSEAIHSN.LALAS.ILRRAL....E....E.A.....E.V.NPDSVQVIpm7eaITIMLGLEDS
 179 GSEALESN.AALAK.LIGEGL....E....A.A.....G.L.PQDAVQVVat7aaVGKLITMTEY
 180 GKDAIFSN.TALVN.CMRQTL....Q....D.T.....G.H.NPDIVQLVed7vvAEELMQATDY
 181 GKETQHSN.KILVE.VIQNAL....Q....Q.A.....G.L.PEMAVQAItd7alVMELLHLDKY
 182 GSDSLNSS.AAIHA.CLVEGL....K....A.A.....G.L.PEDAIQLVpt8avGEMLKGLGGA
 183 GKETLESN.KLISE.VIRGAI....A....S.Q.....G.L.PVDAVQLIds7alVTGLLKLDQY
 184 GKETQFSN.KILIE.VVQNAL....E....Q.A.....G.L.PKFAVQAItd7elVMQLLKLDRY
 185 GKETQFSN.KILIE.VVQNAL....E....Q.A.....G.L.PKFAVQAItd7elVMQLLKLDRY
 186 GHAAEHTN.AATLA.VIADVL....T....K.H.....G.Y.DHNMIATVdq7dgATAMMEARGH
 187 GKEAENSN.QAISS.VLKAAA....Y....E.Q.....G.I.PEGCIEQLpg6avVEALIRLNPY
 188 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 189 SSTSIFSN.RALVH.AIKEGL....K....N.S.....D.V.SEAVISLIdd7glVKEMLTLNEY
 190 GSDSIASS.GAIHR.AFVSGL....K....S.A.....G.L.PEDAVQFVav8avGLMLAGLDNN
 191 GSNAFHSN.QAVAA.ALHTAL....E....A.E.....G.V.PPAAVTLIpt7aaVQEMLTLNQH
 192 SSSAIHSN.KAIIA.VIHRAL....K....Q.T.....S.L.PQESVQLIed7dsAKQLFTMNDY
 193 GSEAIESN.KILSK.VIAGAA....E....S.Q.....G.M.PTACIQLLen7qwVQQLMKMNGY
 194 GSESLHSA.QAIHG.CLAAGL....R....A.A.....D.L.PEDAVQLVpt7aaVQELLTMTAY
 195 GSSAIHSN.TAIVS.VMHQAL....D....S.T.....N.I.PRDAVQFIes7saTKQLFKMKEH
 196 GRDAICSN.TALVN.VIRRTL....A....S.F.....G.L.DENAVQLVed7evAKELMAAVDY
 197 GSESFHSS.QAILT.ALKGGF....T....A.C.....G.L.PADAVQMVpt7aaVGVMLRLSNY
 198 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 199 GKETQFSN.KILIE.VVQNAL....E....Q.A.....G.L.PKFAVQAItd7elVMQLLKLDRY
 200 SSSAINSN.KAIVS.VIHRAL....K....Q.T.....S.L.PPESVQLIed7dsAKQLFTLNEY
 201 GKEAIQTN.TALVK.ILRESL....Q....S.Q.....H.L.PVDAVQLItd7aiADEMMNLTDY
 202 GSDSAHSS.AAIHK.ALVKGL....E....A.A.....N.L.PADAIQIVpv8avGEMLKGLGGA
 203 GSESFHSS.QAILR.ALKGGF....T....A.C.....G.L.PADAVQMVpt7eaVGVMLRLSDY
 204 GSESFHTS.TAIHA.CLQDGL....R....S.A.....G.L.PEDAIQLVpt7aaVAEMLRMVEF
 205 GKETQFSN.KILIE.VVQNAL....E....Q.A.....G.L.PKFAVQAItd7elVMQLLKLDRY
 206 GSDSAHSS.AAIHK.ALVKGL....E....A.A.....N.L.PADAIQIVpv8avGEMLKGLGGA
 207 GSESFHSS.GALAD.CLQEGL....R....T.A.....G.L.PEDAVQRVpt7aaVSEMLAMTET
 208 GKETLNSN.ILLVK.LIQTAL....V....E.V.....G.I.NAQAVQLIad7alIYQLLKLDKY
 209 SASAVRSN.TALVA.VLRGAA....V....A.S.....G.L.PADAVQLVpg7daVKHLMRLRGL
 210 GSDSAHSS.AAIYK.ALVKGL....E....A.A.....N.L.PADAIQIVpv8avGEMLKGLGGA
 211 GSESFHSS.GAIHA.ALQDGL....R....Q.A.....G.L.PVDAIQRVpt7aaVAEMLRMVEH
 212 SSSAINSN.KALVR.VIREAL....E....R.S.....A.L.PEDAVQLIed7etAKQLFTLNDG
 213 GSDSAHSS.AAIYK.ALVKGL....E....A.A.....N.L.PADAIQIVpv8avGEMLKGLGGA
 214 GSAAESTN.KALVA.VMRDAL....E....V.Q.....G.L.PADAIGLLdg6daVRALLTARGQ
 215 GSESLNSS.AAIHR.ALVTGL....K....Q.A.....G.L.PETAIQMVpt7eaVAAMLRAQDY
 216 GKEAWHSN.RALVG.LMQAAL....Q....E.A.....G.L.PREAIQLVpt7saILEMCHLADL
 217 GSESFHSS.GAIHA.ALQDGL....R....Q.A.....G.L.PVDAIQRVpt7aaVAEMLRMVEH
 218 GKETCRTN.AATVA.VIQDAL....K....S.C.....G.L.PAGAVQAIdn7alVSEMLRMDKY
 219 GSESFHSS.RAIHA.ALQQGL....E....A.A.....D.L.PADSIQLVpt7aaVSEMLTMTDT
 220 SSSATRSN.QALVQ.VLRASL....V....S.E.....D.L.PADAVQLLsa7atVTHLIQARGL
 221 GKETKFTN.AVLVE.VVQQAL....E....T.A.....G.L.PKLAVQAVtd7alLLELLKLDRY
 222 GSEAIHSN.LALAA.LITEAL....S....S.V.....G.L.PAEAVQVVst7avIAELCKLEEH
 223 GKETFFSN.MELVK.VIQSAL....A....K.A.....G.L.PAASVQYIek7elVTQLLKLDDY
 224 GSESFNSS.RAIHR.CLAAGL....R....A.A.....G.L.PEDAIQSVpt7aaVGMLLTMTDF
 225 GKEAIQTN.TALVK.ILRESL....Q....S.Q.....H.L.PVDAVQLItd7aiADEMMNLTDY
 226 GSESFHSS.RAIHA.ALQQGL....E....A.A.....D.L.PADSIQLVpt7aaVSEMLTMTDT
 227 GSDSFHSS.RAIHA.CLTEGL....K....V.A.....G.L.PEDAIQMVpv8avGAMLTGLNGA
 228 GSEAIESN.KILSK.VIAGAA....E....S.Q.....G.M.PTACIQLLen7qwVQQLMKMNGY
 229 GKETFFSN.MELVK.VIQSAL....A....K.A.....G.L.PAASVQYIek7elVTQLLKLDDY
 230 GKEAVRSC.EAIVK.AIKQGL....S....H.T.....A.V.NPDTVQLLttreeTLELLKLDKY
 231 GKEAVRSC.EAIVK.AVKQGL....S....T.T.....D.V.NPDVVQLLttreeTLELLRLDKY
 232 GKEAANTN.QILYR.LTQEAL....S....L.H.....G.V.RDAVQLVNtree.VEDLCRLNKL
 233 GSESFHSS.QVIHS.CLTEGL....R....G.A.....N.L.PEDAVQLVpt7aaVQELLTMTDY
 234 GKETFFSN.MELVK.VIQSAL....A....K.A.....N.L.PAASVQYIek7elVSQLLKLDDY
 235 SSSAYRSN.TALVR.VVRDAV....G....G.A.....G.L.PADAVQLVpg7esVRELMRARGL
 236 GSDAIDSN.KALMS.VIQDSL....E....A.S.....G.F.PRSSVQLIed7etARDMMRLNRF
 237 GKEAVRSC.EAIVK.AVKQGL....S....T.T.....D.V.NPDVVQLLttreeTLELLRLDKY
 238 GREATRSC.QVLTE.VIQTAL....A....K.T.....V.V.SPEAINLLttreeIRELLGLNQY
 239 GSEAIESN.KALAR.LVQQAL....T....E.S.....G.L.PAEAVQLVqt7avVGQLITMPQY
 240 GSDAIDSN.KALMS.VIQDSL....E....A.S.....G.F.PRSSVQLIed7etARDMMRLNRF
 241 SSSAIHSN.KALVS.VMKRAL....G....L.S.....K.L.PIDAVQLIed7etAKQLFTLNDG
 242 GRETFHSN.VELVK.VIQVAL....K....K.A.....D.L.PAASVQYIek7elVSQLLRLDQY
 243 GSDSAASS.AAIHS.CLVEGL....R....K.A.....G.L.PEDAIQRVpv8avGEMLRGLGGN
 244 GSESLNST.RVIVE.CLAKGL....E....A.A.....D.L.PLDCIQMIdt7daVQALLTCADY
 245 GSEAIHSN.KALYQ.TMREGL....A....K.A.....G.L.PEEAIQLVpt7alVGAMLTASGL
 246 GSEAFHSN.RCLAD.ILRRSL....V....E.T.....G.L.PEDAVQLVgt7eaVLDLLKLEEC
 247 GKEAVRSC.EAIVK.AVKQGL....S....T.T.....D.V.NPEVVQLLttreeTLELLRLDKY
 248 GKEATNSC.LELVT.AIRQGL....S....T.T.....S.V.NPDGVQLLttreeTLELLKLDEY
 249 GKEALNSS.KAIAE.VLQAVL....R....S.F.....E.L.PEALITVVpt7alLMDLMQQRDH
 250 GSEAIRSN.IAIAT.ALQRAL....R....L.A.....S.L.PETALILVqd7htMLELLQLSDL
 251 GKEALNSC.KTLVK.IIREAL....S....K.T.....K.V.SPDTVQLLttreeIRNLLELDEY
 252 GKETLTSN.KMLSD.IIRDAL....V....S.L.....D.L.PKDAVQLIds7slVSGLLRLDKY
 253 GKEASNTN.QILYR.LTQEAL....S....L.H.....G.V.RDTVQLVNtree.VEDLCRLNKL
 254 GKETRHSN.RILVE.VVQNAL....E....K.A.....G.L.PKTAVQAItd7alVMELLKLDRY
 255 STSALHSN.KALVA.VMKEAL....R....T.T.....A.I.PETAIELLed7etAQRMFRLNNY
 256 GSEAIRSN.IAIAT.ALQRAL....R....L.A.....S.L.PETALILVqd7htMLELLQLSDL
 257 GKEALHTS.KIIAT.ILQSVL....K....Q.Y.....G.L.PEALITVVpd7alMLELMQQRDY
 258 SSSAAKSN.AALVE.ILREAL....R....A.Q.....Q.I.PADAVQLLps7ssVTHLIQARGL
 259 GSEALNSN.RVIFN.ILVEAL....E....DtP.....G.I.PKGAFQLMetreeVMDILALDEY
 260 GSESFRSG.RAIHA.CLVQGL....R....E.A.....G.L.PEAAITLVpt8avGLLLGGLNGT
 261 SSSALHSN.KALVS.VIHRGL....E....A.A.....N.ViPKDAVQLLed7etAKEMFKLNDY
 262 GSDSFRSC.RAIHE.CLVQGL....R....E.A.....G.L.PEAAITLVpt8avGMMLSGLNGA
 263 GSEAIRSN.IAIAT.ALQRAL....R....L.A.....S.L.PETALILVqd7htMLELLQLSDL
 264 GKETFFSN.MELVK.VIQSAL....D....K.A.....G.L.PAASVQYIek7elVTQLLKMDDY
 265 GRETFHSN.VELVK.VIQVAL....K....K.A.....E.L.PAASVQYIdk7elVSQLLRLDQY
 266 GKETFFSN.MELVK.VIQSAL....D....K.A.....G.L.PAASVQYIek7elVTQLLKMDDY
 267 GKETFFSN.MELVK.VIQSAL....D....K.A.....G.L.PAASVQYIek7elVTQLLKMDDY
 268 GKEALHSS.KIIAS.ILQNVL....Q....A.Y.....Q.L.PPALITVIpd7alLLELMQQRDF
 269 SSSAIHSN.KAIVA.VIHRAL....K....Q.T.....S.L.PQESVQLIed7dsAKQLFTMNDY
 270 GSDSFRSC.RAIHE.CLVQGL....R....E.A.....G.L.PEAAITLVpt8avGLLLSGLDGG
 271 SSSAIHSN.KAIVA.VIHRAL....K....Q.T.....S.L.PQESVQLIed7dsAKQLFTMNDY
 272 SSSAAKSN.EALVA.VLRTAL....V....G.L.....E.L.PADAVQLLsa7atVTHLIQARGL
 273 GSDSQHSS.RAIHA.CLVQGL....R....I.A.....G.L.PENAIQLVpv8avGALLSGLKGT
 274 GSDSQHSS.RAIHA.CLVQGL....R....I.A.....G.L.PENAIQLVpv8avGALLSGLKGT
 275 GSESFHSS.GAIHA.CLVQGL....R....E.A.....G.L.PETAIQLVpt7eaVSLMLRDSAN
 276 GKEAARSN.AALGE.AMAAGL....Q....E.V.....G.L.PVELAQVLps6eaAQELMAARSL
 277 GKEALHSN.LALAA.CISYAL....E....K.H.....E.I.DPAAVVVVpn7avMNELMTLNED
 278 GRETFHSN.MALVK.VIQVAL....E....K.A.....G.L.PAASVQYIeq7elVSQLLKLDQY
 279 GKEALQSS.LVIAK.VLQAVL....Q....Q.H.....K.L.PKALITVIpd7glMMELMQQRAY
 280 GSEANLTN.LAIVS.ALKEGL....Q....D.S.....N.L.DENAICLLtsrkdSMAMLNLEKY
 281 GSESFHSS.AAIHQ.CLVTGL....K....Q.A.....N.L.PESAIQLVpt7aaVSEMLTMTDH
 282 GREAICSC.QAIVA.AIAQAL....A....E.Q.....Q.A.PVEAIRLLtsreeTLALLKLDRY
 283 GSEAFHSN.MMLAS.LIHRAL....I....L.A.....G.L.PQDAVQVVps7gaIKALCELEEY
 284 GKEAVRSN.ECLVK.I---AG....A....T.P.....G.M.PDGAIQLLda7esVQQLMKARGL
 285 GSESFRSC.RAIHA.CLVEGL....R....E.A.....R.L.PEAAITLVpt8avGLLLSGMNGG
 286 GKETFFSN.MELVK.VIQSAL....A....K.A.....N.L.PAASVQYIek7elVSQLLKLDDY
 287 GSESFRSC.RAIHA.CLVEGL....R....E.A.....R.L.PEAAITLVpt8avGLLLSGMNGG
 288 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 289 GKEALHTS.KVIAS.VLQKVL....K....Q.Y.....G.L.PASLIAVVpd7alLMELMQQRDT
 290 GKETLESN.LALAA.AIRRAL....A....G.E.....G.L.PEDCVQLIdn7alVTGLLKLDKF
 291 SSSAAKSN.QALVE.VLHAAL....V....S.E.....D.L.PADAVQLLsa7stVTHLIQARGL
 292 GSEAKESN.RAIHA.AMLEGI....V....A.A.....G.L.PAEVVQLVpt7aaVGALLKAAEF
 293 GKETLASN.LALSE.AIREAI....S....E.Q.....G.L.PSDAVQLIqd7alVSGLLKLDKY
 294 SSSAIESN.KALIQ.VIHQSL....A....S.S.....S.I.PKEAVQLIed7evANQFFQLNEY
 295 GSDSFHSA.HALHS.ALVKGL....K....E.A.....G.L.PQDAIQMVgt8vvGEMLKGLDGA
 296 GKEAKRSN.EAIAS.VMQAVL....K....A.N.....N.L.PIEAISLLpd7egVAKLVKMDQY
 297 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 298 GSDSRRSS.QAIHV.CMVEGL....K....A.A.....G.L.PEHAIQLVpv8avGAMLRGLEGA
 299 GSESFHSS.GAIHA.CLVAGL....R....A.A.....G.L.PEDAIQLVpt7aaVEAMLTMTDT
 300 GSEAIHSN.IAIAR.ALQRAL....R....E.A.....N.V.PEAALTLVed7etMLELLQLNDI
 301 GSEAIHSN.TAIAR.ALQRAL....R....E.A.....N.V.PEAALTLVed7etMLELLQLNDI
 302 GRETFHSN.MALVK.VIQVAL....E....K.A.....G.L.PAASVQYIeq7elVSQLLKLDQF
 303 GKETFFSN.MELVK.VIQSAL....A....K.A.....N.L.PAASVQYIek7elVSQLLKLDDY
 304 GSEAIHSN.TAIAR.ALQRAL....R....E.A.....N.V.PEAALTLVed7etMLELLQLNDI
 305 GSEAIHSN.TAIAR.ALQGAL....R....E.A.....N.V.PEAALTLVed7etMLELLQLNDI
 306 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 307 GSEAIRSN.IAIAT.ALQRAL....R....L.A.....S.L.PETALILVqd7htMLELLQLSDL
 308 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 309 GSDSVRSS.AAIHA.TMIAGL....T....L.A.....G.L.PEDAIQIVps8avGAMLRGLDGA
 310 GSEARESN.RTIFE.ILVKAI....E....S.Te....G.M.PKGAFQLMetreeIMSLLSLDAY
 311 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 312 GSEALLSC.QALMA.AIQAGL....Q....QiP.....E.F.PQGSLQLLtsraeVKALLQLEGL
 313 GSAAQNTN.TEIVS.VLRKAV....E....S.A.....G.L.PADSINGIdq7dgATVLMNARDY
 314 GSESFRSC.RAIHD.RLVQGL....R....E.A.....G.L.PDAAITLVpt8avGLLLAGLDGS
 315 GSEAIRSN.IAIAT.ALQRAL....R....L.A.....S.L.PETALILVqd7htMLELLQLSDL
 316 SSSAIHSN.KALVS.VIYRAL....E....Q.S.....A.L.PIHAVQLIed7etAKELFTLNDG
 317 GSEAKLTN.EAIVK.AIDHGL....G....N.S.....S.I.NSDAICLLttrreSLSLLRLDGM
 318 SSSAEASN.AALVE.VLRDAV....A....A.S.....G.L.PADAVQLVpg7daAKHLMRARGL
 319 SSSAAHSN.AALVD.SLRAAL....V....A.E.....G.L.DANAVQLLps7asVTHLIQARGL
 320 GSEASHTN.QAIIE.ALKNGL....A....E.T.....E.I.DPEAIALLktrqeSLALLRLDGL
 321 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.K.TFVFVSTRee...VEDLCRLEKM
 322 GQEASRSC.QTIMQ.TIHRGL....E....K.S.....A.V.PAGAIALLtqrseISELLQLDQW
 323 GSEARESN.RTIFD.ILVRAI....E....S.T.....GgM.PEGAFQLMetreeIMSLLSLDAY
 324 GSAAENSN.RILVE.IIQSAL....H....S.V.....G.V.EPAAVQTIde7dgAKALMQARGY
 325 SASALNSN.RVLVD.VLREAA....V....A.A.....G.L.PADGVQLVpg7dsVKHLMRLRGL
 326 GSEAIHSN.TAIAR.ALQRAL....R....E.A.....N.V.PDAALTLVed7etMLELLQLNDI
 327 GSDAIYSN.MVLVE.IIKENL....L....S.A.....K.I.TDGAVELLsd7aeAEKMMQADKF
 328 GSEAIHSN.TAIAR.ALQRAL....R....E.A.....G.V.PEAALTLVed7etMLELLQLSDI
 329 GKEALHTS.QVIAS.ILQAVL....T....A.Y.....G.L.PKALISVIpd7alMLELMQQREF
 330 GKEAFRSN.RALVA.LWHEAL....G....E.A.....G.L.PEEAVTLVpt6reAVLEMCRLEL
 331 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 332 GKETFFSN.MELVK.VIQSAL....E....K.A.....E.L.PAASVQYIek7elVSQLLKLDDY
 333 GKETFFSN.MELVK.VIQSAL....E....K.A.....E.L.PAASVQYIek7elVSQLLKLDDY
 334 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAVQLVNtree.VEDLCRLDKM
 335 SSSAARSN.AALVN.ALRAAL....A....T.E.....G.L.DTDAVQLLps7asVTHLIQARGL
 336 GKEAQNSN.EAIAK.VLQATL....E....K.N.....S.L.PKSLISLVpd7egVAKLIKMDKY
 337 GKEALHTS.QVIAS.ILQAVL....T....A.Y.....G.L.PKALISVIpd7alMLELMQQREF
 338 GSDSFHSA.YALHS.ALAMGL....E....K.A.....G.L.PTDAIQMVet8avGEMLKGLDGT
 339 GSEANLTN.TAIVK.ALKKGL....Y....E.S.....G.L.DKNAICLLtsrkdSMSMLNLEKY
 340 GKEAANTN.RILHE.LAQEAL....S....I.H.....G.V.KDAIQLVStree.VEDLCRLEKM
 341 GSESFRSC.RAIHE.CLVQGL....R....E.A.....Q.L.PEAAIALVpt8avGLLLSGLNGG
 342 GSEAKDTN.QAIMD.SLDKGL....R....K.A.....N.V.GSGALSLLttrqeSLGLLRLDKF
 343 GSDSFRSC.RAIHE.CLVEGL....R....E.A.....G.L.PDAAITLVpt8avGLLLSGLNGG
 344 GSECIHSN.LAIHA.AIARGL....Q....K.A.....G.L.PTAAVQAVkt8avGMILAGLDRT
 345 GSESFRSG.RAIHD.CLVQGL....R....E.A.....G.L.PEAAITLVpt8avGLLLGGLNGS
 346 SASALHSN.KAIVH.TLKKAF....Q....N.S.....P.I.HPDVIQLLed7eeAANMMQLKST
 347 GSEAVHSN.RALHA.AFAAGL....V....E.A.....G.L.PADAVQLVpt7aaVGAMLRAQGL
 348 GKEAFRSN.RALVA.LWHEAL....E....E.A.....G.L.PEEAVTLVpt6reAVLEMCRLEL
 349 GSEAIHSN.TAIAR.ALQGAL....R....E.A.....N.V.PEAALTLVed7etMLELLQLSDI
 350 GKEAMRSN.AILHK.VITNAI....-....P.D.....N.V.GEKLIGLIttrdeIADLLKHDDV
 351 GSEGLCSC.QALMA.AIQAGL....Q....QiP.....E.F.PQGSLQLLtsraeVKALLQLEGL
 352 GHAAERTN.AATLG.VIAPVL....E....A.H.....G.F.ESALVQSVdq7agATAMMEARGH
 353 GKEAMRSN.AILHK.VITNAI....-....P.D.....N.V.GEKLIGLIttrdeIADLLKHDDV
 354 GHAAERTN.AATLG.VIAPVL....E....A.H.....G.F.ESALVQSVdq7agATAMMEARGH
 355 SSSAARSN.AALVD.ALRAAL....A....T.E.....L.L.DVDAVQLLps7asVTHLIQARGL
 356 GKEALHTS.QVIAS.ILQAVL....T....A.Y.....G.L.PKALISVIpd7alMLELMQQREF
 357 GSEANRTN.RAVIE.ALQEGL....G....A.A.....E.V.DTTIAADAla9qeSLALLRLDGL
 358 GKEAANTN.HVLHQ.ITQEAL....S....V.H.....G.V.KDAVQLVStree.VEDLCRLDKL
 359 GKEAKRSN.AILHK.VITSAI....-....P.D.....K.V.GEKLIGLVtsrdeIPDLLKLDDV
 360 GHAAERTN.AATLG.VIAPVL....E....A.H.....G.F.ESALVQSVdq7agATAMMEARGH
 361 GSDSFRSC.RAIHD.CLVEGL....R....E.A.....G.L.PEAAITRVpv8avGLLLGGLDGN
 362 GKEALHTS.KVIAT.ILQNVL....A....Q.Y.....G.L.PKALISMVpd7alMLELMQQREF
 363 GSDSFRSC.RAIHD.CLVEGL....R....E.A.....G.L.PEAAITRVpv8avGLLLGGLDGN
 364 GSDSFHSA.HALHC.ALVKGL....K....K.A.....G.F.PKDAIQMVat8avGEMLKGLDGA
 365 GKEARRSN.AILHK.VITDAI....-....P.K.....T.V.GGKLIGLVtsrdeIPDLLKLDDV
 366 GKEANRSN.AILHK.VITEAI....-....P.D.....T.V.GSKLIGLVtsraeIPELLKLDDV
 367 GKDAFQSA.RAIVA.ALKTGL....A....Q.T.....R.I.DPEAVQLIed7egSYEMMRAKDY
 368 GKEAKRSN.AILHK.VITSAI....-....P.V.....S.V.GERLIGLVtsreeIPELLKLDDV
 369 GKEAIRSN.TILHK.VITDAI....-....P.R.....N.V.GEKLIGLVttrdeIADLLKLDDV
 370 GKEAIRSN.TILHK.VITDAI....-....P.R.....N.V.GEKLIGLVttrdeIADLLKLDDV
 371 GKEALHTS.KVIAT.ILQNVL....A....Q.Y.....G.L.PKALISMVpd7alMLELMQQREF
 372 GSEARCTN.EAVME.ALKAGL....A....S.S.....A.I.SPDALALLttrqdSLALLKLDGL
 373 GKEAMRSN.TILHK.VITGAI....-....P.D.....V.V.GKKLIGLVknkdeIADLLKLDDV
 374 GKEAFHSA.QAIVT.ALKAGL....E....E.V.....G.L.SPKVIELVqd7asATELMTAKGK
 375 GKEALKSS.QAIAS.VMHSVL....A....K.H.....N.L.PEALISVIpd7glLMELMQQRDS
 376 GSDSFRSC.RAIHD.CLVQGL....R....E.A.....D.L.PEAAITLVpv8avGLMLSGLNGN
 377 GGESLHSA.RAIQA.AMEDGL....R....A.A.....G.L.DEACVQILps7alVGAMLQASGK
 378 GSESRHST.REIVA.CMQAGL....K....A.A.....G.L.PENAVQTVqt7naVAELLKADEH
 379 GTAAAATN.EALIR.VLRDAL....A....S.V.....G.L.PADAVQTVdq7egANVLMRARGR
 380 GSEARESN.RTIFQ.ILVKAI....E....S.Td....G.M.PAGAFQLMetreeIMDLLSLDAY
 381 GSEANLTN.TSIVK.ALQEGL....N....E.S.....G.L.DKNAICLLtsrkdSMAMLNLEKF
 382 GKETFFSN.MELVK.VIQVAL....E....K.A.....G.L.PAASVQYIek7elVSQLLTMDDY
 383 GSEARCTN.EAVME.ALKLGL....G....R.S.....A.V.APDALTLLttrqeSLALLRLDGL
 384 GKEAAHSN.RALME.LVKESL....A....A.T.....G.A.SNAISLVStree.ISDLLSMDEH
 385 GSEASLTN.IEIVK.AMKEGL....S....K.S.....D.I.QPESICLLktrqeSLGLLGLDGI
 386 GSAAIATN.GVLVG.VIQEAL....A....A.A.....G.L.PADAVQTIdd7egANGLMQARGF
 387 GSEARCTN.EAVMD.ALQAGL....A....A.S.....P.V.SADALALLttrqeSLALLRLDGL
 388 GREASRSC.TAIFA.ALQEGL....A....E.S.....E.V.DRQALALLttrqeSLGMLRLDGL
 389 SSSARSSN.AAIVA.ALRDAI....A....G.T.....G.L.DPDVVQQVpg7dsVKALMRARGH
 390 GKEAIRSN.TILHK.VITDAI....-....P.R.....N.V.GEKLIGLVttrdeIADLLKLDDV
 391 GSDIARSV.AATTE.VIALAL....E....Q.A.....G.L.PAFAVQSIid7elVRQLLRLDRY
 392 GKEATNSN.KYLME.LVKEAL....G....P.V.....G.A.ANAISLIStred.VGDLLSMGKH
 393 GKEAAYSN.KALME.LVKEAL....G....T.V.....G.A.TKAISLVStree.ISDLLSMDKH
 394 GKEALGSS.KAIAA.ILQDVL....Q....K.H.....S.L.PVELITVVpd7elMMELMQQSDY
 395 GKEAKRSN.AILHK.VITSAI....-....P.E.....N.V.GPRLIGLVtsreeIPDLLKLDDV
 396 GKETSYSN.KILVT.VIQDAL....E....Q.T.....G.L.PKNAVQAItd7nfVLELLKLDKY
 397 GSEAVHSN.RAIHK.ALVAGL....A....E.G.....G.V.PAEAVQLVpt7aaVGAMLGAAGL
 398 GKEAAHSN.RALMD.LVTEAL....V....T.V.....G.A.EHAVSLVStree.ISDLLSMEKH
 399 GKETIHSN.IVLVN.IIQKAL....Q....D.A.....G.L.PKAAVQYIed7awVAKLLKMDQF
 400 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 401 GKETFFSN.MELVK.VIQSAL....D....K.A.....G.L.PAASVQYIek7elMTQLLKMDDY
 402 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 403 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 404 GSEAIHSN.LAIAH.CLHQVL....T....T.H.....N.V.DEHIVCVIpd7svIEQLLQQSDT
 405 GSESFHSS.TAIHK.CLQTGL....Q....Q.A.....G.L.PATAIQLVpt7aaVSAMLTATDH
 406 GSDALRSS.LALAE.AFAEGL....E....K.A.....G.L.PAASAQVVpt7eaTYELLALDDL
 407 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 408 GKEAFHSN.VAILK.ALHSAL....E....Q.H.....S.L.PKECVSMIed7egILEFVKMDKY
 409 GSEAVHSN.RAILA.SLAAGL....A....E.G.....G.V.PAEAVQLVpt7aaVGAMLTASGL
 410 GSEAFYSN.EILIK.LFHEIL....I....K.E.....E.I.DIGSVVFVdk7sfMIPFFQQTSL
 411 SSSALESN.RAVIA.AMRSRL....-....P.E.....E.I.REAVQLVEgghevTDELMTARGY
 412 GSEAFYSN.EILIK.LFHEIL....I....K.E.....E.I.DIGSVVFVdk7sfMIPFFQQTSL
 413 GKETNYSN.KILVK.VIQDAL....E....Q.T.....G.L.PKNAVQAItd7nfVLELLKLDKY
 414 GKDAFQSA.RAIVA.ALKTGL....A....Q.T.....R.I.DPDALQLIed7esSYEMMRAKDY
 415 GKEAKRSN.AILHK.VITEAI....P....D.I.....V.G.SKLIGLVTsrae.IPELLKLDDV
 416 GKDAYQTT.HAIVT.ALKKGL....E....T.T.....T.I.HPNVIQLVed7esSYAMMKAKGY
 417 GKEAIESN.IILTN.ILRNVL....R....K.H.....N.L.NPDIIQLItd7dsVNTLLNLRDY
 418 GKEAAHSN.KALME.LVKEAL....A....T.V.....G.A.EHAVSLVStree.ISDLLSMENH
 419 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 420 GKEAQRSN.AILHK.VITSVI....-....P.N.....T.V.GDKLIGLVnsrdeIPYLLKLDDV
 421 GSAAQSSN.TVLVE.VVRGAL....E....S.V.....G.L.PADAVTSIde7dgVGALLTARGL
 422 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 423 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 424 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 425 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGFV-tsreeIPDLLKLDDV
 426 GKEAKNTN.LAIIK.AIHKAL....Q....K.C.....G.L.DKNCVVYLdi6neVKKLINMDKY
 427 GKESLHSF.TAIAK.AVTKAL....E....K.S.....K.V.PPGAIQLIatrdeVSSLLSQDQY
 428 GKDAYQTT.HAIVT.ALKKGL....E....T.T.....T.I.HPNVIQLVed7esSYAMMKAKGY
 429 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDI
 430 GKEAAHSN.KALME.LVKEAL....G....T.V.....G.A.TNAISLVStree.IGDLLSMEQH
 431 GSEASHSN.RVLYE.IIREAT....-....-.A.....D.L.PDGWAQLIearedVDRLLGMDDS
 432 GKDAFQSA.RAIVA.ALKTGL....A....Q.T.....R.I.DPDALQLIed7esSYEMMRAKDY
 433 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 434 GKESYQTF.KIMSD.IVNTTLd...K....E.T.....D.V.PGPAVQLIqsreeVGDLLLQDKY
 435 GKDAIFSN.TALVN.CMRQTL....Q....D.T.....G.H.NPDIVQLVed7vvAEELMQATDY
 436 GSEARCTN.EAVMD.ALRAGLar..E....E.S.....D.V.SPDALALLttreeSLGLLRLDGL
 437 GSEAKFTN.EAIFT.LVNKVL....K....E.F.....D.L.QDCFAMFTqrde.ILQILAFDDL
 438 GKESYQTF.KIMSE.IINQTLq...I....E.T.....D.V.PRDAIQLIqsredVADLLNQDKY
 439 GKEANRSN.AILHK.VITEAI....-....P.D.....T.V.GSKLIGLVtsraeIPELLKLDDV
 440 SSTAVHSN.TTLVG.ILQDVL....A....T.F.....D.L.PRETVQLLpc7esVQDLITARGL
 441 GSESLNST.RIIVE.AMRHGL....E....A.A.....G.L.PADAVQLVds7aaVGALLGCAEH
 442 GKEAINTN.KAILN.CIENAI....N....Q.VkknyiN.I.NREIVQMVfshedVNKLLSFNQF
 443 GKEAEESN.KALHA.LVQEAL....G....T.H.....G.F.EMRDAVTLvr6edVADLLQLKDL
 444 GKEAEESN.KALHA.LVQEAL....G....T.H.....G.F.EMRDAVTLvr6edVADLLQLKDL
 445 SSTAVHSN.TKLVE.ILQDVL....E....R.F.....E.L.PRETVQLLpc7gsVQDLITARGL
 446 GKEAINTN.KAILN.CIENAI....N....Q.VkknyiN.I.NREIVQMVfshedVNKLLSFNQF
 447 GKEAEESN.KALHA.LVQEAL....G....T.H.....G.F.EMRDAVTLvr6edVADLLQLKDL
 448 GKEASYSN.EVLHS.LVEEAL....E....M.H.....D.A.KDAVALIStreq.VGDLLKMSDD
 449 GKEATNSN.NLLMN.IVKEAL....S....E.Y.....G.C.ADAISMVSkrea.IGDLLKMDQY
 450 SKSAQHSN.AALVA.VVHRVL....E....S.H.....G.L.PHEVVQLLpc7esVQDLITARGL
 451 SKSARHTN.EKLVQ.ILQDVA....E....S.H.....N.L.PRELVQLLpc7dsVQDLITARGL
 452 GKEATNSN.NLLMN.IVKEAL....S....E.Y.....G.C.ADAISMVSkrea.IGDLLKMDQY
 453 GKEATNSN.NLLMN.IVKEAL....S....E.Y.....G.C.ADAISMVSkrea.IGDLLKMDQY
 454 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 455 SSTAVHSN.TKLVE.ILQDVL....E....R.F.....E.L.PRETVQLLpc7gsVQDLITARGL
 456 GTESAKSF.AALSN.VVRSAL....G....K.S.....K.V.PQAAVQLVqsreeVSQLLKLDEY
 457 GKEARRSN.AILHK.VITDAI....P....E.T.....V.G.GKLIGLV-tsreeIPDLLKLDDV
 458 GKESTESF.IAISN.VISAAL....E....K.S.....Q.V.PNGAIQLVttrdvIPQLLALDSH
 459 GSEAKFTN.SAIFD.LVYKVL....E....K.F.....N.L.QDCFAMFYerne.IMQILAFDDL
 460 GKEAIHSN.TVLAT.ILRDVL....I....D.Q.....N.L.NPDIIQLItd7esVNTLLHMREA
 461 GKESVNTF.KAMAK.VVNQTI....EqykdE.T.....G.V.PVGAVQLIetrqdVSDLLGQDEY
 462 GKEAKRSN.AILAK.VITEAI....-....P.D.....S.V.GKKLIGLVtsreeIPNLLKLDDV
 463 GSESYHSN.TAIYL.AMTKGL....R....Q.A.....G.F.PDGTVQIApn7afVAAMLGASGQ
 464 GKEAFRSN.RALVA.LWHEAL....E....E.A.....G.L.PEEAVTLVpt6reAVLEMCRLEL
 465 GSDADHSN.RAIAE.LIHTVL....Q....D.H.....G.I.SPDILYLLps6eaATIMMEAVGK
 466 GKESTESF.IAISK.VISEAI....S....G.T.....R.V.PVASVQLVktrdvVSSLLAQDSL
 467 GKESTESF.VTIAN.VISEAI....S....H.T.....R.V.PQSSIQLVktraaVSDLLAQDSL
 468 GREAEHSN.AAIHS.VIVGAV....T....K.A.....S.E.GKVPSGVIsl8adVYELLKLEGF
 469 GSAASYSN.AALLR.AIHVGL....K....K.A.....H.G.VVDAVAVPpv9gdVDHILRARGF
 470 GSAASYSN.APLLR.AIHVGL....K....K.A.....H.G.VVDAVAVPpv9gdVDHILRARGF
 471 GSDAHESN.TAIVE.CIKTVL....R....R.N.....G.I.NDNTLSLLps6eaAGIMLNAVDS
 472 GSDAAYSN.IAIVN.LIQTVI....R....D.R.....G.L.DPDMIYLLpa6eaAHILLNAVGY
 473 GSEAINTN.KILAK.LFRKSL....K....E.T.....R.V.NENFIQFIds8mvDFMLSKMKDY
 474 GKESTESF.VAISQ.VISDAI....S....S.T.....Q.V.PKSSVQLVktrdvISSLLAQDSL
 475 GSDADDSN.RAIIS.VIHKVL....E....K.F.....H.V.NPHIVELLpa6eaTAALLNATGY
 476 GKETVNSN.AALEG.AIRAAL....A....S.E.....N.I.PEDAVQVIrd7erMLELLRLDDL
 477 GKEAHFTN.SYLLL.LIKNTL....K....N.F.....N.I.NTDIVCLLpp6alMTQLLNATGL
 478 GSDARDSN.IAIVN.LIHEVL....L....D.N.....G.M.NAETIYLLpa6eaAGVMLNAVGS
 479 GSDAMYSN.IAIVE.LIHSVL....K....Q.H.....G.I.NPDTLYLLpa6eaAAVMLNAVGY
 480 GKESTESF.VAISK.VISSAL....E....T.T.....K.V.PNSAIQLVttrdaIAELLAQDRY
 481 GSDADYSN.RAIVE.VIHQVL....R....Q.F.....N.I.DTHMVELLpa6eaTRELLHATGY
 482 GSEAINTN.KILAK.LFRKSL....K....E.T.....R.V.NENFIQFIds8mvDFMLSKMKDY
 483 GKEAHFTN.SYLLL.LIKNTL....K....N.F.....N.I.NTDIVCLLpp6alMTQLLNATGL
 484 GSDAMYSN.IAIVE.LIHSVL....Q....Q.H.....G.I.NPDTLYLLpa6eaAAVMLGAVGY
 485 GKESTESF.VAIST.AISNAL....S....Q.T.....Q.V.PNDAIQLVttresIPQLLALDRD
 486 GKEAHFTN.SYLLL.LIKNTL....K....N.F.....N.I.NTDIVCLLpp6alITPLLNATGL
 487 GKESIESF.REIAR.IVSKAL....L....S.T.....D.V.PNTAIQLVesrdvILPLLAQDKC
 488 GSDAMYSN.MAIVD.LIREVL....V....R.N.....N.V.NPDTLYLLps6eaAGIMLNAVGY
 489 GKETVNSN.AALED.AIHAAL....N....R.E.....G.L.PADAVQVIrd7arMLELLRLDES
 490 GKESVNTF.REMAK.IVNDTIaqfqS....E.T.....G.V.PVGSVQLIetrqdVSDLLDQDEY
 491 GKESIKTN.QVLVS.ILQQSL....K....K.L.....G.Y.SENIVQLIed7dsVKELLHLRKF
 492 GKESVNTF.REXAK.IVNDTIaqfqS....E.T.....G.V.PVGSVQLIetrqdVSDLLDQDEY
 493 GSDAMHSN.IAIVD.LIHTVL....Q....K.H.....G.I.NTDTIYLLpa6eaAAVMLNAVGA
 494 GKESLNTF.KEMSR.IVNDVV....E....Q.N.....E.K.TTHVPVGAvq9edVSDLLQQDEY
 495 GSDADASN.RAIVE.LIHSVL....S....D.H.....N.L.SPDTLYLLps6eaATVMMGAVGK
 496 SSSAIHSN.KALVS.VMKRAL....G....L.S.....K.L.PIDAVQLIed7etAKQLFTLNDG
 497 GKESINTA.TLLSS.LISQAL....A....K.T.....S.I.PPAFVQSVstrseISSLLAQDKY
 498 GREGEHSN.AVLHD.LIVSAV....E....S.Stqg..R.V.PRGVIGLVtnradVYSLLQLDAH
 499 GKESINTA.TLLSS.LISQAL....A....K.T.....S.I.PPAFVQSVstrseISSLLAQDKY
 500 GKETVNTF.RELAA.VINLVLaeseP....E.T.....G.V.PVHAVQLVesrseVSDLLQQDEY
 501 GKEASNTN.KILHQ.LTQEAL....S....L.H.....G.V.ADAIQLVStree.VEDLCRLDKL
 502 SSSAIHSN.KALVS.VIYRAL....E....Q.S.....A.L.PIHTVQLIed7etAKELFTLNDG
 503 SEVSDHMA.DLLST.LIPQYM....-....D.K.....D.L.YPVIKGGV.....PETTELLKEK
 504 SEVSGHMA.DLLAT.LIPQYM....-....D.Q.....N.L.YLVVKGGV.....PETTELLKER
 505 GKESLKSN.LKIVS.LWHKAL....E....E.N.....G.V.SKDWVEYLny7etQTFLEKPTQK
 506 SEVSDHMA.DLLST.LIPQYM....-....D.K.....D.L.YPVIKGGV.....PETTELLKEK
 507 SEVSGHMA.DLLAT.LIPQYM....-....D.Q.....N.L.YLVVKGGV.....PETTELLKER
 508 SEVSDHMA.DLLST.LNPQYM....-....D.K.....D.L.YPVIKGGV.....PETTELLKEK
 509 SELSENTA.KILAK.LLPQYL....-....D.Q.....D.L.YIVINGGV.....EETTELLKQR
 510 SEVSENTA.KLLER.LIPRYL....-....D.K.....E.L.YPIVNGGI.....PETTQLLEQR
 511 SEVSDHMA.DLLST.LNPQYM....-....D.K.....D.L.YPVIKGGV.....PETTELLKEK
 512 SELSENTA.KILAK.LLPQYL....-....D.Q.....D.L.YIVINGGV.....EETTELLKQR
 513 SELSENTA.KILAK.LLPQYL....-....D.Q.....D.L.YIVINGGV.....EETTELLKQR
 514 GREAEHSN.AAIHS.VIVEAV....T....K.A.....S.E.GKVPSGVIsl8adVYELLKLEGF
 515 GKEAYLSN.VVLVD.CWKQAL....R....E.N.....D.L.DESWITMLqm7etQAFLKNPDQP
 516 SEVSENTA.KLLAK.LLPQYL....-....D.Q.....D.L.YAVVTGGV.....EETTELLKQR
 517 SEVSENTA.KLLAK.LLPQYL....-....D.Q.....D.L.YAVVTGGV.....EETTELLKQR
 518 GKEANHSN.IILEK.CWHEAL....E....E.N.....E.L.STDWISLLhl7etREFLSNPPEK
 519 GKESKHTA.AILSS.IISSAL....A....Q.A.....G.L.PKHLIQTVetrsdIQSLLHLDEY
 520 SEVSEHTS.QMIAN.ILPQYL....-....D.P.....E.L.YPVVTGGV.....PETTELLEQR
 521 SSSAIHSN.KAIVS.VIHRAL....K....Q.T.....S.L.PSESVQLIed7dsAKQLFTLNEY
 522 GKEAKRSN.AILHK.VIIEAI....-....P.D.....N.V.GGKLIGLVtsreeIPELLKLDDV
 523 STEASHSN.AAIVE.ALQHAI....V....E.V.....G.L.PSGCIELVtt7gsLRDLITQDQY
 524 GKEAIYSN.KTLVD.FWHKAL....L....E.N.....N.I.SSDYIKLLqm7etQSFLKNPTEQ
 525 STEASHSN.AAIVE.ALQHAI....V....E.V.....G.L.PSGCIELVtt7gsLRDLITQDQY
 526 GKEAMHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 527 SELSENTA.KILAK.LLPQYL....-....D.Q.....D.L.YIVINGGV.....EETTELLKQR
 528 STEASHSN.AAIAE.ALQNAI....A....E.V.....G.L.PLGCVELIta7asIRDLVTQDQY
 529 SEITPLSA.LKLAE.IYTEAG....V....P.A.....G.V.FNVVQGDGr....VGAMLAAHPD
 530 GKEAYHSN.VALVA.CWHKAL....E....E.N.....D.L.SADWIRMLkl7atREFLMNPPEP
 531 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 532 GKEAHESN.VVLVE.CWHQAL....Q....E.N.....K.L.PKDWIKMLvm7etQEFLKNPTEP
 533 SESAPETS.KILKE.ILEKVF....D....E.K.....Y.V.LHVNPERGk....EVVEELLKEK
 534 SEMTSVTA.WMLCK.LMQQAG....V....P.P.....G.V.VNIVFGTGsk...AGSALVSHPE
 535 SEYSTNTS.RIVED.IVKEVF....L....S.C.....H.V.C-VIEGDK.....DISKEILRKK
 536 SELSEHSS.RLMKE.LLPLYL....-....D.K.....E.M.YQVVTGGV.....PETQELLKQR
 537 SERDPSAS.LLIAD.LLMRAG....L....P.A.....G.V.FNVVQGGKp....VVDTLLDHPD
 538 SERDPSPS.LFIAE.LLKQAG....L....P.D.....G.V.FNVVQGDKl....AVDTLLTHPD
 539 GKESLNSN.LALVD.LWHKAL....A....S.Q.....N.C.STDWVTYLqf7ktQQFLENPTQK
 540 SERDPSAA.LFIAD.LLTQSG....L....P.A.....G.V.FNVVQGDKg....AVDALLDHPD
 541 SEVTPLTA.LKLAE.IYTEAG....V....P.A.....G.V.FNVVQGDGs....VGALLTGHPD
 542 SEVTPLTA.LKLAE.IYTEAG....M....P.A.....G.V.FNVVQGDGs....VGALLTGHPD
 543 SEVTPLTA.LKLAE.IYTEAG....V....P.A.....G.V.FNVVQGDGs....VGALLTGHPD
 544 SEVTPLTA.LKLAE.IYTEAG....V....P.A.....G.V.FNVVQGDGs....VGALLTGHPD
 545 SEHAPHTS.ELVAE.MIQNTF....-....D.S.....S.F.VTVVQGAK.....VETEALLKQR
 546 CNSSTHSN.QVIAD.ILQTAL....K....D.T.....E.L.PTGCLEVIsa7asIQDLVTQHQY
 547 SELAPASS.KLIAE.LVPKYL....-....D.N.....D.C.FKVIEGGV.....AETSALLKLR
 548 AEQTPIIA.YEAVK.ILHEAG....I....P.K.....N.V.LHLIPGDGgy...LGKILVPDNR
 549 SERDPSST.LLIAE.LLHEAG....L....P.K.....G.V.LNVVHGDKv....AVDALIEAPE
 550 SEKDPSAP.MRLAE.LWAEAG....L....P.D.....G.V.FNVVHGGKe....AVDALLTHED
 551 AEQTPIIA.YEAVK.ILHEAG....I....P.K.....N.V.LHLIPGDGgy...LGKILVPDNR
 552 AEQTSLMA.HFAVK.LFQQAG....L....P.I.....G.V.LQCLCGAGkv...IGEKLVSDAR
 553 SERDPSST.LLIAE.LLHEAG....L....P.K.....G.V.LNVVHGDKv....AVDALIEAPE
 554 SEIAPAAS.SLLAK.LFSEYL....-....D.N.....T.T.IRVIEGGV.....PETTALLDQK
 555 SEIAPAAS.SLLAK.LFSEYL....-....D.N.....T.T.IRVIEGGV.....PETTALLDQK
 556 GKDAFHSN.KALVK.LIRQSL....E....K.S.....G.I.TPDAVQLVed7avAEELMQATDY
 557 SERDPSST.LLIAE.LLHEAG....L....P.K.....G.V.LNVVHGDKv....AVDALIEAPE
 558 SELTSVTA.WMMCK.LLEKAG....V....P.P.....G.V.VNIVFGTGpr...VGEALVAHPE
 559 AEVTPLAS.LALAR.LCEQAG....V....P.R.....G.V.ISVLPGKGsv...IGDALVRDPL
 560 AEVTPLAS.LALAR.LCEQAG....V....P.R.....G.V.ISVLPGKGsv...IGDALVRDPL
 561 SELAFHTS.KVIAN.GISRYM....-....D.N.....G.A.LAVFEGGV.....EDTVLLLKER
 562 AEVTPLAS.LALAR.LCEQAG....V....P.R.....G.V.ISVLPGKGsv...IGDALVRDPL
 563 AEQTPLIA.AAAVR.LLRDAG....V....P.A.....A.A.VQLLPGRGet...VGAALVGDAR
 564 SEMTSVTA.WMFCK.LLDKAG....V....P.P.....G.V.INIVFGTGpr...VGEALVSHPE
 565 AEVTPLAS.LALAR.LCEQAG....V....P.R.....G.V.ISVLPGKGsv...IGDALVRDPL
 566 AEQTPLIA.AQAVR.LLRDAG....V....P.A.....G.A.VQLLPGNGet...VGAALVADPR
 567 SEVAPASS.AVMAE.LVPRYL....-....D.N.....D.A.IAVIEGDG.....AVSQELIAQG
 568 GTEAVHTN.QAIVS.VMQEAL....E....S.T.....E.L.PTTSLILLpe8tsLAALVTQDQW
 569 AEQTPLIA.AAAVR.ILREAG....V....P.A.....G.A.VQLLPGRGet...VGAALVGDAR
 570 SELTPNVS.HVLSA.LIKEVY....-....P.V.....E.Y.ISTVEGGV.....ETSQQLLEQP
 571 AEETPLIA.AEGVR.ILHEGG....I....P.A.....D.A.LQLLPGDGr....IGAALVAAPE
 572 SEVASHTA.KLIAE.LWNKYL....-....D.P.....E.C.FRVVNGGI.....PETTALLDQR
 573 AEQTPLIA.AQAVR.ILREAG....V....P.A.....G.A.VQLLPGNGet...VGAALVADPR
 574 AEETPLIA.AEGVR.ILHEGG....I....P.A.....D.A.LQLLPGDGr....IGAALVAAPE
 575 AEETPLIA.AEGVR.ILHEGG....I....P.A.....D.A.LQLLPGDGr....IGAALVAAPE
 576 SRHSYNIS.KLLHG.LLTKYL....D....P.E.....C.F.EFDCEGGA.....PYITELLEYK
 577 GTEAVHTN.QAIVS.VMQEAL....E....S.T.....E.L.PTTSLISLpe8tsLAALVTQDQW
 578 SEQVPLTS.VRLAE.LFLEAG....A....P.K.....G.V.LQVVHGGKe....QVDQLLKHPQ
 579 SEQVPLTS.VRLAE.LFLEAG....A....P.K.....G.V.LQVVHGGKe....QVDQLLKHPQ
 580 AEQTPLIA.AQAVR.LLREAG....V....P.A.....G.A.VQLLPGTGet...VGAALVADSR
 581 AEQTPLIA.AQAVR.LLREAG....V....P.A.....G.A.VQLLPGTGet...VGAALVADAR
 582 SEQVPLTS.VRLAE.LFLEAG....A....P.K.....G.V.LQVVHGGKe....QVDQLLKHPQ
 583 ATETPFSA.LALGA.LAEQAG....I....P.A.....G.V.IQVVTGKSst...IGDILTGDAR
 584 ATETPFSA.LALGA.LAEQAG....I....P.A.....G.V.IQVVTGKSsv...IGDILTGDAR
 585 AEETPLIA.AEGVR.ILREAG....I....P.A.....S.A.LQLLPGDGr....VGAALVAAAE
 586 SERDPSAS.MLLAK.LWKEAG....L....P.D.....G.V.FQVLHGDKe....TVDGLLTHPD
 587 SEVTSLTT.LKLAE.IYTEAG....L....P.N.....G.V.FNVLTGSGre...VGTWLTEHPR
 588 AEQTSLMA.HYAVE.LFYQAG....V....P.K.....S.V.LQCLPGSGae...IGNKLTADPR
 589 ATQGAISA.LHVVE.IMRKAG....I....P.D.....G.V.LNTITGRGse...IGDYVVTHKG
 590 SEQTRHTS.SIIKK.ITTEAF....H....P.D.....H.V.F-VAEGGP.....ETTQELLSFA
 591 SEHAPYTA.DILEK.IISEVF....E....D.S.....-.Q.AIVIQGAV.....ETAQILLDQK
 592 SEETPGSA.TLLAE.VMHEAG....V....P.A.....G.V.FNLVHGFGggs..AGEFLSRHPG
 593 AEVTPLAS.LALAR.ICEEAG....V....P.K.....G.V.LSVLPGKGsv...IGDVLVRHPL
 594 AEVTPLVS.LALAR.ICEEAG....V....P.K.....G.V.LSVLPGKGsv...IGDVLVRHPL
 595 SEVTSLTT.LKLAE.IFTEAG....L....P.N.....G.V.FNVLTGSGre...VGTWLTEHPR
 596 AEQTPLIA.ARAVA.LMLEAG....V....P.L.....G.V.LQLLPGAGet...VGAALVADPR
 597 ATQGSLSA.LFLAK.MFHDAG....L....P.G.....G.V.LNTVTGRGse...IGDYCVTHDK
 598 AEQTPLIA.AQAVR.LLREAG....V....P.A.....G.A.VQLLPGTGet...VGAALVADPR
 599 AEVTPLVS.LALAR.ICEEAG....V....P.K.....G.V.LSVLPGKGsv...IGDVLVRHPL
 600 AEDTPASA.TILAR.LALQAG....M....P.D.....G.V.LNVVHGYGpgs..VGSALTGDPR
 601 AEQTPLIA.AQAVR.LLREAG....V....P.A.....G.A.VQLLPGTGet...VGAALVADPR
 602 CGASSHST.AAICE.ILREGL....L....D.A.....D.L.PVDSVSHIps7pnVQDLVGNASQ
 603 ATQGSLCG.LYLAK.VFQEAG....V....P.N.....G.V.LNTITGRGse...IGDYAVTHKG
 604 SELSENTA.KILAK.LLPQYL....-....D.Q.....D.L.YIIINGGV.....EETTELLKQR
 605 ATETPLSA.LALGE.LALQAG....I....P.K.....G.V.LQIVTGKSsv...VGGVLTQDHR
 606 SELSPNAS.AFLAK.TIPAYL....-....D.T.....K.A.IKVIEGGP.....DVATILLQHQ
 607 SEHAPHTS.ALLAR.SAGEYF....-....D.S.....S.A.VRVVEGGI.....VEAGALLAER
 608 AEQTPLSA.LVLAE.LITEAG....F....P.P.....G.V.VNIVNGYGre...AGAALASHPL
 609 AEETPLIA.AEAVR.LLHEAG....V....P.G.....D.A.LQLVPGAGe....IGAALVAAPQ
 610 AEQTSLIA.AQGIA.ILLEAG....V....P.P.....G.V.VQLLPGRGet...VGAQLTADAR
 611 SEWSTHSK.ILFEH.LLRKVL....S....N.R.....G.Y.DPNLIQILpgmg.ETGEALVRSG
 612 AEQTPIVA.YEAIK.LMIDSG....I....P.S.....E.S.LQFLPGSGki...IGNSLSKDHR
 613 SEKDPSAA.IWMAR.LWQEAG....L....P.D.....G.V.FTVLQGDKv....AVDGLLDHPD
 614 SERVPSTS.IMLAK.LAQEAG....L....P.D.....G.V.LQVVNGDKe....IVDAILDHPT
 615 ASQSPVVG.SMVMN.VFEEAG....L....P.K.....G.V.LSFLPGPGaq...IGDYLVHHPD
 616 SEVAPATS.SLLAE.LLPRYV....-....D.G.....S.C.IKVVEGGV.....AETTTLLEQK
 617 GKEAKRSN.AILHK.VITSAL....P....E.T.....V.G.TKLIGLLTsree.IPDLLRLDDV
 618 SEVSLHSA.KVMEE.LLPLYL....-....D.K.....D.L.YPVVTGGV.....AETQELLSLR
 619 AEETPLIA.AESVR.LLHDAG....V....P.A.....D.A.LQLLPGDGg....IGAALVAAPE
 620 AEQTPLSA.LRLAE.LTEEAG....F....P.P.....G.V.FNVITGFGet...AGAAIAAHDN
 621 SEHAPHTS.ALLAQ.ELRRYL....-....D.A.....N.A.VVVVEGAV.....DVAKALLAER
 622 SEWTPISM.ANLVQ.TMADAG....L....P.G.....G.V.VNLVYGAGe....VGERLVTDPA
 623 SSDIPLSL.YLWVR.LMHEAG....V....P.K.....N.V.LAFVSGSGgl...VGRHIVENKK
 624 SEQDPSSS.LFLAQ.LALEAG....L....P.P.....G.V.LNVVHGGPd....IANGLCEHPD
 625 SELAPTSS.SLLAT.VLPNYL....-....D.N.....N.G.IKIIEGGP.....QIGEHLLHKK
 626 SEQDPSSS.LFLAQ.LALEAG....L....P.P.....G.V.LNVVHGGPd....IANGLCEHPD
 627 AEQTPLIA.HRAIS.LLHEAG....V....P.K.....T.A.LQLLPGAGd....VGAALTSDPR
 628 PTQGSVSG.LVLAK.AFAEAG....L....P.A.....G.V.FNTITGRGse...IGDYIVEHEE
 629 PTQGSVSG.LVLAK.AFAEAG....L....P.A.....G.V.FNTITGRGse...IGDYIVEHEE
 630 AEQTPIIA.ALAVR.LLHQAG....V....P.E.....T.A.LQLLPGDGpt...VGAALTRDPR
 631 SSDAPITSgLLIAE.LFEEAG....L....P.K.....G.V.LNVVVGKAae...IGDAFVTHPI
 632 PTQGSVSG.LVLAK.AFAEAG....L....P.A.....G.V.FNTITGRGse...IGDYIVEHEE
 633 PTQGSVSG.LVLAK.AFAEAG....L....P.A.....G.V.FNTITGRGse...IGDYIVEHEE
 634 SEHTSILG.YIIVN.KFHEIG....V....P.K.....D.A.LNLILGDGi....HGDMLSKVNN
 635 ASNTPVTGgLLIAK.VFEAAG....L....P.E.....G.V.FNVVTGKGse...IGDRIAGHPH
 636 AEDTPASS.WLLGR.LCEEAG....L....P.K.....G.V.LNVVHGLGpe...AGQALIEHPD
 637 SEACPALH.RMIGT.VLEEAG....L....G.S.....G.V.VNVVTHAPedaatIVETLIAHPA
 638 ANLTPASA.VALTE.IIHRHG....L....P.A.....G.T.FNLVLGSGgs...VGDALINSPD
 639 AEQTPLVA.AMAVR.LMHEAG....V....P.R.....S.A.LQYVPGDGat...VGATLTSDAR
 640 SEDACLSA.LRIAE.LAVEVG....F....P.A.....G.V.FNVVTGRGet...AGKALTEHRG
 641 AEETPLIA.SEAVR.ILHEAG....V....P.D.....D.A.LVFLPGDGa....IGAALVAAPE
 642 ADWSPLSA.SILAD.LIEEAG....F....P.A.....G.V.FNIVQGLGae...LGNALTSDPR
 643 AEQTPLIA.FKAVE.LFYQAG....V....P.R.....S.A.LQLLPGQGet...IGAQLVADER
 644 SSDIPLSL.YLFVR.LLIEAG....V....N.K.....D.A.IAFVSGTGsl...IGDIITENKK
 645 SNNTPSSA.FEIAK.AVQDSG....I....P.A.....G.V.VNILTMDHa....TAESVCTHPK
 646 ASQTPFSA.TALAA.LAEQAG....V....P.R.....G.V.FNVVPGRAse...IAKAMTESPV
 647 AEQTPLLA.FRAVQ.ILHDAG....V....P.V.....A.A.LQLLPGGGd....VGAALTADAR
 648 AEPTPVIA.AYAIG.LLHQAG....V....P.K.....A.A.LQLLPGAGrv...VGTALSSDPR
 649 SELAPHTS.NCILK.LFNNYM....-....D.K.....S.A.YRCIEGQV.....QVSINITKLP
 650 SEYSSHSS.ELIKK.ICEKLF....N....P.K.....H.V.KVFLGGKE.....TVDKLWETQK
 651 AEQTPLIA.HLAVG.LMHKAG....V....P.A.....T.A.LQLLPGAGd....VGAALTSDAR
 652 SEKSPLSA.LRLAQ.LTREAG....L....P.R.....G.V.FQVLPGFGht...VGKALALSMG
 653 TSEAPFTA.ALVYQ.LAVEAG....V....P.P.....G.V.LNFVTGPGda...VEEVATGDPR
 654 ADQTPLVA.FRAVE.LLHEAG....V....P.R.....D.V.LQFLPGRGsk...VGAAITGDAR
 655 SERDPGAA.LILAE.LITEAG....A....P.P.....G.T.VNIIHGGAp....TVNFICDAPE
 656 SSDIPLSL.YLWVR.LMHDAG....V....P.K.....E.V.LAYVSGSGsv...VGKHIVENKK
 657 SSASAHFG.QVLEN.ALSEAF....-....P.Q.....E.L.VTVINGGG.....AISDAFSHLP
 658 SELSPHTS.AVLGR.IFKEAL....-....D.P.....G.I.IQVVYGGV.....PETTALLTQH
 659 PGESPSST.VAIGR.LMQEAG....L....P.D.....G.C.LNILWGDPah...LSETLLAAPE
 660 SERVPSAS.MFLVQ.LAQEAG....V....P.D.....G.V.VNVIHGGKe....AVNFICDAPE
 661 SEITAHTA.ELLEA.RAPEYF....-....D.A.....A.E.LTVVTGGP.....DTAAAFTALP
 662 AEQTPVIA.EVAVR.LLHEAG....V....P.P.....A.A.LHLVQGDGr....IGAALVEQRD
 663 SDTTPEST.LLLAQ.LAAEFL....-....P.E.....G.T.FNVVLGRAa....TGAMVVGSKV
 664 AEQTPGVA.WEAVK.LLHAAG....V....P.E.....G.A.LQLLHGPGet...VGAALVAAPQ
 665 APQTPLIA.HRAVQ.LLHEAG....V....P.R.....D.A.LQLLPGGPa....VGAALTSDPR
 666 DQQSSLTA.LAGHE.LLLEAG....L....P.E.....G.V.FQVVLGPG.....SSTGQAIVDQ
 667 AEQTPLIA.AQAVR.LLREAG....V....P.A.....G.A.VQLLPGDGet...VGAALVADPR
 668 AEQTPAVA.QRFVG.LLHAAG....V....P.Q.....D.A.LTLLHGPGet...VGAALVAHPL
 669 SGPIQKTH.QALVN.LLAETA....Y....E.H.....G.I.PEGAIQTLp14spLLLLLQQTRY
 670 SEIARHTE.LLLSE.LVPTYL....-....D.S.....S.A.IALIRADP.....ASMGTILEYK
 671 ASRTPIGA.LIIGE.VLAETD....L....P.K.....G.A.FSILPCSRd....GADLFTTDER
 672 SEFTPQVN.AVLRE.LLAEAF....D....P.S.....-.E.VAMVQGGV.....ATAQRLLACP
 673 SGPIQKTH.QAMVN.LLAETA....Y....E.H.....G.I.PEGAIQTLp14spLLPLLQQTRY
 674 AHQTPLVH.ARVMQ.CLADCPs...L....P.P.....G.V.VNSINESGie...VGQAIVSSPL
 675 SEKTPLTA.IACHV.LLQKAL....R....E.F.....D.K.THPGVAPAe11rdVGEVLTASKK
 676 SEKTPLTA.IACHV.LLQKAI....R....E.F.....D.K.THPGVAPAe11rdVGEVLTASKK
 677 GKEAAHSN.RILHL.LTQEAL....S....I.H.....G.V.KEAIQLVNtree.VEDLCRLDKI
 678 SELTSVTA.WMMCK.LLEKAG....V....P.P.....G.V.VNIVFGTGpr...VGEALVAHPE
 679 GPQNTASA.RRLVE.LCYEAG....M....P.P.....E.T.LQLCIPDVp....AMAELVAHPQ
 680 SEKTPLTA.IACHV.LLQKAL....R....E.F.....D.K.THPGVAPAe11rdVGEVLTASKK
 681 SEKTPLTA.IACHV.LLQKAL....R....E.F.....D.K.THPGVAPAe11rdVGEVLTASKK
 682 AENVTGSA.LLIDK.IIREAG....L....P.E.....N.I.FTVLRISHe....QSDAIIENDL
 683 SSLSTLTG.YMLCK.CFWDSG....I....P.K.....D.A.LIFLPSKGsd...ISKYLLIDEA
 684 SSLSTLTG.YMLCK.CFWDSG....I....P.K.....D.A.LIFLPSKGsd...ISKYLLIDEA
 685 SSLSTLTG.YMLCK.CFWDSG....I....P.K.....D.A.LIFLPSKGsd...ISKYLLIDEA
 686 GKEARRSN.AILHK.VITSVM....-....P.D.....T.V.GDKLIGLVtsrdeIPDLLKLDDV
 687 GSEAINSN.LKIVE.IISDAL....K....E.A.....G.L.PEGSVQILed7etATDFMRLNDY
 688 ------SN.AVLHK.IITSAI....P....D.T.....-.V.GGKLIGLVtsreaIPDLLKLDDV
 689 SSLSVLSG.YEICK.CFWDAG....I....S.K.....N.R.LIFLPAKGsd...ISKYLLNTDE
 690 SSLSTLTG.YMLCK.CFWDAG....I....P.K.....D.A.LIFLPSKGsd...ISKYLLVDEA
 691 SELTPMVA.QETVK.LWEKAG....I....P.A.....G.V.LNLVQGEVd....TGKALSAHPQ
 692 --------.-----.------....-....-.-.....-.-.--------.....--------DY
 693 --------.-----.------....-....-.-.....-.-.------LIed7dsAKQLFTMNDY
 694 ASNVPQAA.AAFEK.LMLDAG....L....P.Q.....G.V.FKNLYATRs....QIETIINDPR
 695 --------.-----.------....-....-.-.....-.-.--------.....----------
 696 --------.-----.------....-....-.-.....-.-.--------.....IPDLLKLDDV
 697 AKQARRSG.AVMIE.ALWEAG....V....P.R.....D.V.LTMVQLGEre...LGQQLISHPA
 698 --------.-----.------....-....-.-.....-.-.--------ee...IPDLLKLDDV
 699 AAQTTLIG.RIVKE.AYEAIG....G....P.A.....G.V.LQVLELGHd....QVTTAIKSGV
 700 SEITAHTA.ELLEA.RAPEYF....-....D.A.....A.E.LTVVTGGP.....DTAAAFTALP
 701 APQARHCA.AVISE.CLWEAG....I....P.R.....D.V.LQLVDVEEne...AGKHLVSHPE
 702 --------.-----.------....-....-.-.....-.-.--------.....----------
 703 --------.-----.------....-....-.-.....-.-.--------.....----------
 704 SELTSVTA.WMMCR.LLEKAG....V....P.P.....G.V.VNIVFGTGpr...VGEALVSHPE
 705 HPNAKNCI.LETVN.IISEAA....I....K.A.....G.A.PEDSILCItn6ivGTNELMKHKD
 706 --------.-----.------....-....-.-.....-.-.--------.....----------
 707 HPNALKSI.IETVE.IIQKAA....I....A.A.....G.A.PEGCVSVIkt6mqATSELMKNKE
 708 --------.-----.------....-....-.-.....-.-.--------.....----------
 709 HPKAQKCS.AAAAR.IMLDAA....V....A.A.....G.A.PANCIQWVee6ieATDALMKHPG
 710 HPNAVKCI.VETSK.ILNEAA....I....K.A.....G.A.PEGLIGCItv6iqGTSELMKHKD
 711 GESSHYTA.GAIAT.LIEAAL....S....K.T.....S.L.PKTTIQTLsls..PASWLGDPTA
 712 SEIAPAAS.SLLAK.LFSEYL....-....D.N.....T.T.IRVIEGGV.....PETTALLDQK
 713 GVSLYNTN.MALMS.SVRRAL....T....T.A.....G.L.SPSAVVCVes9rsTSEWLQLSDC
 714 SEMTPACS.QLISG.LIPKYL....-....D.E.....S.I.CQVICGDGg....VCKQILETQR
 715 HPRAQKCC.EKTAQ.LCLDAA....I....K.A.....G.A.PKDCIQWIte6veATNALMTNPG
 716 HPSAQQSS.AHAAQ.VVYDAA....V....A.A.....G.A.PKNCVQWIkt6meGTSALMKHPG
 717 HPQAQKCS.AHAAQ.ILYDAA....V....K.A.....G.A.PENIVQWIet6laNTSALIQNPK
 718 HRKARQVS.DRTVS.IIRSVL....S....R.Y.....Q.V.NPDLVQIPsq7reLTSLLMSHPD
 719 HPRAKQSS.ADAAR.LLADAA....V....A.A.....G.A.PDGIVQVVee6ipLVEALMADER
 720 HPRAKRCS.ADAAR.LLADAA....I....A.A.....G.A.PDGIVQVVee6ipLVEALMADER
 721 --------.-----.------....-....-.-.....-.-.--------.....----------
 722 HPAAAKCT.IRAVE.LMRDAA....I....E.A.....G.A.PEDIIASLtn6meATNELMKNEN
 723 GSDALGTA.QAIVThALNPAL....A....D.A.....G.L.PAGAVSLVes6haAGWAMFADRR
 724 HPRARQCS.AEAAR.LLAEAA....T....A.A.....G.A.PDGIVQVIde6lpLVEALMSDER
 725 HPGAILPL.ALTVQ.VAREVL....G....E.A.....G.F.DPDVVLLAah7ddTAQRLALDPA
 726 HPGAILPL.ALTVQ.VAREVL....G....E.A.....G.F.DPDVVLLAah7ddTAQRLALDPA
 727 HPGAILPL.ALTVQ.VAREVL....G....E.A.....G.F.DPDVVLLAah7ddTAQRLALDPA
 728 GKEALDTS.LAIAE.LMQDVL....E....K.H.....N.L.PKALV---.....----------
 729 --------.-----.------....-....-.-.....-.-.--------.....----------
 730 GKEAMRSN.TILHK.VITSVI....-....P.D.....V.V.GKKLIGLVkskdeIADLLKLDDV
 731 GKEARRSN.AALHK.VITSAI....-....P.E.....N.V.GQKLIGLVtsrdeIPDLLKLDD-
 732 GKESLKSN.LKIVD.LWHTAL....K....Q.N.....D.A.ALNWVTYLpc6teMVKCDNMQEK
 733 --------.-----.------....-....-.-.....-.-.--------.....----------
 734 --------.-----.------....-....-.-.....-.-.--------.....----------
 735 --------.-----.------....-....-.-.....-.-.--------.....----------
 736 --------.-----.------....-....-.-.....-.-.--------.....---MMTARGK
 737 --------.-----.------....-....-.-.....-.-.--------.....----------
 738 --------.-----.------....-....-.-.....-.-.--------.....----------
 739 --------.-----.------....-....-.-.....-.-.--------.....----------
 740 --------.-----.------....-....-.-.....-.-.--------.....----------
 741 --------.-----.------....-....-.-.....-.-.--------.....----------
 742 AAGEALVA.ALPAS.LKAHAV....V....R.-.....-.-.--------.....----KQADAP
 743 AAGEALVA.ALPAS.LKAHAA....V....R.K.....-.-.--------.....-----QADAP
 744 SAGEALVA.ALPAA.LKGHAA....V....-.-.....-.-.--------.....---RKQADAP
 745 GGKAILSH.NPITQ.KIFSIL....-....P.Q.....S.V.LKNVI---l....IPNWKREDSM
 746 AAGEALVA.ALPAA.LKAHAA....V....R.-.....-.-.--------.....----KQPDAP
 747 --------.-----.------....-....-.-.....-.-.--------.....----------


       190       200            210       220                    230   
        |         |              |         |                      |   
   1 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
   2 LDVLIPRGGAGLIKTVVE.....-NSTVPVIETGVGNCHVYVEE...D.....A.....DLEM..
   3 VDVIVPRGGKGLIERISR.....-DARVPVIKHLDGVCHVYIDS...H.....A.....DPEK..
   4 LDVLIPRGGAGLIRTVVE.....-NATVPVIETGVGNCHVYVDA...E.....A.....DLDM..
   5 VDVIVPRGGKGLIERISR.....-EAKVPVIKHLDGICHVYIDV...A.....A.....DLDK..
   6 VDVIVPRGGKGLIERISR.....-EAKVPVIKHLDGICHVYIDV...A.....A.....DLDK..
   7 VDVIIPRGGKGLIERISE.....-GAKVPVIKHLDGICHVYIDD...D.....A.....DADK..
   8 VDVIVPRGGKGLIARISA.....-EARVPVIKHLDGNCHVYIDD...T.....A.....NPDK..
   9 VDVIIPRGGKGLIERISE.....-GAKVPVIKHLDGICHVYIDD...D.....A.....DADK..
  10 VDVIIPRGGRSLIERISQ.....-EAKIPVIKHLDGICHVYIDD...R.....A.....DLDK..
  11 LDVLIPRGGAGLINRVIA.....-EAKVPVIQTGVGNCHVYVDS...E.....A.....DLDM..
  12 VDVIVPRGGKGLIERISR.....-EARVPVIKHLDGICHVYIDV...A.....A.....DLDK..
  13 VDVIVPRGGKGLIERISR.....-EAKVPVIKHLDGICHVYIDS...A.....A.....DLDK..
  14 IDLIIPRGGESLIRFVVE.....-NSRIPVIKHYKGVCHVFVDA...D.....A.....DFDM..
  15 IDLIIPRGGEGLIRFVTE.....-NSRIPVIKHYKGVCHIFVDE...S.....A.....DFDM..
  16 VDVIVPRGGKSLIERVSR.....-DAKVPVIKHLDGVCHVYIDV...A.....A.....DLDK..
  17 LDVLIPRGGAGLIQTVVK.....-NATVPVIETGVGNCHVYVDS...H.....A.....DLDM..
  18 VDVIVPRGGKSLIERVSR.....-DAKVPVIKHLDGVCHVYIDV...A.....A.....DLDK..
  19 LDVLIPRGGAGLIKAVVN.....-NATVPVIETGVGNCHIYIDD...E.....A.....DINM..
  20 IDVLIPRGGRGLIDNVVK.....-NSTVPVIQTGVGLCHVYVDG...S.....A.....NLKM..
  21 VDVIVPRGGKSLIERISA.....-DARVPVIKHLDGNCHVYIDD...H.....A.....DLQK..
  22 VDIIVPRGGRSLIERVVA.....-ESRIPVIKHLDGICHVYIDD...G.....A.....DLAK..
  23 IDLIIPRGGEDLIRAVVR.....-QSRIPVIKHYKGVCHVFVDA...D.....A.....DLEM..
  24 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIFVDS...S.....A.....DIAP..
  25 IDLIIPRGGASLIKNVIE.....-NSTVPVIETGVGNCHIFVDE...T.....A.....KFNM..
  26 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIFVDS...S.....A.....DIAP..
  27 IDVLIPRGGAGLIQAVLK.....-NATVPVIETGTGNCHIYVDK...D.....C.....DFEM..
  28 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIFVDS...S.....A.....DIAP..
  29 VDVVVPRGGKSLIERISA.....-DARVSVIKHLDGICHVYVDK...T.....A.....NLDK..
  30 VDVIVPRGGKGLIERISR.....-EARVPVIKHLDGVCHVFIDR...D.....A.....DLNK..
  31 IDLIIPRGGEGLIRFVSE.....-NSRIPVIKHYKGVCHSFVDA...D.....A.....DFDM..
  32 VDVIVPRGGRGLIERISR.....-DARVPVIKHLDGICHIYVSQ...H.....A.....DLDK..
  33 VDVIVPRGGKGLIERISN.....-DARVPVIKHLDGNCHVFIDN...E.....A.....DIDK..
  34 VDVIVPRGGKSLIERISN.....-EARIPVIKHLDGNCHVFIDV...E.....A.....DLHK..
  35 IDLIIPRGSNEFVRYIMD.....-NSRIPVMGHADGICHCYIDE...D.....A.....DIDM..
  36 IDLIIPRGSNEFVRYIMD.....-NSRIPVLGHADGICHLYVDE...D.....A.....DIQM..
  37 VDVIVPRGGKGLIERISK.....-EARVPVIKHLDGNCHVYIDR...D.....A.....DVAK..
  38 VDVIVPRGGRGLIERISR.....-DARVPVIKHLDGICHIYVSQ...H.....A.....DLDK..
  39 LDVLIPRGGANLIKTVLT.....-TATVPVIETGTGNCHIYVDK...D.....A.....QLTM..
  40 VDMVVPRGGKGLIERIAN.....-EARVPVIKHLDGVCHVYVDL...S.....A.....DLEK..
  41 VDVIVPRGGRGLIERISR.....-DARVPVIKHLDGICHIFVDE...H.....A.....DLDK..
  42 VDVIVPRGGKGLIERISR.....-DARVPVIKHLDGVCHVYVDR...A.....A.....DDAK..
  43 IDLIIPRGGTSLIKNVIE.....-NSTVPVIETGVGNCHIFVDE...S.....A.....NFEM..
  44 VDVIVPRGGKGLIERVSR.....-DARVPVIKHLDGICHVYVSA...H.....A.....DLPK..
  45 VDVIVPRGGRGLIERISR.....-DARVPVIKHLDGICHVYVSE...H.....A.....DLPK..
  46 VDVIVPRGGKGLIERISN.....-EARIPVIKHLDGVCHIYIDE...E.....A.....DQEK..
  47 IDVLIPRGGAGLIKSVVE.....-NSSVPVIETGTGNCHVYVDK...Y.....A.....DFDK..
  48 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  49 VDVIVPRGGKGLIERVSR.....-DARVPVIKHLDGICHVYVSA...H.....A.....DLPK..
  50 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...S.....A.....DFDK..
  51 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  52 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  53 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  54 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  55 VDVLIPRGGASLIQTVVN.....-ESTIPVIETGTGNCHVYVDE...A.....A.....DLDQ..
  56 VDVIVPRGGKGLIERISQ.....-DARVPVIKHLDGVCHVYIDA...E.....A.....DPKK..
  57 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  58 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  59 LDLLIPRGGANLIKTVVQ.....-NATVPVIETGVGNCHVFVDE...S.....A.....DFEM..
  60 VDVIVPRGGKSLIERLMN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLTK..
  61 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIFVDS...S.....A.....DIAP..
  62 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....V.....EIAE..
  63 VDVIVPRGGKGLISRLAQ.....-EARVPLIKHLDGNCHVYVDA...A.....A.....DLAK..
  64 LDVLIPRGGAKLIQRVKE.....-QATVPIIETGTGNNHVYIDK...E.....A.....QLSM..
  65 IDLIIPRGGEGLIRFVSE.....-NSHIPVIKHYKGVCHTFVDA...D.....A.....DTDM..
  66 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....V.....EIAE..
  67 LDVLIPRGGKGLKQAVLE.....-HASVPVIMTGMGNCHVYVDA...L.....A.....DLSK..
  68 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....A.....EIAE..
  69 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....V.....EIAE..
  70 VDVIVPRGGKGLIERVSR.....-DARVPVIKHLDGICHVYVSA...H.....A.....DLAK..
  71 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
  72 VDVIVPRGGKGLISRLAQ.....-EARVPLIKHLDGNCHVYVDA...A.....A.....DLAK..
  73 LSLVIPRGGYGLISFVRD.....-NATVPVLETGVGNCHIFVDE...S.....A.....DLKK..
  74 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
  75 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
  76 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
  77 VDVIVPRGGKGLIERISN.....-EARIPVIKHLDGNCHVYIDE...S.....A.....DLAK..
  78 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
  79 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTYVDA...D.....V.....DFDK..
  80 VDVIVPRGGKGLIERITG.....-EARVPVIKHLHGNCHVYVDD...R.....A.....DLAK..
  81 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDM..
  82 VDVIVPRGGKGLISRLAQ.....-EARVPLIKHLDGNCHVYVDA...A.....A.....DLAK..
  83 VDVLIPRGGASLIQTVVN.....-ESTIPVIETGTGNCHVYVDE...A.....A.....DLDQ..
  84 VDVLVPRGGKGLIERITA.....-EATVPVIKHLDGICHVYIDD...S.....A.....DPAK..
  85 LSLVIPRGGYGLISFVRD.....-NATVPVLETGVGNCHIFVDE...S.....A.....DLKK..
  86 IDVVIPRGGKSLVERISR.....-EAQVPVIKHLDGICHVYIDA...G.....A.....DADM..
  87 VDVIVPRGGKGLIERISR.....-DARVPVIKHLDGNCHTFIDS...D.....A.....DPEI..
  88 VDVIVPRGGKGLIERITG.....-EARVPVIKHLHGNCHVYVDD...R.....A.....DLAK..
  89 IDLIIPRGGESLIRFVVE.....-HSKIPVIKHYKGVCHVFVDA...S.....A.....DFDM..
  90 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
  91 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDI..
  92 IDVAIPRGGESLIRAVVE.....-HAKVPVIKHYKGVCNIYVDD...E.....A.....DLEK..
  93 IDVAIPRGGESLIRAVVE.....-HAKVPVIKHYKGVCNIYVDD...E.....A.....DLEK..
  94 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDM..
  95 VDVLIPRGGARLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDM..
  96 VDVIIPRGGKGLIERIAA.....-EATVPVIKHLDGNCHVYVDA...G.....A.....DLDL..
  97 VDIIIPRGGKGLIQRVMD.....-EATIPVIKHLDGICHTYIDA...D.....A.....DPAK..
  98 LDVLVPRGGKGLVERLLR.....-EATVPMIKHLDGVCHVYVDD...Q.....A.....DPEK..
  99 VDVIVPRGGKGLVERIAR.....-EARVPVIKHLDGVCHVYIDE...A.....A.....DTEK..
 100 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDM..
 101 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....SVTK..
 102 VDVIVPRGGKGLIKRISD.....-EACIPVIKHLDGVCHVYIDE...G.....A.....DLDK..
 103 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVGNVHIYVDA...Q.....A.....DLDM..
 104 VDVVIPRGGEALIRTVVE.....-KSTIPVIKHYKGVCHTYVDE...F.....A.....DLKI..
 105 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 106 VDVIVPRGGKSLIARLME.....-EARVPMIKHLDGICHVFIDA...D.....A.....DLDK..
 107 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 108 IDLVIPRGGAGLISYVKQ.....-NSFIPVVAGGIGVVHVYVDA...D.....A.....KVTD..
 109 VDVIVPRGGKGLIERISR.....-DAKVTVIKHLDGICHVYIDD...A.....A.....DKGK..
 110 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 111 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 112 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 113 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 114 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 115 LDLVIPRGGAGLIRRVVE.....-NATVPVIETGVGNCHVYVDV...D.....A.....DPGM..
 116 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 117 LDVLIPRGSARLIQTVLN.....-TAKVPVIETGAGICHVYVDK...F.....A.....DKKM..
 118 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....SVAK..
 119 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...N.....A.....DLQR..
 120 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 121 VDVVVPRGGKSLIERISA.....-DAKVTVIKHLDGICHVYIDS...D.....A.....DVSK..
 122 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...S.....A.....DVEK..
 123 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 124 VDVIVPRGGKSLIARLME.....-EARVPMIKHLDGICHVYIDV...D.....A.....DVDK..
 125 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...N.....A.....DLQR..
 126 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...H.....A.....DLER..
 127 VDVIVPRGGKGLIARISQ.....-DARVPVIKHLDGNCHTFIDS...D.....A.....DPEI..
 128 VDVLIPRGGAKLIQTVKE.....-KSKIPVIETGVGNVHIYIDE...F.....A.....DLDM..
 129 VDVIVPRGGKGLIERITN.....-EARVPVIKHLDGVCHVYVDL...S.....A.....DLEK..
 130 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....SVAK..
 131 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...S.....A.....DFEK..
 132 VDVIVPRGGKSLIARLME.....-EARVPMIKHLDGICHVYIDD...D.....A.....DLEK..
 133 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...S.....A.....DIEK..
 134 VDLLIPRGGARLIQTVKE.....-KAKVPVIETGVGNCHIYVDK...Y.....A.....NLDM..
 135 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...H.....A.....DLER..
 136 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....SVAK..
 137 IDLVIPRGGAGLISYVKQ.....-NSFIPVVAGGIGVVHVYVDA...N.....A.....KVTD..
 138 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...S.....A.....DVEK..
 139 VDVLIPRGGAKLIQTVKE.....-KSKIPVIETGVGNVHIYIDE...F.....A.....DLDM..
 140 VDLLIPRGGARLIQTVKE.....-KAKVPVIETGVGNCHIYVDK...Y.....A.....NLDM..
 141 VDLLIPRGGARLIQTVKE.....-KAKVPVIETGVGNCHIYVDK...Y.....A.....NLDM..
 142 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...H.....A.....DLER..
 143 IDLVIPRGGEGLIHFVSD.....-TSKIPVIQHYKGVCHLYVDK...D.....A.....DLDK..
 144 IDLVIPRGGAGLISYVKQ.....-NSFIPVVAGGIGVVHIYVDA...D.....A.....NIAD..
 145 LDVLIPRGGAKLIQTVLE.....-NATVPVIETGTGNCHIYVDK...A.....A.....EKQM..
 146 VDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDD...T.....I.....DFEQ..
 147 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYADD...S.....I.....DFDK..
 148 VDMIIPRGGASLHELCKQ.....-HSTIPVIVGGIGVCHLFIEQ...S.....A.....DLDK..
 149 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...N.....A.....NLER..
 150 VDVIVPRGGKGLIARLLA.....-ESRVPMIQHLDGNCHVYLEA...E.....A.....DPAK..
 151 LDVLIPRGGAKLIQTVLE.....-NATVPVIETGTGNCHIYVDK...A.....A.....EKQM..
 152 LDVLIPRGGAKLIQTVLE.....-NATVPVIETGTGNCHIYVDK...A.....A.....EKQM..
 153 VDVIVPRGGKGLIERISR.....-DARVPVIKHLDGNCHTFIDS...D.....A.....DPEI..
 154 VDMLIPRGGASLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...N.....A.....DFEK..
 155 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 156 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 157 VDVIVPRGGKSLIARLME.....-EARVPMIKHLDGICHVYIDV...D.....A.....DIDK..
 158 VDVIVPRGGKGLIERISR.....-DARVPVIKHLDGNCHTFIDS...D.....A.....DPEI..
 159 IDVAIPRGGEGLIRRVAD.....-EATMPVIKHFNGNCHVYVDR...D.....A.....DLDM..
 160 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHVFIDE...T.....A.....DKQM..
 161 IDVTIPRGGENLIRRVAA.....-EATMPVIKHYDGNCHVYVDE...S.....A.....DIEM..
 162 VDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYVDA...A.....A.....DPKM..
 163 LDVIVPRGGRSLVERVSQ.....-EARVPVIGHLEGICHVYVDK...G.....A.....DLEK..
 164 VDVLIPRGGASLIRTVVE.....-ESTVPVIETGTGNCHVYVDA...Q.....A.....DLDM..
 165 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHIFIDE...T.....A.....DKQM..
 166 VDMLIPRGGASLHKLCRE.....-QSTIPVITGGIGVCHTFVDE...N.....A.....DFEK..
 167 IDLVIPRGGEGLIHFVSD.....-TSKIPVIQHYKGVCHLYVDK...D.....A.....DLDK..
 168 VDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYIDK...A.....A.....DPEK..
 169 IDVLIPRGGKGLIKAVVE.....-QATVPVIETGAGNCHIYVDA...H.....A.....QLQM..
 170 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHVFIDE...T.....A.....DKQM..
 171 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHVYIDK...A.....A.....DPQK..
 172 IDLIIPRGGEGLIRFVAE.....-NSRIPVLKHYKGVCHVFVDE...S.....A.....DLEM..
 173 VDVIIPRGGKGLIERISR.....-EAKVPVIKHLDGNCHVYVDD...P.....C.....DIDM..
 174 LDVLIPRGSARLINRVKE.....-KATVPVIETGVGNCTIFVDE...S.....A.....DLDM..
 175 VDVLIPRGSARLIQTVLA.....-KATVPVIETGAGNCHVYVDK...D.....A.....QLQM..
 176 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLDK..
 177 VDVIIPRGGKGLIERISR.....-DAKVPVIKHLDGNCHVYVDD...P.....C.....DIAM..
 178 IDLVIPRGGEGLIRFVSK.....-NSSIPVLKHYKGVCHAYIDK...D.....A.....DLAK..
 179 VDVIVPRGGKSLIERLIN.....-EARVPMIKHLDGICHVYVDD...R.....A.....DLAK..
 180 VDVLIPRGGTKLIQTVKE.....-KSKIPVIETGVGNVHIYIDE...F.....A.....DLDM..
 181 VDMIIPRGGAGLQALCRD.....-NSSIPVIVGGIGVCHIFVEQ...S.....A.....DQDR..
 182 LDVIIPRGGKSLVGRVQS.....-EARVPVFAHLEGICHLYIDR...S.....A.....DLDM..
 183 VDMIVPRGGQALQRLCAE.....-QATIPVILGGIGICHLYVDK...A.....A.....NLER..
 184 VDMIIPRGGSDLHELCKQ.....-HSTIPVIVGGVGVCHTFVEE...S.....A.....DQNK..
 185 VDMIIPRGGSGLHELCKQ.....-HSTIPVIVGGVGVCHTFVEK...S.....A.....DQNK..
 186 IDVLIPRGGAGLIQAVVR.....-NSKVPVIETGAGNVHIYVDR...T.....G.....NPDK..
 187 LALVIPRGGHSLIDFVVR.....-NATVPVLETGVGNCHIYVAA...S.....A.....DLEM..
 188 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSESICHMYVDS...E.....A.....SVDK..
 189 IDLIIPRGGKELIDFVVK.....-NATVPTIETGVGNCHIFVDE...S.....A.....NIDE..
 190 MDVIVPRGGKSLVARVQS.....-DARVPVFAHLDGINHVYVDK...A.....A.....DLDM..
 191 LDLIIPRGGEGLIRFVDE.....-TSQIPVIKHYKGVCHLYVDE...D.....A.....DLEV..
 192 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHIFIDE...T.....A.....DKQM..
 193 VDVIIPRGGAGLIETVVK.....-EATVPVIETGTGVCHAYVDG...E.....A.....DLAK..
 194 VDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYLDK...D.....A.....DRKK..
 195 IDVLIPRGGGALIQEVVE.....-NATVPVLETGVGNCHIYIDR...E.....A.....DPEK..
 196 VDVLIPRGGARLIQTVKK.....-EAKVPVIETGVGNVHIYVDE...F.....A.....DLDM..
 197 IDVIVPRGGKSLVERVVA.....-ESRIPLFQHLEGICHTYVDG...S.....A.....DLEM..
 198 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSESICHMYVDS...E.....A.....SVDK..
 199 VDMIIPRGGSGLHELCKQ.....-HSTIPVIVGGVGVCHTFVEK...S.....A.....DQNK..
 200 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHIFIDE...T.....A.....DKQM..
 201 IDVLIPRGGRALIQRVVT.....-TATVPVIETGAGNCHIYIDK...D.....A.....DLTM..
 202 IDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHLYIDK...S.....A.....DLDM..
 203 IDVIVPRGGKSLVERVVA.....-ESRIPLFQHLEGICHTYVDG...S.....A.....DLEM..
 204 IDVIVPRGGKGLVGLVQV.....-EARVPVFAHLEGICHVYADA...D.....A.....DLEK..
 205 VDMIIPRGGSGLHELCKQ.....-HSTIPVIVGGVGVCHTFVEK...S.....A.....DQNK..
 206 IDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHLYIDK...S.....A.....DLDM..
 207 IDVIVPRGGKGLVALVQR.....-EARVPVFAHLEGICHIYLDA...S.....A.....DPEK..
 208 IDMIIPRGGQTLQQVCVE.....-HSTIPVITGGIGICHLFVDE...S.....A.....DVEK..
 209 VDVLIPRGGAGLIRAVVE.....-ESTVPVIETGVGNCHVYVDA...E.....A.....DLDQ..
 210 IDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHLYIDK...S.....A.....DLDM..
 211 IDVIVPRGGKGLVGLVQA.....-EARVPVFAHLEGICHVYADG...D.....A.....DLEK..
 212 LDVLIPRGGKNLIDMVVR.....-ESTVPVLETGAGNCHIFIDE...S.....A.....QPDM..
 213 IDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHLYIDK...S.....A.....DLDM..
 214 VDLIIPRGGAGLIQTVVT.....-ESTVPVIETGVGNCHVYVDA...A.....A.....DLDK..
 215 IDVIVPRGGKGLVGLVQK.....-EARVPVFAHLEGICHVYADR...D.....A.....DLDK..
 216 LDLIIPRGGRGLIELVQR.....-EARIPVLAHTEGINHLFVDE...S.....T.....DPGC..
 217 IDVIVPRGGKGLVGLVQA.....-EARVPVFAHLEGICHVYADG...E.....A.....DLEK..
 218 IDMLIPRGGAGLHKLCRE.....-QSTIPVITGGIGVCHIYVDE...S.....V.....EIAE..
 219 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYIDE...N.....A.....DPEK..
 220 VDVVIPRGGANLINAVVR.....-DAQVPTIETGVGNCHVYVHE...G.....A.....DLEV..
 221 IDMVIPRGGAGLHQFCKE.....-NSTIPVIVGGIGVCHMFVEK...S.....A.....DQEK..
 222 IDVIIPRGGETLIRAVVD.....-MARMPVLKHYKGVCHAYIDS...G.....A.....DLAQ..
 223 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...T.....A.....DLAK..
 224 IDVIVPRGGKSLIERVSA.....-ESKVPLFKHLEGLCHTYIHA...K.....A.....DPQK..
 225 IDVLIPRGGRALIQRVVT.....-TATVPVIETGAGNCHIYIDK...D.....A.....DLTM..
 226 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYIDE...N.....A.....DPEK..
 227 IDVIVPRGGKSLVARVQN.....-EARVPVFAHLEGLCHIYVDA...S.....A.....DRDM..
 228 VDVIIPRGGAGLIETVVK.....-EATVPVIETGTGVCHAYVDG...E.....A.....DLAK..
 229 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...T.....A.....DLAK..
 230 VDLIIPRGSNSFVRFVQE.....-NTRIPVLGHADGICHLYIDK...A.....A.....DISK..
 231 VDLIIPRGSNSFVRFVQE.....-NTRIPVLGHADGICHVYIDK...S.....A.....DIEK..
 232 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHVYVDS...D.....A.....SVDK..
 233 VDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYLDK...S.....A.....DPKK..
 234 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...S.....A.....DLEK..
 235 VDVLIPRGGASLISTVVQ.....-ESTVPVIETGTGNCHVYVDA...H.....A.....DLDM..
 236 LDVLIPRGGARLIQTVLE.....-NATVPVIETGTGNCHIYVDK...A.....A.....EKQM..
 237 VDLIIPRGSNSFVRFVQE.....-NTRIPVLGHADGICHVYIDK...S.....A.....DIEK..
 238 VDLIIPRGSNEFVQYIQQ.....-NTQIPVLGHADGICHLYLDA...Q.....A.....DLSK..
 239 VDVIIPRGGKGLIERISR.....-DAKVPVIKHLDGNCHTYVDD...P.....C.....DIAM..
 240 LDVLIPRGGARLIQTVLE.....-NATVPVIETGTGNCHIYVDK...A.....A.....EKQM..
 241 LDVLIPRGGKNLIDLVVR.....-ESTVPVLETGAGNCHVYIDE...S.....A.....DPDM..
 242 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIYVDH...S.....A.....DISR..
 243 LDVIVPRGGRSLVERVQN.....-EARVPVFAHLEGICHLYVDR...S.....A.....KLDM..
 244 VDLVIPRGGKGLVSLVRD.....-QARVPTLLHLDGNCHTYVHA...A.....A.....DLTK..
 245 IDLVIPRGGKSLVARVQQ.....-DARVPVLAHLDGINHSYVHK...E.....A.....DPEK..
 246 IDVMIPRGGEDLIRFVAE.....-NARMPVLKHYKGVCHVFVDD...E.....A.....DPDM..
 247 VDLIIPRGSNSFVRFVQE.....-NTRIPVLGHADGICHVYIDK...S.....A.....DIEK..
 248 VDLIIPRGSNSFVKFVQE.....-NTQIPVLGHAEGICHVYVDK...F.....A.....DIQK..
 249 IDVIIPRGGEGLINFVTD.....-NSKIPVIQHFKGVCHLYIDK...E.....A.....DLEK..
 250 IDLVIPRGGEGLIRFVAE.....-HARIPVIKHYKGVCHQFVDA...S.....A.....DIEM..
 251 IDLIIPRGSNEFVRFIQQ.....-NTNIPVLGHADGICHLYVDK...E.....A.....ELDT..
 252 VDMIIPRGGQNLQRLCAE.....-QSSIPVILGGIGICHLFVDK...Q.....A.....DLVR..
 253 IDLIIPRGSSQLVRDIEK.....AAKGIPVMGHSEGICHVYVDS...E.....A.....SVEK..
 254 VDMIIPRGGAGLHALCKQ.....-HATIPVIIGGIGVCHTFVEQ...S.....A.....DQNR..
 255 LDVLIPRGGAGLIRSVVE.....-NATVPVLETGVGNCHIFVDE...S.....A.....ERQM..
 256 IDLVIPRGGEGLIRFVAE.....-HARIPVIKHYKGVCHQFVDA...S.....A.....DIEM..
 257 IDVIIPRGGEGLINFVSD.....-NSKIPVIQHFKGVCHLYVDK...D.....A.....DLDI..
 258 VDVVIPRGGAGLINAVVR.....-DAIVPTIETGTGNCHVYVHA...A.....A.....DLDM..
 259 IDLLIPRGSNDFVKFIQD.....-NTKISVLGHADGICHVYVDT...N.....A.....DLNK..
 260 VDVIVPRGGKSLVARVES.....-EARVPVFAHLEGINHVYVDR...T.....A.....DLDM..
 261 LDVLIPRGGANLIQSVVK.....-EASVPVLETGVGNCHVYIDE...S.....A.....DPEM..
 262 IDVIVPRGGKSLVARVEQ.....-EARVPVFAHLEGVNHVYVDA...S.....A.....DLAM..
 263 IDLVIPRGGEGLIRFVAE.....-HARIPVIKHYKGVCHQFVDA...S.....A.....DIKM..
 264 VDMIIPRGGAGLHKMCKE.....-NSTVPVIIGGFGISHIFVDE...S.....A.....DLDK..
 265 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHVYVDH...S.....A.....DISR..
 266 VDMIIPRGGAGLHKMCKE.....-NSTVPVIIGGFGISHIFVDE...S.....A.....DLDK..
 267 VDMIIPRGGAGLHKMCKE.....-NSTVPVIIGGFGISHIFVDE...S.....A.....DLDK..
 268 IDVIIPRGGEGLINFVTD.....-NSKIPVIQHFKGVCHLYVDK...D.....A.....DLDI..
 269 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHVFIDE...T.....A.....DKQM..
 270 IDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGVNHVYVDG...A.....A.....DLAM..
 271 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHVFIDE...T.....A.....DKQM..
 272 VDVVIPRGGAGLIEAVVR.....-DAQVPTIETGVGNCHVYVHQ...A.....A.....DLDV..
 273 VDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHIYVDK...S.....A.....DLDM..
 274 VDVIVPRGGKSLVARVQS.....-EARVPVFAHLEGICHIYVDK...S.....A.....DLDM..
 275 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGICHVYVDR...W.....A.....DPEM..
 276 VDVLIPRGGAGLIRATVE.....-QSQVPVIETGTGVCHVYVHR...A.....A.....DLAM..
 277 IDLIIPRGGEGLIRFVSE.....-NSRIPVIQHYKGVCHLYVDD...A.....A.....DENK..
 278 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIYVDE...S.....A.....DLTR..
 279 IDVIIPRGGEGLINFVTD.....-NSKIPVIQHFKGVCHLYVDK...D.....A.....DLDN..
 280 INLIIPRGSNELVKFIQE.....-NTEIPVLGHADGICHLYIDN...E.....V.....NLDM..
 281 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGICHIYVGA...T.....A.....DPAM..
 282 VDLIIPRGSNSFVRFVQD.....-NTHIPVLGHADGICHLYVDQ...A.....A.....AIEK..
 283 IDVIIPRGGETLIRTVVA.....-DARMPVLKHYKGVCHAYVDE...G.....A.....DLEQ..
 284 VDVIVPRGGAGLIQFVVE.....-NSTVPVIETGAGNCHIFVDE...S.....A.....NLDM..
 285 IDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGVNHVYVDG...A.....A.....DLAM..
 286 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...S.....A.....DLEK..
 287 IDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGVNHVYVDG...A.....A.....DLAM..
 288 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 289 IDVIIPRGGEGLINFVTE.....-HSKVPVIQHFKGVCHLYVDK...D.....A.....DLDK..
 290 VDMIVPRGGQGLQRLCAE.....-QATIPVILGGIGICHLYLDR...D.....A.....DISR..
 291 VDVVIPRGGANLIDAVVR.....-DAQVPIIETGVGNCHVYVHQ...A.....A.....DLEV..
 292 VDLIVPRGGKSLVARVQE.....-EARVPVLAHLDGINHSYVDG...A.....A.....DPAM..
 293 VDMIVPRGGQNLQRLCAE.....-QATIPVILGGIGICHLYVDS...E.....V.....DQLK..
 294 LDVLIPRGGKQLIDTVIK.....-QSTVPVIETGAGNCHVYLDE...S.....A.....KVEM..
 295 IDVIVPRGGKDLVARVQS.....-DARVPIFAHLEGLCHIYIDQ...S.....A.....DLDM..
 296 VDLIVPRGGNALISFVSE.....-NATIPVIKHDKGLCHLYIHE...E.....A.....DFAK..
 297 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 298 IDVIVPRGGKSLVARVQN.....-EARVPVFAHLEGLCHIYVDA...S.....A.....DLEM..
 299 IDVIIPRGGKGLVGLVQR.....-EARVPVFAHLEGIVHIYLDV...E.....A.....DPAK..
 300 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....EMEL..
 301 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....EMEL..
 302 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIYVDE...S.....A.....DLTR..
 303 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...S.....A.....DLEK..
 304 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....EMEL..
 305 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....DLAL..
 306 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 307 IDLVIPRGGEGLIRFVAE.....-HARIPVIKHYKGVCHQFVDA...S.....A.....DIEM..
 308 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 309 IDVIVPRGGRSLVGRVQD.....-EARVPVFAHLEGLCHVYVDR...A.....A.....NLDM..
 310 VDLLIPRGSNEFVKFIQD.....-NTKIPVLGHTSGICHIYVDE...F.....A.....DPDT..
 311 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 312 VDLIIPRGSSSFVRYILE.....-NTRIPVLGHADGLCHLYVDR...A.....A.....DVDM..
 313 VDLLIPRGGAELINTVVQ.....-ESLVPVIETGIGNVHMFIDS...S.....A.....TVKN..
 314 VDVIVPRGGKSLVARVES.....-EARVPVFAHLEGVNHVYVDR...S.....A.....DLEM..
 315 IDLVIPRGGEGLIRFVAE.....-HARIPVIKHYKGVCHQFVDA...S.....A.....DIEM..
 316 LDVLIPRGGKKLIDLVVR.....-ESTVPVLETGAGNCHIFIDE...T.....A.....KPQM..
 317 VDLIIPRGSNDLVRFIQD.....-NTRIPVLGHADGICHLYIDS...A.....A.....DLDK..
 318 VDVLIPRGGAGLIRSVVE.....-ESTVPVIETGVGNCHVYVDA...D.....A.....DLDQ..
 319 VDVVIPRGGAGLIDAVVR.....-DAQVPTIETGVGNCHVYVHS...A.....A.....DLDM..
 320 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGICHLYLDA...A.....A.....DLKQ..
 321 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 322 VDLIIPRGSNEFVRYIQN.....-NTRIPVLGHADGLCHLYVDR...A.....A.....DLEK..
 323 VDLLIPRGSNEFVKFIQD.....-NTKIPVLGHTSGICHIYVDE...F.....A.....DPDT..
 324 VDVLIPRGSAQLIQTVVQ.....-ESTVPVIETGAGIVHVFLDE...S.....A.....DTST..
 325 VDVLIPRGGAGLIRAVVE.....-ESTVPVIETGVGNCHVYVDV...D.....A.....DVDT..
 326 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....EMEL..
 327 LDVLIPRGSARLINRVKE.....-KATVPVIETGVGNCTIFVDE...S.....A.....DLEM..
 328 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....DVDL..
 329 IDVIIPRGGEGLINYVTE.....-NSSIPVIQHFKGVCHLYVDK...D.....A.....NQDI..
 330 LDLLIPRGGEELIRLVQR.....-EARVPVLAHAKGVNHLYVDK...K.....A.....DLSM..
 331 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKps
 332 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...S.....A.....DLEK..
 333 VDMIIPRGGAGLHKMCKE.....-NSTIPVIIGGFGISHIFVDE...S.....A.....DLEK..
 334 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 335 VDVVIPRGGAGLIDAVVR.....-DAQVPTIETGVGNCHVFVHE...S.....A.....DLDM..
 336 VDLIIPRGGEGLIKYVCD.....-NATVSVVKHDKGQCHTYIDK...E.....A.....ILED..
 337 IDVIIPRGGEGLINYVTE.....-NSSIPVIQHFKGVCHLYVDK...D.....A.....NQDI..
 338 IDVIIPRGGQSLVKRVQS.....-DARVPVFAHLAGLCHIYIDQ...S.....A.....NVEM..
 339 INLIIPRGSNELVKFIQE.....-NTRIPVLGHADGICHLFIDN...E.....A.....NLEM..
 340 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHSEGICHVYVDH...E.....A.....SITKp1
 341 IDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGVNHVYVDG...A.....A.....DPAM..
 342 VNLIIPRGSNELVQFIQE.....-NTRIPVLGHADGICHLYVDN...S.....V.....DIDK..
 343 VDVIVPRGGKNLVARVEA.....-EARVPVFAHLEGVNHVYVDG...A.....A.....DLEM..
 344 IDLIIPRGGKSLVARVQA.....-EARAPVLGHLEGLNHVFVHA...A.....A.....DLKK..
 345 VDVIVPRGGKSLVARVES.....-EARVPVFAHLEGVNHVYIDR...S.....A.....DLDM..
 346 IDVLIPRGGANLIQTVLQ.....-EATIPVIETGVGNCHVYVAS...S.....A.....DPDM..
 347 IDIIIPRGGKGLVARVQD.....-EARVPVLAHLDGINHLYIDG...A.....A.....NPAK..
 348 LDLLIPRGGEELIRLVQQ.....-EARVPVLAHAKGVNHLYVDE...K.....A.....DLSM..
 349 VDLAIPRGGEGLIRFVAE.....-HARVPVIKHYKGVCHLFVDA...S.....A.....DVDL..
 350 IDLVIPRGSNKLVAQIKS.....-STKIPVLGHADGVCHVYIDK...S.....A.....DMDM..
 351 VDLIIPRGSSSFVRYIME.....-NTRIPVLGHADGLCHLYVDR...A.....A.....DVDM..
 352 IDVLVPRGGAGLIQAVVR.....-NSKVPVIETGAGNVHIYIDK...S.....G.....DLAK..
 353 IDLVIPRGSNKLVAQIKS.....-STKIPVLGHADGVCHVYIDK...S.....A.....DMDM..
 354 IDVLVPRGGAGLIQAVVR.....-NSKVPVIETGAGNVHIYIDK...S.....G.....DLAK..
 355 VDVVIPRGGAGLIDAVVR.....-DAQVPTIETGVGNCHVYVHS...S.....A.....DLDT..
 356 IDVIIPRGGEGLINYVTE.....-NSSIPVIQHFKGVCHLYVDK...D.....A.....NQDI..
 357 VDLIIPRGSNALVRFIQD.....-NTRIPVLGHADGVCHLYVDA...Q.....V.....DVPQ..
 358 IDLIIPRGSSQLVRDIQR.....AAKGIPVLGHTEGICHVYVDA...E.....A.....DIDK..
 359 IDLVIPRGSNKLVSQIKE.....-STRIPVLGHADGICHVYVDK...S.....A.....NMDM..
 360 IDVLVPRGGAGLIQAVVR.....-NSKVPVIETGAGNVHIYIDK...S.....G.....NLAK..
 361 VDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGINHVYVDR...A.....A.....DLDM..
 362 IDVIIPRGGEGLINYVTE.....-NSSIPVIQHFKGVCHLYIDK...D.....A.....DQTM..
 363 VDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGINHVYVDR...A.....A.....DLDM..
 364 IDVIVPRGGKNLVARIQV.....-DARVPIFAHLEGLCHIYIDQ...S.....A.....DLDM..
 365 IDLVIPRGSNKLVSQIKN.....-STKIPVLGHADGICHVYVDK...S.....C.....KVDM..
 366 IDLVIPRGSNKLVSDIKS.....-STKIPVLGHADGICHVYVDK...S.....A.....NLEM..
 367 LDLLIPRGGAGLIRAVVE.....-NAVVPVIETGTGIVHIYIDK...D.....A.....DWDK..
 368 IDLVIPRGSNKLVSQIKA.....-STKIPVLGHADGICHVYVDK...S.....A.....DMDM..
 369 IDLVIPRGSNKLVSQIEA.....-STKIPVLGHADGICHVYIDK...S.....A.....DMDM..
 370 IDLVIPRGSNKLVSQIKA.....-STKIPVLGHADGICHVYIDK...S.....A.....DMDM..
 371 IDVIIPRGGEGLINYVTE.....-NSSIPVIQHFKGVCHLYIDK...D.....A.....DQTM..
 372 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGICHLYVDA...A.....A.....DVDK..
 373 IDLVIPRGSNKLVSQIKA.....-ATKIPVLGHADGICHVYIDK...S.....A.....DMDM..
 374 IDLLVPRGGAGLIQAVVE.....-NATVPVIETGTGICHVYVDK...D.....A.....DLDK..
 375 IDLIIPRGGEGLINFVTE.....-NSTIPVIQHFKGVCHLYVDK...D.....A.....DLEV..
 376 VDVIVPRGGKSLVARVEA.....-EARVPVFAHLEGVNHVYVDR...G.....A.....DLAM..
 377 IDLIIPRGGKSLVERVQR.....-EARVPVLAHADGLNHTYIHA...S.....A.....DPAM..
 378 VDLVIPRGGRGLVELVRD.....-QASVPTLLHLDGNCHSYVHE...A.....A.....DVAK..
 379 VDVLIPRGGRDLIQTVVT.....-NSSVPVIETGEGNVHIFIDE...S.....A.....SEDM..
 380 VDLLIPRGSNEFVKFIQE.....-NTKISVLGHTSGICHIYVDE...Y.....V.....DLDT..
 381 INLIIPRGSNELVKFIQE.....-NTRIPVLGHADGICHLFIDI...E.....A.....NLEM..
 382 VDMIIPRGGAGLHKMCKE.....-NSSIPVIIGGFGISHAFVDE...S.....A.....DLER..
 383 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGICHLYVDA...A.....A.....DVDQ..
 384 IDLIIPRGSSELVRSIQE.....KAQHIPVMGHAEGICHVYVDR...E.....A.....DLDK..
 385 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGICHLYIDS...A.....V.....NLNQ..
 386 VDVLIPRGSAGLIQIVVT.....-QSAVPVIETGAGVVHIVLDE...S.....A.....REDW..
 387 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGVCHLYVDA...A.....A.....DIAK..
 388 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGVCHLFVDR...S.....V.....NQEQ..
 389 VDVLIPRGGAGLIRSVVE.....-ESTVPVIETGVGNCHVYVDR...A.....A.....DLDK..
 390 IDLVTPRGSNKLVSQIKA.....-STKIPVLGHADGICHVYIDK...S.....A.....DMDM..
 391 VDMIIPRGGAGLHRFCVE.....-NATVPVIVGGMGVSHIYVEP...S.....A.....DFAR..
 392 IDLVIPRGSSDLVRSIQE.....QSKHIPVLGHAEGICHVFVDR...D.....A.....DLVK..
 393 IDLIIPRGSSELVRSIQQ.....KSQHIPVMGHAEGICHVYVDK...D.....A.....SPEK..
 394 IDVIIPRGGEGLIRHVTD.....-NSKIPVIQHFKGVCHLYIDK...D.....A.....DLQT..
 395 IDLVIPRGSNKLVSQIKE.....-STKIPVLGHADGICHVYVDK...S.....A.....NMDM..
 396 VDMIIPRGGAGLHEFCKQ.....-NSTIPVIIGGVGVCHVFVEE...S.....A.....EQDK..
 397 IDMIVPRGGKSLVARVQA.....-DARVPVLAHLDGINHTFVHA...S.....A.....DPAM..
 398 IDLIIPRGSSELVRSIQQ.....QSVHIPVLGHAEGVCHVYIDR...D.....A.....DLQK..
 399 VDMIIPRGNAGLQKFCKE.....-NSTIPVIVGGIGICHLYVEK...T.....A.....DIEK..
 400 IDLVIPRGSNKLVTQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....DTDM..
 401 VDMIIPRGGAGLHKMCKE.....-NSTVPVIIGGFGISHIFVDE...S.....A.....DLDK..
 402 IDLVIPRGSNKLVTQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....DTDM..
 403 IDLVIPRGSNKLVTQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....DTDM..
 404 IDLVIPRGGEGLIRYVSE.....-NSRIPVIQHYKGVCHLYIDK...Y.....A.....DLDK..
 405 IDVIVPRGGKGLVGLVQR.....-EARVPVFAHLEGICHIYVGA...H.....A.....DPAM..
 406 IDLAIPRGGPSLIRAVAE.....-RSRVPVLKHYQGVCHLYLDA...S.....A.....PPQQ..
 407 IDLVIPRGSNKLVSQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....NVDM..
 408 VDLLIPRGGEGLIEFVKH.....-NATIPIIKHDKGVCHTYIHK...S.....A.....NLDM..
 409 IDMIVPRGGKSLVARVQS.....-DARVPVLAHLDGINHTYIHS...A.....A.....NPTM..
 410 IDIVVPRGGEGLIRFVSE.....-NSKIPVVKHDKGVCNLYIDQ...D.....A.....DPEK..
 411 VDLLIPRGGAGLINAVVT.....-GAKVPVIQTGTGNCHLVIDV...S.....A.....DVEM..
 412 IDIVVPRGGEGLIRFVSE.....-NSKIPVVKHDKGVCNLYIDQ...D.....A.....DPEK..
 413 VDMIIPRGGAGLHEFCKQ.....-NSTIPVIIGGVGVCHVFVEE...S.....A.....EQDK..
 414 LDLLIPRGGAGLIRAVVE.....-NAVVPVIETGTGIVHIYIDK...D.....A.....DWDK..
 415 IDLVIPRGSNKLVSQIKS.....-STKIPVLGHADGICHVYVDK...S.....A.....DLEM..
 416 LDLLIPRGGAGLINAVVE.....-NAIVPVIETGTGIVHVYVDK...D.....A.....DEDK..
 417 VDVLIPRGSGQFIDFVVK.....-NATVPVIETGAGNTHIFVDE...S.....A.....KQDE..
 418 IDLIIPRGSSDLVRSIQQ.....QSLHIPVLGHAEGVCHVYIDR...D.....A.....DLEK..
 419 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQNKGLCHAFVDQ...S.....A.....NLDM..
 420 IDLVVPRGSNKLVSQIKE.....-STKIPVLGHADGICHVYVDK...S.....A.....KIDM..
 421 VDLLVPRGGADLIQRVVR.....-EATVPVIETGVGNCHVYVDA...S.....A.....DLAQ..
 422 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQNKGLCHAFVDQ...S.....A.....NLDM..
 423 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQNKGLCHAFVDQ...S.....A.....NLDM..
 424 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQNKGLCHAFVDQ...S.....A.....NLDM..
 425 IDLVIPRGSNKLVTQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....DTDM..
 426 LDLIVPRGGENLVKFVSQ.....-NATIPVLKHDKGLCHIYVDE...F.....A.....DLDK..
 427 IDLVIPRGSNELVKHIKD.....-NTKIPVMGHADGICAIYVDQ...D.....A.....NAKM..
 428 LDLLIPRGGAGLINAVVE.....-NAIVPVIETGTGIVHVYVDK...D.....A.....DEDK..
 429 IDLVIPRGSNKLVSHIKN.....-SPKIPVLGHADGICHVYVDK...S.....G.....KLDM..
 430 IDLIIPRGSSELVRSIQS.....QSQHIPVLGHAEGICHVYVD-...N.....A.....DLSK..
 431 VDLLMPRGSSAFVSYIQD.....-NTSIPVLGHTEGVCHVYVDD...A.....A.....DLDM..
 432 LDLLIPRGGAGLIRAVVE.....-NAVVPVIETGTGIVHIYIDK...D.....A.....DWDK..
 433 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQNKGLCHAFVDQ...S.....A.....NLDM..
 434 IDLVIPRGSNELVRNIKS.....-NTKIPVLGHADGICSIYIDK...E.....A.....DLDK..
 435 VDVLIPRGGAKLIQTVKE.....-KSKIPVIETGVGNVHIYIDE...F.....A.....DLDM..
 436 VDLIIPRGSNELVRFIQD.....-NTRIPVLGHADGVCHLYVDA...A.....A.....DVMK..
 437 IDVIIPRGSSNMIQEIAN.....-NTKIPLIKQDKGLCHAFVDQ...S.....A.....NLDM..
 438 IDLVIPRGSNELVRNIKS.....-NTKIPVLGHADGICSIYVDE...K.....F.....DIIK..
 439 IDLVIPRGSNKLVSDIKS.....-STKIPVLGHADGICHVYVDK...S.....A.....NLEM..
 440 VDVVIPRGGAGLINAVVM.....-GATVPTIETGTGNCHFYIDG...D.....V.....DVDS..
 441 VDLVIPRGGRSLVERVRD.....-EARVPTLLHLDGNCHSYVHS...G.....A.....DLEK..
 442 IDLVIPRGSGELVHMIKK.....-NTCIPVLGHADGVCMLYVHV...D.....A.....NISE..
 443 IDLIIPRGSSDLVRSMQE.....KSKGIPVLGHAEGVWHVYIDK...D.....C.....DEQK..
 444 IDLVIPRGSSDLVRSMQE.....KSKGIPVLGHAEGVCHVYIDK...D.....C.....DEQK..
 445 VDVVIPRGGAGLINAVVT.....-GATVPTIETGTGNCHFYIDA...E.....A.....KLDQ..
 446 IDLVIPRGSGELVHMIKK.....-NTCIPVLGHADGVCMLYVHV...D.....A.....NISK..
 447 IDLIIPRGSSDLVRSMQE.....KSKGIPVLGHAEGVWHVYIDK...D.....C.....DEQK..
 448 IDLVIPRGSKEMVQLIQQ.....QSEGIPVLGHSEGICHVYIDE...E.....A.....DLDM..
 449 IDLVIPRGSGELVKSIKE.....QSKMIPVLGHAEGVCHVYVDK...Y.....A.....DLEK..
 450 VDVVIPRGGAGLIEAVVT.....-NATVPTIETGTGNCHFYIDR...D.....Vs....DLDQ..
 451 VDLVIPRGGAGLINAVVL.....-GATVPTIETGTGNCHFYIDS...S.....A.....DIEE..
 452 IDLVIPRGSGELVKSIKE.....QSKMIPVLGHAEGVCHVYVDK...Y.....A.....DLEK..
 453 IDLVIPRGSGELVKTIKE.....QSKMIPVLGHAEGVCHVYVDK...Y.....A.....DLEK..
 454 IDLVIPRGSNKLVSQIKN.....-STKIPVLGHADGICHVYVDK...S.....G.....KLDM..
 455 VDVVIPRGGAGLINAVVT.....-GATVPTIETGTGNCHFYIDA...E.....A.....KLGQ..
 456 IDLVIPRGSTNLVRHIKD.....-NTKIPVLGHAAGLCSMYVHE...D.....A.....DMEL..
 457 IDLVIPRGSNKLVSQIKN.....-STKIPVLGHADGICHVYVDK...S.....G.....KLDM..
 458 IDLVIPRGSNDLVRYIKN.....-NTRIPVLGHADGLCAIYLEQ...S.....A.....DPSM..
 459 VDVIIPRGSSNMIQEIAS.....-HTKIPLIKQDKGLCHAFVDE...S.....A.....NLNM..
 460 IDVLIPRGSAAFIDYVVA.....-NATVPVIETGAGNTHIFVDA...S.....A.....DQAA..
 461 IDLVVPRGSNSLVRQIKD.....-STKIPVLGHADGICSIYVDR...D.....A.....DLEK..
 462 IDLVIPRGSNKLVSQIKD.....-STKIPVLGHADGICHVYVDK...S.....A.....NMDT..
 463 IDLIIPRGGKSLVERVQR.....-EARVPVLAHAEGLNHTYIHA...E.....A.....DAEM..
 464 LDLLIPRGGEELIRLVQQ.....-EARVPVLAHAKGVNHLYVDE...K.....A.....DLSM..
 465 IDMIIPRGSQQLIDHVRN.....-TAKVPVIETGAGIVHTYVDR...D.....A.....DMEM..
 466 IDLVIPRGSNDLVRFVKE.....-NTKIPVLGHADGLCSAYLHA...D.....A.....DPAI..
 467 IDLVIPRGSNDLVRFVKE.....-NTKIPVLGHADGLCSAYIHS...D.....A.....DPEI..
 468 IDLVIPRGSNEMVRNIQR.....-STNIPVLGHADGICHVYVHP...D.....A.....DMNM..
 469 IDAVFPRGGAALIRRVVE.....-GAHVPVIETGCGVCHLYVDE...S.....A.....NIDV..
 470 IDAVFPRGGAALIRRVVE.....-GAHVPVIETGCGVCHLYVDE...S.....A.....NIDV..
 471 IDMIIPRGSQKLIDFVRQ.....-NAKVPVIETGAGIVHTYIDK...N.....A.....DTGI..
 472 IDVIIPRGSQALIDFARK.....-HSTVPVIETGAGIVHTYFDQ...S.....G.....DLAM..
 473 IDVIIPRGGKNLVKRVQQ.....-FSNVPIIGHLEGLCHTFIDK...D.....A.....NLKM..
 474 IDLVIPRGSNELVRFVKD.....-NTKIPVLGHADGLCSAYLHF...D.....A.....DPEV..
 475 VDLIIPRGSSNLINFVRE.....-NARIPVIETGAGICHTYFDE...F.....G.....DTRK..
 476 VDAIIPRGGAGLHRFCVE.....-NATVPVIVGGIGVVHIYLDE...SftrdpA.....DVAR..
 477 VDLCIPRGSQNLINFVRD.....-NAKIPVIETGAGIVHTYFDK...S.....G.....DLGK..
 478 IDIIIPRGSQQLIDYVRT.....-HSTVPVIETGAGIVHTYFDA...S.....G.....ELDM..
 479 IDMIIPRGSQKLIDFVRN.....-NAKVPVIETGAGIVHTYFDK...S.....G.....DLDL..
 480 IDLVIPRGSNELVRYIKE.....-STKIPVLGHADGLCHIYLTA...S.....A.....DKEK..
 481 VDLIIPRGSSALINFVRQ.....-NATIPVIETGAGICHTYFDE...Y.....G.....DTAK..
 482 IDVIIPRGGKNLVKRVQQ.....-FSNVPIIGHLEGLCHTFIDK...D.....A.....NLKM..
 483 VDLCIPRGSQNLINFVRD.....-NAKIPVIETGAGIVHTYFDK...S.....G.....DLGK..
 484 IDMIIPRGSQKLIDFVRD.....-NSRVPVIETGAGIVHTYFDV...S.....G.....DLEL..
 485 IDLVIPRGSNELVRYIKE.....-NTKIPVLGHADGLCSIYLAA...S.....A.....DAKL..
 486 VDLCIPRGSQNLINFVRD.....-NAKIPVIETGAGIVHTYFDK...S.....G.....DLEK..
 487 IDLVIPRGSNELVRFIKA.....-NTKIPVLGHADGLCSIYLRS...D.....A.....DITM..
 488 IDVIIPRGSQQLIDFARK.....-SSSVPVIETGAGIVHTYFDL...S.....G.....DLQM..
 489 VDAIIPRGGAGLHRFCVE.....-NATVPVIVGGIGVVHIYLDG...S.....FvqtpqDVQI..
 490 IDLVVPRGSNALVRKIKD.....-TTKIPVLGHADGICSIYLDE...D.....A.....DLIK..
 491 IDVLIPRGSGSFINYVVD.....-NSTVPVIETGAGNDHIFVDK...S.....A.....DQEE..
 492 IDLVVPRGSNALVRKIKD.....-TTKIPVLGHADGICSIYLDE...D.....A.....DLIK..
 493 IDVIIPRGSQQLIDFVRK.....-NSTVPVIETGAGIVHTYFDK...S.....G.....NLAM..
 494 IDLVIPRGSNALVRQIKS.....-STKIPVLGHADGICSIYVDE...S.....A.....DIGK..
 495 IDMIIPRGSQALINHVRN.....-TAKVPVIETGAGIVHTYFDK...S.....G.....ELEM..
 496 LDVLIPRGGKNLIDLVVR.....-ESTVPVLETGAGNCHVYIDE...S.....A.....DPDM..
 497 IDLVMPRGGNELVRSIQN.....-NTRIPVMGHADGICAVYLDE...S.....A.....VQEK..
 498 IDLVVPRGSNAMVQNIQR.....-STRIPVLGHADGICHVYVHK...D.....A.....DVDA..
 499 IDLVMPRGGNELVRSIQN.....-NTRIPVMGHADGICAVYLDE...S.....A.....VQEK..
 500 IDLVVPRGSNALVKQIKA.....-STKIPVLGHADGICSIYLDA...D.....A.....DLAK..
 501 IDLIIPRGSSELVRHIQT.....AAKGIPVLGHSEGICHVYVDS...E.....A.....SIDK..
 502 LDVLIPRGGKKLIDLVVR.....-ESTVPVLETGAGNCHIFIDE...T.....A.....KPQM..
 503 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 504 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 505 VDLIVPRGGEKLIEFVKA.....-HATCPVIVSGRGNNFVYVHE...D.....A.....DTDL..
 506 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 507 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 508 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 509 FDHIFYTGNTAVGKIVMEaa...AKHLTPVTLELGGKSPCYIDK...D.....C.....DLDI..
 510 FDHIFYTGSTGVGKIIMSaa...AKFLTPVTLELGGKSPCYIDK...N.....C.....DIDI..
 511 FDHIMYTGSTAVGKIVMAaa...AKHLTPVTLELGGKSPCYVDK...D.....C.....DLDV..
 512 FDHIFYTGNTAVGKIVMEaa...AKHLTPVTLELGGKSPCYIDK...D.....C.....DLDI..
 513 FDHIFYTGNTAVGKIVMEaa...AKHLTPVTLELGGKSPCYIDK...D.....C.....DLDI..
 514 IDLVIPRGSNEMVRNIQR.....-STSIPVLGHADGICHVYVHP...D.....A.....DMNM..
 515 LDLIVPRGGERLIGFVKE.....-HAKCAVLVSGRGNNFLYVHP...K.....A.....DWAK..
 516 FDHILYTGNTTVGKIVMQaa...AKHLTPVTLELGGKSPCYVDR...D.....C.....DLDV..
 517 FDHILYTGNTTVGKIVMQaa...AKHLTPVTLELGGKSPCYVDR...D.....C.....DLDV..
 518 IDLVVPRGGDKLIDFVKR.....-TAKGAVLVSGRGNNFLYVSP...D.....A.....DWDT..
 519 IDLVIPRGSNELVRAIQR.....-DARMPVMGHADGLCIGYVHE...D.....A.....ELDM..
 520 FDHILYTGNSAVGKIVMAaa...AKHLTPVTLELGGKSPCYIDT...D.....C.....DLAV..
 521 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHIFIDE...T.....A.....DKQM..
 522 IDLVIPRGSNKLVSQIKS.....-STKIPVLGHADGICHVYVDK...S.....A.....NVEM..
 523 INLVIPYGRSSLVQQVMR.....-QATCPVLKSAMGNCYLYWSL...N.....S.....SLDM..
 524 LDLVVPRGGERLIDFVKE.....-HAKCAVLISGRGNNFLYIDE...S.....A.....DWNQ..
 525 INLVIPYGRSSLVQQVVR.....-QATCPVLKSAMGNCYLYWSL...N.....S.....SLDM..
 526 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 527 FDHIFYTGNTAVGKIVMEaa...AKHLTPVTLELGGKSPCYIDK...D.....C.....DLDI..
 528 VNLVIPYGRSSLVQQVVR.....-QSTCPVLKSAMGNCYLYWSL...N.....S.....SLEM..
 529 IEKISFTGGVETGKKVMSlag..ASSLKEVTMELGGKSPLLVFD...D.....A.....DLER..
 530 IDLIVPRGGERLIAFVKE.....-HATCAVLVSGRGNNFLYVAE...D.....A.....DWDQ..
 531 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 532 LDLIVPRGGERLIAFVKE.....-HAKCAVLVSGRGNNFLYVDK...D.....A.....DWKK..
 533 FDYIFFTGSATVGKIVMKaa...SQYLTPVTLELGGKSPCIIDK...D.....C.....KLEL..
 534 VPLISFTGSTATARLITEls...APYCKKLSLELGGKNPALVFA...D.....A.....DLDQ..
 535 FDYIFFTGSEEVGKIVMKaa...AENLTPLTLELGGKSPCIIDS...E.....C.....NLSL..
 536 FDHIFYTGSSTVGKLVMEaa...SRHLTPVTLELGGKSPCYIDK...N.....C.....DIAV..
 537 VQAVSFVGSTPIAAYVQQrg...VQAGKRVQALGGAKNHLVVMP...D.....A.....NLDQ..
 538 VKAVSFVGSTPIAQYIYEtg...AKHGKRVQALGGAKNHMVVMP...D.....A.....DLEQ..
 539 VDLIVPRGGERLIAFVKQ.....-HATCPVIISGRGNNFVYVDS...E.....A.....DLQM..
 540 VQAVSFVGSTPIAAYVQQra...VQSGKRVQALGGAKNHLVVMP...D.....A.....NIEQ..
 541 IAKVSFTGGVETGKKVMSlag..ASSLKEVTMELGGKSPLIVFD...D.....A.....DLDR..
 542 IAKVSFTGGVETGKKVMSlag..ASSLKEVTMELGGKSPLIVFD...D.....A.....DLDR..
 543 IAKVSFTGGVETGKKVMSlag..ASSLKEVTMELGGKSPLIVFE...D.....A.....DLDR..
 544 IAKVSFTGGVETGKKVMSlag..ASSLKEVTMELGGKSPLIVFD...D.....A.....DLDR..
 545 FDHIFFTGGAAIGKIVMRaa...SEFLTPVTLELGGKSPAIVDE...D.....A.....NIQV..
 546 LSLVLPYGRPSLVEQVTQ.....-WATAPVLKSAMGNCYLYWSP...T.....V.....DLEM..
 547 FDYIFFTGSTHIGKIVSEaa...AKFLTPVTLELGGKSPVYVDN...T.....V.....DIEI..
 548 IAGVAFTGSTQTAQIINKmlanrDGPIVPLIAETGGLNAMIVDS...S.....A.....LLEQ..
 549 VKALSFVGSTPIAEYIYKeg...AARGKRVQALGGAKNHAVLMP...D.....A.....DLDN..
 550 VKAVSFVGSTPIARYVYAta...AAHGKRVQALGGAKNHMVVLP...D.....A.....DLDL..
 551 IAGVAFTGSTQTAQIINKmlanrDGPIVPLIAETGGLNAMIVDS...S.....A.....LLEQ..
 552 VDGVIFTGSTDTAKRINQnlak.HNKLIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 553 VKALSFVGSTPIAEYIYKeg...AARGKRVQALGGAKNHAVLMP...D.....A.....DLDN..
 554 WDKIFFTGGARVARIIMAaa...ARNLTPVVLELGGKCPALVDS...D.....V.....NLQV..
 555 WDKIFFTGGARVARIIMAaa...ARNLTPVVLELGGKCPALVDS...D.....V.....NLQV..
 556 VDVLIPRGGAKLIQTVKE.....-KAKVPVIETGVRNVHIYVDA...Q.....A.....DLDM..
 557 VKALSFVGSTPIAEYIYKeg...AARGKRVQALGGANNHAVLMP...D.....A.....DLDN..
 558 VPLISFTGSQPTAERIIHls...APHCKKLSLELGGKNPAIIFE...D.....A.....NLEE..
 559 VKKVSFTGGTEVGRGIARla...AEKLMPLSLELGGKSPTIVFD...D.....A.....ELDH..
 560 VKKVSFTGGTEVGRGIARla...AEKLMPLSLELGGKSPTIVFD...D.....A.....ELDH..
 561 FDCVFFTGSQRAGREVMLaa...ARHLTPVILELGGKSPCIVHN...D.....A.....SLGV..
 562 VKKVSFTGGTEVGRGIARla...AEKLMPLSLELGGKSPTIVFD...D.....A.....ELDH..
 563 VKGVMFTGSTEVARLLQRnv8daAGRPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 564 VPLISFTGSQPTAERITQls...APHCKKLSLELGGKNPAIIFE...D.....A.....NLEE..
 565 VKKVSFTGGTEVGRGIARla...AEKLMPLSLELGGKSPTIVFD...D.....A.....ELDH..
 566 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 567 FDHLIFTGGTEVGRKVYEsa...ATHLTPVTLELGGKSPVIVAK...D.....A.....DIEV..
 568 IDLVIPYGRPELVQQVAR.....-LATSPVLRTSMGNCYLYWAS...G.....G.....ELET..
 569 VKGVMFTGSTEVARILQRni8daAGRPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 570 FDYIFFTGSVPVGKIVMEaa...SKRLIPVTLELGGKSPVIVHE...D.....A.....NIGL..
 571 TCGVMFTGSTEVARLIQAql8lpNGKPVPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 572 FEHIFYTGNGTVGRIIAEka...AKWLCPTTLELGGKSPVYVDK...S.....A.....DLSI..
 573 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 574 TCGVMFTGSTEVARLIQAql8lpNGKPVPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 575 TCGVMFTGSTEVARLIQAql8lpNGKPVPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 576 WDHIFFTGSVKVGKIVYQaa...AKFLTPVTLELGGKNPCIVDK...D.....T.....DIKL..
 577 IDLVIPYGRPELVQQVAR.....-LATSPVLRTSMGNCYLYWAS...G.....G.....ELET..
 578 VKAVSFVGSVAVGQYVYHtg...TAHNKRVQSFAGAKNHMVIMP...D.....A.....DKAQ..
 579 VKAVSFVGSVAVGQYVYHtg...TAHNKRVQSFAGAKNHMVIMP...D.....A.....DKAQ..
 580 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 581 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 582 VKAVSFVGSVAVGQYVYHtg...TAHNKRVQSFAGAKNHMVIMP...D.....A.....DKAQ..
 583 IHKLSFTGSTEVGRTLMAqc...APTIKKLSLELGGNAPFIVFD...D.....A.....DLEK..
 584 IHKLSFTGSTEVGRTLMAqc...APTIKKLSLELGGNAPFIVFD...D.....A.....DLEK..
 585 TAGVMFTGSTEVARLIQAql8spAGRPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 586 VDGISFVGSTPIAQYVHEta...TKHGKRVQALGGAKNHAIVMP...D.....A.....DLDN..
 587 IEKVSFTGGTTTGKKVMAsas..SSSLKEVTMELGGKSPLIICA...D.....A.....DLDK..
 588 VDGVIFTGSTETAKTINRnlqk.HSKIIPLIAETGGQNALIMDS...S.....A.....LGEQ..
 589 INFINFTGSTEVGQHISK.....ISGMVPLLLELGGKDAAIVLE...D.....A.....DLDF..
 590 FDHIFFTGSTRVGKIVMTaa...AKNLASVTLELGGKSPTIVDA...T.....A.....NLAE..
 591 WDYVFFTGSVPVGKIVSQqi...AKHMTPHTLELGGKNPCIVDA...S.....A.....NLDS..
 592 IDALTFTGESRTGSTIMKav...ADGVKEISFELGGKNAAVVFA...D.....C.....DFDK..
 593 VKKVSFTGGTEVGRGIARia...ADKLMPVSLELGGKSPTIVFE...D.....A.....DLDH..
 594 VKKVSFTGGTEVGRGIARia...AEKLMPVSLELGGKSPTIVCD...D.....A.....DLDH..
 595 IEKVSFTGGTTTGKKVMAsas..SSSLKEVTMELGGKSPLIICD...D.....A.....DLDK..
 596 VRGVMFTGSTQVARLLQTtl8dpQGRPIPLIAETGGLNAMLVDS...S.....A.....LTEQ..
 597 IDFINFTGSTEVGRRISE.....ITVMKPLLMELGGKDAAIVLE...D.....A.....DLDL..
 598 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 599 VKKVSFTGGTEVGRGIARia...AEKLMPVSLELGGKSPTIVCD...D.....A.....DLDH..
 600 VDRITFTGETGTGRTIAAaa...AAHLTPVSLELGGKGANLVFA...D.....A.....DLDS..
 601 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 602 LNLVIPYGRPSFVEQISQ.....-QCTPPVLKAAMGNCYLYWSS...K.....G.....DLEM..
 603 VNFINFTGSTDVGVRISK.....LTSMVPLLMELGGKDAAIVLE...D.....A.....DLEL..
 604 FDHIFYTGNTAVGKIIMEaa...AKHLTPVTLELGGKSPCYIDK...D.....C.....DLDI..
 605 VHKLSFTGSTEVGRTLMAqc...APTIKKLSLELGGNAPFIVFD...D.....A.....DLEK..
 606 WDKIFFTGSPKIGRIIMAaa...AQHLTPVTLELGGKCPTIVDHhtiS.....K.....NIKS..
 607 FDFIFYTGSRNGGREVMLaa...ARHMLPVALELGGKNPCIVEP...D.....A.....ALRT..
 608 VDKIAFTGSTQTAREIMKma...AGTLKDITLETGGKSPLLVFP...D.....A.....DMEQ..
 609 TAGVLFTGSTEVARLIQRql8saSGRPIPLVAETGGQNAMIVDS...S.....A.....LAEQ..
 610 VRRVMFTGSTEVATLLQRni8daQGRPIPLIAETGGMNAMIVDS...S.....A.....LTEQ..
 611 VDKILFIGSPGTGKRVMKaa...SDSLTPVILELGGKDPMIVFD...D.....V.....ELDW..
 612 IHGVMFTGSTQVARLLQLnl7lsKGRPVPLIAETGGLNAMIVDS...S.....A.....LTEQ..
 613 VAAISFVGSTPIAEYVYEra...SRTGKRVQALGGAKNHMVVLP...D.....A.....DLDL..
 614 VQAVGFVGSTPIAQYIYGra...AANGKRAQCFGGAKNHMLIMP...D.....A.....DLDK..
 615 VAVIAFTGSKKVGLDIIAqa8erAGHVKTVVAEMGGKNAIVVDA...D.....A.....DLDE..
 616 WDKIFYTGNGKVGRIVMAsa...AKHLTPVVLELGGKCPVVVDS...N.....V.....NLHV..
 617 IDLVIPRGSNKLVSQIKN.....-STKIPVLGHSDGICHVYVDK...A.....A.....NLEM..
 618 FDHIFYTGSSTVGKLVMEsa...ARHLTPVTLELGGKSPCYIDK...D.....C.....DIPV..
 619 TAAVMFTGSTEVARLIQRql8srAGRPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 620 IDKVAFTGSTEVGRLIAQaa...SGNLKKVSLELGGKSPVIVFG...D.....S.....DIEQ..
 621 FDVIFYTGSYAVGREVMAaa...AHHVTPLTLELGGKCPCLVEQ...T.....S.....NYQI..
 622 VDCVAFVGSHQTAERIVR.....SAGLRRTLIEASGNGPVIVCA...D.....A.....DLRR..
 623 VAGIVFTGSRDVGLDIQRksi..DNGPKVVITEMGGKDAIIVSN...K.....A.....DMDK..
 624 IKAVSFIGSTRVGTEIYNra...SAAGKRCQSMMGAKNHCVILP...D.....A.....DPEV..
 625 WDKIFFTGSARVGRIVMSaa...VEHLTPITLELGGKCPALVDSlstS.....W.....DREM..
 626 IKAVSFIGSTRVGTEIYNra...SAAGKRCQSMMGAKNHCVILP...D.....A.....DPEV..
 627 IGGVAFTGSTETAQKIRAtmaenLAPGAPLIAETGGLNAMIVDS...T.....A.....LPEQ..
 628 VNFINFTGSTPVGQRIGK.....LAGMRPIMLELGGKDAGIVLA...D.....A.....DLDN..
 629 VNFINFTGSTPVGQRIGK.....LAGMRPIMLELGGKDAGIVLA...D.....A.....DLDN..
 630 VAGVVFTGSTETAQIIARamaahLAPGTPLIAETGGLNAMVVDS...T.....A.....LPEQ..
 631 PKLISFTGSTEVGRHIAQla...ARELKETALELGGNNVMIVLD...D.....A.....DIEK..
 632 VNFINFTGSTPVGQRIGK.....LAGMRPIMLELGGKDAGIVLA...D.....A.....DLDN..
 633 VNFINFTGSTPVGKRIGK.....LAGMRPIMLELGGKDAGVVLA...D.....A.....DLDN..
 634 IKGVAFTGSLKTAKKIQSslasnHESIIPLIAETGGINSMIVDS...S.....A.....LLEQ..
 635 ADVISFTGSTAIGRQVAAta...GENLALPAMELGGNNVHIVTE...D.....A.....DLDD..
 636 VDVLSFTGSTRVGRMIAEsa...GRRLKKVSLELGGKNALVVCD...D.....A.....DLDL..
 637 VRRVNFTGSTHVGRIIAQha...AKHLKPALLELGGKAPVIVLD...D.....A.....DLDA..
 638 IDAVSFTGSVPTGRKVAAat...APNFVRCQLEMGSKNALVIAN...D.....A.....DLDI..
 639 VDGVVFTGSTETARVIQGamaehLAPGAPLIAETGGLNAMIVDS...T.....A.....LPEQ..
 640 VDFISFTGSPEVGTLIQIaa...AKNYVGCTLELGGKSPQIVFE...D.....A.....DLDA..
 641 IAAVLFTGSTEVGRLIQRql8saEGRPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 642 IKRISFTGSVPTARVIGKaa...AENIVPLTAELGGKSPLLVFA...D.....A.....DIDA..
 643 VRGVMFTGSTEVAHILQKtl8dsEGRPVPLIAETGGLNAMIVDS...S.....A.....LTEQ..
 644 VSGVVFTGSRDVGLRIFKnat..KYGPKPVITEMGGKDAVIISD...K.....A.....DLKK..
 645 VGMITLTGSVGAGRKVLEys...QVNIAKSSLELGGKSPAIVEA...D.....A.....DLEK..
 646 VRKITFTGSTEVGSQLMSda...AQHIQKISLELGGNAPFLVFE...D.....A.....DLDA..
 647 INGVAFTGSTATALKIRAsmathCAPGTPLIAETGGLNAMIVDS...T.....A.....LPEH..
 648 VSGLVFTGSTGTAQTIARtmaanLAPGTPLIAETGGLNAMVVDS...T.....A.....LPEQ..
 649 WGLIIFTGSPEKGKLVAKaa...SENLVPCILELGGKSPTVVDS...D.....A.....NLEN..
 650 IDFLFFTGNTKVGQILYEka...ASKMIPVILELSGTNPLIIDE...S.....A.....NLKI..
 651 VGGVAFTGSTETALKIRAamaknLRPGAPLIAETGGMNAMIVDS...T.....A.....LPEQ..
 652 VDCLAFTGSTGVGKQLMQyag..QSNLKKVFLECGGKSPNLVFA...D.....Ck....DLDR..
 653 VAGIAFTGSRDVGMRLYRlftqrQPWPKPIVLEMGSKNPTVVTA...K.....A.....DLEK..
 654 INGVAFTGSTATAMRIRSamaehCAPGTPLIAETGGLNAMIVDS...T.....A.....LPEQ..
 655 IKAISFVGGDAAGKHIHQrg...GANGKRVQANLGAKNHCVLMP...D.....A.....DKNF..
 656 VAGIVFTGSREVGLDIQRrsi..DNGPKVVITEMGGKDAIIVSN...K.....A.....DLNK..
 657 FDKMIFTGSTSVGKTVMAaa...SENLVPVILELGGKSPAIVHP...S.....M.....DMKE..
 658 WDKIMYTGNGAVGRIIAQaa...VKNLTPLALELGGKSPVFITS...N.....C.....KSVM..
 659 VRKISFTGSVEVGKHLASla...GRHMKRSTMELGGHAPVILFD...D.....A.....DIEA..
 660 VRAISFVGADQAGRHIHArg...TANGKRVQSNMAAKNHATIVP...D.....A.....HKER..
 661 FDHLFFTGSPAVGVHVQRaa...AANLVPVTLELGGKNPAVVGP...R.....A.....DLRR..
 662 IAGVVFTGSTEVARAINRtlaakDGPIVPLIAETGGINAMIVDA...T.....A.....LPEQ..
 663 PGLVSITGSVRAGIEVAKaa...AENLTRCHLELGGKAPCIVFD...D.....A.....DVDA..
 664 VAGVVFTGSTQVAKIINRalaakDGPIVPLIAETGGINAMLVDS...T.....A.....LPEQ..
 665 VSGVAFTGSTATAQKIRAamaanMRPGTPLIAETGGLNAMIVDS...T.....A.....LPEQ..
 666 ADYVCYTGSTPTGRIVAQaa...AKRLVGCSLELGGKNSMYVAA...D.....A.....DISR..
 667 TRAVMFTGSTEVARLINKtl8dpDGKPIPLIAETGGQNAMIVDS...S.....A.....LAEQ..
 668 TAGVCFTGSTPVAKHIQRalaakDGAIVPLIAETGGLNAMVVDS...S.....A.....LPEQ..
 669 VDLVIPCGRPGWVEFLLQ.....-ASKVPTLVTHLGYGHIYVDR...T.....A.....PWPL..
 670 FDFIFYTGSTRVGRIIAEaa...AKHITPTALELGGQAPAIVTK...S.....A.....DIEV..
 671 LKLLSFTGSPDVGWALKA.....KAGKKPVVLELGGNAACVVDE...D.....A.....DIED..
 672 FDHVFFTGSPAVGRQVMAaa...AAQLASVTLELGGKSPGIVDR...S.....A.....NLER..
 673 LDLVIPCGRPGWVEFLLQ.....-ASKVPTLATHLGYGHIYLDR...T.....A.....PWPL..
 674 VDTISFTGSSATGKAIMAaa...APTLKRVGLELGGKAPAVIFP...D.....A.....DLDK..
 675 VPVVSATGSVRMGQEVAKvl...SQRLARGILELGGNNGMIVAP...S.....A.....DLDL..
 676 VPVVSATGSVRMGQEVAKvl...SQRLARGILELGGNNGMIVAP...S.....A.....DLDL..
 677 IDLIIPRGSSQLVRDIQK.....AAKGIPVMGHSEGICHMYVDS...E.....A.....SVDK..
 678 VPLISFTGSQPTAERIIHls...APHCKKLSLELGGKNPAIIFE...D.....A.....NLEE..
 679 IKAINFTGGTAAANAIAK.....AAGFKKLLLELGGNDPLIIMP...D.....A.....DIDA..
 680 VPVVSATGSVRMGQEVAKvl...SQRLARGILELGGNNGMIVAP...S.....A.....DLDL..
 681 VPVVSATGSVRMGQEVAKvl...SQRLARGILELGGNNGMIVAP...S.....A.....DLDL..
 682 VRGVTLTGSGAAGKVVGEka...GKALKKTVLELGSNDAYLVLD...D.....A.....DVDT..
 683 IKFSILTGGEDTAYAMLK.....ANPTLLLSAETGGKNATIVSK...F.....A.....DRDS..
 684 IKFSILTGGEDTAYAMLK.....ANPTLLLSAETGGKNATIVSK...F.....A.....DRDS..
 685 IKFSILTGGEDTAYAMLK.....ANPTLLLSAETGGKNATIVSK...F.....A.....DRDS..
 686 IDLVVPRGSNKLVSQIKE.....-STKIPVLGHADGICHVYVDK...S.....A.....NFDM..
 687 LDVLIPRGGAGLIKAVVN.....-NATVPVIETGVGNCHIYIDD...E.....A.....DINM..
 688 IDLVVPRGSNKLVSQIKD.....-STKIPVLGHADGICHIYIDK...A.....A.....NINV..
 689 IKACVLTGGEETAYTMLR.....TNPTLWLSAETGGKNATIVTK...M.....A.....DRDQ..
 690 IKFSILTGGEDTAYAMLK.....ANPTLLLSAETGGKNATIVSK...F.....A.....DRDS..
 691 IDGLYFTGSSNTGHLLHKqfg..GRPDKILALEMGGNNPLLVTN...V.....A.....DVDA..
 692 VDVLIPRGGAKLIQTVKE.....-KSKIPVIETGVGNVHIYIDE...F.....A.....DLDM..
 693 LDVLIPRGGKQLIDTVVR.....-EASVPVLETGAGNCHIFIDE...T.....A.....DKQM..
 694 VQGVALTGSEGAGAVVAAqa...GKALKKSTLELGGADAFVVLA...D.....A.....DMQK..
 695 -DLIIPRGGEGLIRFVAE.....-NSRIPVLKHYKGVCHVFVDE...S.....A.....DLEM..
 696 IDLVVPRGSNKLVSQIKD.....-STKIPVLGHADGICHVYIDK...A.....A.....NINV..
 697 VDRVILTGGYETAELFRS.....FRKDLPLLAETSGKNAIIVTP...S.....A.....DLDL..
 698 IDLVIPRGSNQLVSQIKN.....-TTKIPVLGHADGICHVYVDK...A.....C.....NVDM..
 699 VKGVNFIGSVGGGLAVHAaa...AGTLTHVHLELGGKDPAYVRP...D.....A.....DIAT..
 700 FDHLFFTGSPAVGVHVQRaa...AANLVPVTLELGGKNPAVVGP...R.....A.....DLRR..
 701 VDRVILTGAWETAKLFRS.....WRHDLPVLAETSGKNSIIVTE...N.....A.....DYDL..
 702 ------------------.....---------HSEGICHVYVDT...D.....A.....SVEK..
 703 ------------------.....-----PVIETGVGNCTIFVDE...S.....A.....DLDM..
 704 VPLISFTGSQPTAERIMQls...APHCKKLSLELGGKNPAVIFE...D.....A.....NLAE..
 705 TNLILATGGEAMVRAAYS.....--SGTPAIGVGPGNGPAFIDK...S.....A.....NVKL..
 706 ------------VSQIKE.....-STKIPVLGHADGICHVYVDK...S.....A.....SLDM..
 707 TNLILATGGNAMVKAAYS.....--SGTPAIGVGPGNGPAYIER...S.....A.....NVPH..
 708 ------------------.....----IPVITGGIGVCHIYVDE...S.....A.....EIAE..
 709 VAMVIATGGGAMVKAAYS.....--SGHPALGVGPGNVPVYIEK...S.....A.....NLNI..
 710 TALILATGGEAMVKAAYS.....--SGTPAIGVGPGNGPAFIDK...S.....A.....NVKL..
 711 VDLALVYGRSRFVAEQRA.....-AARCPLVSLSLGNTYLVWDG...S.....V.....SPES..
 712 WDKIFFTGGARVARIIMAaa...ARNLTPVVLELGGKCPALVDS...D.....V.....NLQV..
 713 VDLAVVCGPPKLYQFASR.....-YSTIPLMRATGQFSSVYVDQ...S.....A.....SFEV..
 714 FDFIFYTGGTTIGREVYVaa...AKQLTPIVLELGGKCPVYIDS...D.....V.....SLDV..
 715 VDVILATGGGAMVRAAYS.....--SGNPAFGVGAGGCPVYVAA...D.....A.....DIDQ..
 716 IATILATGGNAMVEAAYS.....--CGKPALGVGAGNVPAYVEK...T.....A.....KLEQ..
 717 IASILATGGPGMVNAALK.....--SGNPSMGVGAGNGAIYVDA...T.....A.....HVDR..
 718 IAFILATGGPGMVRSAYQ.....--SGTPSIGVGKGNAPVWVCD...D.....A.....DVKT..
 719 TDVIVATGGTGVVRAAYS.....--SGTPALGVGPGNVPVLVDA...S.....A.....DITA..
 720 TDVIVATGGTGVVRAAYS.....--SGTPALGVGPGNVPVLVDA...S.....A.....DITA..
 721 ------------------.....---------------------...-.....-.....----..
 722 VSLIIATGGPGMVKAAYS.....--SGKPAIGVGAGNSPAYIER...T.....A.....NVEK..
 723 LSLAVARGSGRAVSQLGSia...QQAGTAVSLHGTGGAWLIADR...D.....A.....DAKR..
 724 TDVIVATGGTGVVRAAYS.....--SGNPALGVGPGNVPVFVDA...T.....A.....DVDA..
 725 VRIVDFTGSSANGNWLEQ.....NARQALVYTEKAGVNQVLIDS...T.....D.....DLKG..
 726 VRIVDFTGSSANGNWLEQ.....NARQALVYTEKAGVNQVLIDS...T.....D.....DLKG..
 727 VRIVDFTGSSANGNWLEQ.....NARQALVYTEKAGVNQVLIDS...T.....D.....DLKG..
 728 ------------------.....---------------------...-.....-.....----..
 729 ------------------.....---------------PIVVFD...D.....A.....DVKN..
 730 IDLVIPRGSNRLVSQIKA.....-QTKIPVLGHADGICHVYIDK...S.....A.....DMDM..
 731 ------------------.....---------------------...-.....-.....----..
 732 KRILIKIGSHTLTKETDNisrgkIEDMANQIAKLKDTCEFIIVS...S.....G.....AIAV..
 733 ------------------.....-----------DGISHVNIDK...S.....V.....EQDM..
 734 ------------------.....---------------------...-.....-.....----..
 735 ------------------.....---------------------...-.....-.....----..
 736 IDLLIPRGGRGLIRAVVD.....-NAKVPVIETGTGICHIYVNK...A.....A.....NLDE..
 737 ------------------.....---------------------...-.....-.....----..
 738 ------------------.....---------------------...-.....-.....----..
 739 ------------------.....---------------------...-.....-.....----..
 740 ------------------.....---------------------...-.....-.....----..
 741 ------------------.....---------------------...-.....-.....----..
 742 FDAVLFEGDSDELQTLVKdv...AQRPGP---------------...-.....-.....----..
 743 FDAVLFEGDSDELQTLVKdv...---------------------...-.....-.....----..
 744 FDAVLFEGDSDELQTLVKdv...A--------------------...-.....-.....----..
 745 FDIVLFHGDELQLKEVLEil...SKKRGPVI-------------...-.....-.....----..
 746 FDAVLFEGDSDELQTLVKdv...---------------------...-.....-.....----..
 747 ------------------.....---------------------...-.....-.....----..


                   240         250               260                270
                    |           |                 |                  |
   1 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
   2 ...AE..R.II.INAKC..QRPAVCNAME.....T.LLVHEKI..A.....P.V...FLPQIGKA
   3 ...AL..K.VA.VNAKT..QRYGTCNTME.....T.LLVDDEV..A.....E.D...LLPLLAEQ
   4 ...AQ..R.IV.INAKT..QRPGVCNAME.....T.LLVHEKV..A.....D.S...FLPSLAAA
   5 ...AI..R.VA.DNAKT..QRYAPCNTME.....T.LLVHAGI..A.....E.R...VLPPLATI
   6 ...AI..R.VA.DNAKT..QRYAPCNTME.....T.LLVHAGI..A.....E.R...ALPPLATI
   7 ...AT..R.VA.FNAKT..HRYGVCNAME.....T.LLIADSR..A.....A.E...ILPGLVEL
   8 ...AF..N.IA.LNAKT..HRYGTCNTME.....T.LLVHTAF..A.....E.F...MLPRLAEA
   9 ...AT..R.VA.FNAKT..HRYGVCNAME.....T.LLIADSR..A.....A.E...ILPGLVEL
  10 ...AV..A.IA.VNAKC..QRYGVCNAME.....T.LLVAREI..A.....A.E...ILPMMGEH
  11 ...AL..D.IV.FNAKT..SRPAVCNAAE.....S.LLVHRQV..A.....D.E...FLPELYKL
  12 ...AI..R.VA.DNAKT..QRYAPCNTME.....T.LLVHAGI..A.....E.R...VLPPLAAI
  13 ...AI..R.VA.DNAKT..QRFAPCNTME.....T.LLVHAAI..A.....A.R...ALPPLGEI
  14 ...AE..K.II.VNGKV..QRPGVCNALE.....T.LLVHKDI..A.....E.T...FIPRIAET
  15 ...AE..R.II.INAKT..QRPGVCNALE.....T.LLIHESV..A.....A.A...FIPRIASI
  16 ...AI..R.IA.DNAKT..QRYAPCNTME.....T.LLVHSAI..A.....E.R...VLPPLAAI
  17 ...AE..N.IV.INAKT..HRPGVCNAME.....T.LLVHQDV..A.....R.K...FLPHVGKR
  18 ...AI..R.IA.DNAKT..QRYAPCNTME.....T.LLVHSAI..A.....E.R...VLPPLAAI
  19 ...GV..D.II.VNAKT..SRPAVCNAAE.....K.LLVNEKI..A.....E.E...FLPVAIKA
  20 ...AQ..D.II.VNAKT..QRPGVCNALE.....T.LLVHKDV..A.....N.S...FLPEIVSE
  21 ...AL..A.IA.LNAKT..HRYGVCNAME.....S.LLVAESV..A.....K.T...VLPELAAL
  22 ...AR..R.IA.INAKT..QRYGVCNAME.....T.LLVAAGI..A.....P.A...VLPDLAAL
  23 ...AA..K.IC.LNAKI..QRPGVCNAME.....T.LLVHREA..A.....P.R...FLPELARK
  24 ...AL..K.II.VNAKT..QRPSTCNTVE.....T.LLVHQDI..A.....E.R...FLPALSKQ
  25 ...AK..D.II.VNAKV..QRPGVCNAVE.....T.VLVHKSI..A.....K.E...FLPLMVEE
  26 ...AL..K.II.VNAKT..QRPSTCNTVE.....T.LLVHQDI..A.....E.R...FLPALSKQ
  27 ...AK..N.IV.INAKA..SRPSVCNAAE.....K.LLINEKI..V.....E.D...FLPIVVKA
  28 ...AL..K.II.VNAKT..QRPSTCNTVE.....T.LLVHQDI..A.....E.R...FLPVLSKQ
  29 ...AF..N.IV.INSKT..HRYGVCNAME.....T.MLVDEAI..A.....A.D...FLPRAAKE
  30 ...AL..T.IA.VNSKT..QRYGTCNTME.....T.LLVDAPV..A.....A.T...ILPQLAQA
  31 ...AE..K.IC.VNAKV..QRPGVCNAME.....T.LLIHKDA..A.....E.V...FVPRIARV
  32 ...AW..N.VA.FNAKT..YRYGICGAME.....T.LLVDQQV..A.....E.R...FLPEMARR
  33 ...AI..K.IA.VNAKT..RRYGVCNAME.....S.LLVHKEV..A.....Q.S...VLPQLADI
  34 ...AL..P.IA.LNAKT..HRYGVCNAME.....T.LLVHEEI..A.....E.E...FLPRIAEL
  35 ...AI..R.IV.VDSKT..QYVAVCNATE.....T.LLVHKNI..A.....P.K...VLPELKRA
  36 ...AV..K.IA.VDAKT..QYVAVCNAVE.....T.LLVHEKI..A.....P.A...FLPELKKA
  37 ...VV..P.IV.ENAKT..QRYGTCNTAE.....S.LLVAREV..A.....P.R...LLPEIGRM
  38 ...AW..N.VA.FNAKT..YRYGICGAME.....T.LLVDQQV..A.....E.R...FLPEMARR
  39 ...AT..E.II.VNAKC..QRPSVCNAAE.....T.LLIHQEV..A.....E.A...FLPTIEKA
  40 ...AV..R.VA.DNAKT..QRYGTCNTME.....T.LLVHAGI..A.....E.R...FLPRICKI
  41 ...AW..R.VA.FNAKT..YRYGICGAME.....T.LLVDQRV..A.....E.R...FLPEMARR
  42 ...AV..A.IA.DNAKT..QRYSPCNTME.....T.LLVHVDA..A.....P.R...VLPELARL
  43 ...AK..D.II.VNAKV..QRPGVCNAVE.....T.VLVHKGI..A.....E.R...FLPVMVKE
  44 ...AQ..K.IA.FNAKT..YRYGICGAME.....T.LLVDQTI..A.....A.D...FLPAMAAQ
  45 ...AQ..R.IA.FNAKT..YRYGICGAME.....T.LLVDQRV..A.....K.D...FLPSMAKQ
  46 ...AI..R.VA.DNAKT..QRYGTCNTLE.....T.LLVHENI..A.....G.E...VLPPLCRI
  47 ...AE..R.II.INAKL..QRPAVCNAME.....S.LLVHKDV..A.....H.E...FLPRISSK
  48 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  49 ...AQ..K.IA.FNAKT..YRYGICGAME.....T.LLVDQTI..A.....A.D...FLPSMAAQ
  50 ...AL..T.VI.TNAKV..QRPSACNALE.....T.LLVHQKI..A.....A.D...FLPALSKY
  51 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  52 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPVLSKQ
  53 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  54 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  55 ...AL..K.IV.LNSKT..QRCSVCNASE.....T.LLVHAGI..A.....D.A...FLPRALAE
  56 ...AL..A.IA.ENAKT..RRYGVCNAME.....T.LLVDSLV..A.....D.V...LLPSLQSI
  57 ...VL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  58 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  59 ...AE..K.IV.INAKT..QRPGVCNAAE.....K.LLVHKNI..A.....E.S...FLPMIVKK
  60 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVARGI..A.....A.E...VLPPLGKL
  61 ...AL..K.II.VNAKT..QRPSTCNTVE.....T.LLVHQDI..A.....E.R...FLPALSKQ
  62 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  63 ...AH..D.IA.FNAKT..YRYGVCGAME.....T.LLVHADV..A.....Q.R...LLPVLGQA
  64 ...AV..N.II.VNAKA..SRPSVCNAAE.....T.LLIHSEI..A.....P.F...FLPAIEKE
  65 ...AT..E.IC.LNAKV..QRPGVCNAME.....T.LLIHKDI..A.....E.T...FVPHIARA
  66 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  67 ...AQ..K.IV.FNAKV..QRPSVCNAAE.....T.LLVNAKI..A.....G.D...FLPAMIAE
  68 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....Y.S...FLPALSKQ
  69 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
  70 ...AQ..K.IA.FNAKT..YRYGICGAME.....T.LLVDQTI..A.....A.D...FLPAMAAQ
  71 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVSSGV..A.....A.K...LLPPLGKL
  72 ...AH..D.IA.FNAKT..YRYGVCGAME.....T.LLVHADV..A.....Q.R...LLPVLGQA
  73 ...AV..P.VI.INAKT..QRPGTCNAAE.....K.LLVHEKI..A.....K.E...FLPVIVEE
  74 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVASGI..A.....A.T...LLPPLGKL
  75 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVSSGV..A.....A.K...LLPPLGKL
  76 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVASGI..A.....A.K...LLPPLGKL
  77 ...AL..R.IL.ENSKT..QRLGTCNTAE.....S.LLVARSI..A.....Q.E...ALPPLTAM
  78 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVSSGI..A.....A.A...LLPPLGKL
  79 ...AL..T.VI.ENAKI..QRPSACNSLE.....T.LLVNRSI..A.....A.E...FLPALSAK
  80 ...AV..K.IV.ENAKT..QRYGTCNTTE.....S.LLVARAV..A.....A.A...ALPQIGAM
  81 ...AT..N.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
  82 ...AH..D.IA.FNAKT..YRYGVCGAME.....T.LLVHADV..A.....Q.R...LLPALGQA
  83 ...AL..K.IV.LNSKT..QRCSVCNASE.....T.LLVHAGI..A.....D.A...FLPRALAE
  84 ...AI..S.VA.YNAKT..QRLGTCNTME.....T.LLVAEAI..A.....E.R...VLPELARR
  85 ...AV..P.VI.INAKT..QRPGTCNAAE.....K.LLVHEKI..A.....K.E...FLPVIVEE
  86 ...AL..A.IA.VNAKT..HRYGTCNTME.....T.LLVHAEE..A.....P.A...LLPLLAAA
  87 ...AI..N.VS.VNAKT..HRYGTCNTME.....T.LLVDEAI..A.....D.E...LLPKIAEA
  88 ...AV..K.IV.ENAKT..QRYGTCNTTE.....S.LLVARAV..A.....A.A...ALPQIGAM
  89 ...AE..R.IV.VNAKV..QRPGVCNALE.....T.LLIHKDV..A.....E.A...FIPRIAAT
  90 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
  91 ...AT..K.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
  92 ...AY..H.IV.YNAKV..QRPSVCNAVE.....N.LVINRKI..L.....K.E...FFPKMAYY
  93 ...AY..H.IV.YNAKV..QRPSVCNAVE.....N.LVINRKI..L.....K.E...FFPKMAYY
  94 ...AT..K.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
  95 ...AT..K.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
  96 ...AV..R.VT.DNAKT..QKYSPCNAAE.....S.LLVHRDV..A.....A.A...FLPRIGAV
  97 ...AI..D.IT.FNGKM..QRTGVCNATE.....T.LLIHEKV..A.....K.T...ILPALAKR
  98 ...AA..R.IA.YNAKT..QRYGTCNTME.....S.LLIAEAI..A.....P.Q...LLPRLIDL
  99 ...AV..A.IA.VNAKT..QRLGTCNTME.....T.LLVAEAA..A.....E.R...VLPEVGRQ
 100 ...AT..N.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
 101 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVARGI..A.....P.A...VLSPLGRL
 102 ...SI..G.IA.DNSKT..QRYGTCNTME.....T.LLVHEKI..A.....R.E...VLPPLCKI
 103 ...AT..K.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
 104 ...AE..E.VC.FNAKV..QRPATCNAME.....T.MLVHENI..A.....P.V...FLPKIAKR
 105 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 106 ...AV..R.VC.DNAKT..QRYAPCNTME.....T.LLVSQDI..A.....A.R...ALPPLCRI
 107 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 108 ...AV..N.IA.YNSKV..QRPTVCNAMD.....T.LLVHKDI..A.....P.V...FLPAVAAE
 109 ...AI..N.VA.LNAKT..HRYGTCNTME.....T.LLVNAGI..A.....A.E...VLPELAER
 110 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 111 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 112 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 113 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 114 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 115 ...AL..E.IL.LNAKC..QRYGVCNAAE.....S.LLVHEGI..A.....A.N...WLPGAVQE
 116 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 117 ...AV..E.IT.TNAKV..QRPSVCNAIE.....N.LVIHQDV..A.....Q.E...YLPAIADE
 118 ...AL..A.VC.DNAKT..HRYGTCNTME.....T.LLVARGI..A.....P.A...VLTPLGRL
 119 ...AL..D.VI.ANAKV..QRPTVCNALD.....T.LLVDERV..A.....S.T...FVPQVAEY
 120 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 121 ...GV..N.IA.INAKT..HRYGTCNTME.....T.LLVNEAI..A.....E.K...ILPQLDAA
 122 ...AL..L.VI.ENAKI..QRPSACNSLE.....T.LLVHQAI..A.....E.R...FLPVLSTR
 123 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 124 ...AV..R.IC.DNAKT..QRYAPCNTME.....T.LLVARDV..A.....A.R...ALPPLVKI
 125 ...AL..D.VI.ANAKV..QRPTVCNALD.....T.LLVDERV..A.....S.S...FVPQVAEY
 126 ...AL..E.VI.ANAKV..QRPTVCNALD.....T.LLVDNAV..A.....E.R...FVPQIAEY
 127 ...AI..K.VS.VNAKT..HRYGTCNTME.....T.LLVDQAI..A.....N.E...LLPQIAEA
 128 ...AA..K.IV.INAKT..QRPSVCNAAE.....G.LVVHQAI..A.....K.G...FLSQLEKM
 129 ...AV..R.VA.DNAKT..QRYGTCNTME.....T.LLVHTGI..A.....E.Q...FLPRICQI
 130 ...AL..A.VC.DNAKT..HRYGTCNTME.....T.LLVARGI..A.....P.A...VLTPLGRL
 131 ...AL..L.VI.ENAKI..QRPSACNSLE.....T.LLVHQAI..A.....E.R...FLPVLSAR
 132 ...AV..R.VC.DNAKT..QRYAPCNTME.....T.LLVSREI..A.....A.K...ALPPLCRI
 133 ...AL..L.VI.ENAKI..QRPSACNSLE.....T.LLVHQAI..A.....E.S...FLPVLSAR
 134 ...AT..Q.IV.INAKT..QRPSVCNAAE.....S.LVVHADI..V.....E.E...FLPNLEKA
 135 ...AL..E.VI.ANAKV..QRPTVCNALD.....T.LLVDNAV..A.....E.R...FVPQIAEY
 136 ...AL..A.VC.DNAKT..HRYGTCNTME.....T.LLVARGI..A.....P.A...VLTPLGRL
 137 ...AV..N.IA.YNSKV..QRPTVCNAMD.....T.LLVHKDI..A.....P.V...FLPAVAAE
 138 ...AL..L.VI.ENAKV..QRPSACNSLE.....T.LLVHQAI..A.....A.S...FLPILSAR
 139 ...AA..K.IV.INAKT..QRPSVCNAAE.....G.LVVHQAI..A.....K.G...FLSQLEKM
 140 ...AT..Q.IV.INAKT..QRPSVCNAAE.....S.LVVHADI..V.....E.E...FLPNLEKA
 141 ...AT..Q.IV.INAKT..QRPSVCNAAE.....S.LVVHADI..V.....E.E...FLPNLEKA
 142 ...AL..E.VI.ANAKV..QRPTVCNALD.....T.LLVDTAV..A.....E.R...FVPQIAEY
 143 ...AL..A.IL.LNGKT..QRTGVCNALE.....G.LLVHQDI..A.....D.K...FLPMAAKA
 144 ...AV..N.IA.YNSKV..QRPTVCNAMD.....T.LLVHKDI..A.....A.A...FLPVVAAE
 145 ...AI..D.IL.VNAKC..SRPSVCNAAE.....T.LLIHRDV..A.....D.A...FLPEIETA
 146 ...AL..P.VI.ENAKI..QRPSACNSLE.....T.LLVHQAI..A.....E.R...FLPRLSHH
 147 ...AL..T.VI.ESAKV..QRPSACNSLE.....T.LLVNRSI..A.....D.R...FLPELSKK
 148 ...AL..P.LI.ENAKT..QRPSTCNTLE.....T.LLVQRAI..A.....T.Q...FLPKLAQH
 149 ...AL..A.VI.ANAKV..QRPTVCNALD.....T.LLVDERV..A.....S.T...FVPQIAEY
 150 ...AL..K.IV.ENAKT..QRYGTCNTAE.....S.LLVDRSV..A.....A.M...LLPPIAAM
 151 ...AI..D.IL.VNAKC..SRPSVCNAAE.....T.LLIHRDV..A.....E.A...FLPEMETA
 152 ...AI..D.IL.VNAKC..SRPSVCNAAE.....T.LLIHRDV..A.....D.A...FLPEMETA
 153 ...AI..K.VS.VNAKT..HRYGTCNTME.....T.LLVDEAI..A.....N.E...LLPKIAEA
 154 ...AL..L.VI.ENAKI..QRPSACNSLE.....T.LLVHQAV..A.....K.T...FLPLLSAR
 155 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 156 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 157 ...AV..R.IC.DNAKT..QRYAPCNTME.....T.LLVAREV..A.....A.R...ALTPLARI
 158 ...AI..K.VS.VNAKT..HRYGTCNTME.....T.LLVDEAI..A.....N.E...LLPKIAEA
 159 ...AM..S.IT.VNSKC..HRYGVCNAAE.....S.LVVHQDV..A.....D.Q...FLPAIGAA
 160 ...AF..D.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....E.Q...YGSELFSS
 161 ...AV..D.II.ENAKC..QRMGVCNACE.....S.LLIHQSI..A.....A.D...ALPAIAKR
 162 ...AM..E.VV.LNAKT..RRTGICGAAE.....C.LLIHRDI..A.....D.T...LGRDLIEM
 163 ...AK..A.IV.VNAKL..RRTGVCGAAE.....T.ILIDKAR..A.....D.E...LVPEIAGA
 164 ...AV..D.IL.INSKA..QRPSVCNSAE.....T.LLVHQDI..A.....A.E...FLPRALDA
 165 ...AI..D.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....Q.Q...HGSELFSS
 166 ...AL..L.VI.ENAKI..QRPSACNSLE.....T.LLVHQAV..A.....K.T...FLPLLSAR
 167 ...AL..A.IL.LNGKT..QRTGVCNALE.....G.LLVHQDV..A.....D.K...FLPMAAKA
 168 ...AL..R.VV.MNAKT..RRTGICGAAE.....C.LLIHKDI..A.....D.N...LGADLVRA
 169 ...AV..A.IV.VNAKV..QRPSVCNAAE.....K.LLIHADV..A.....N.E...QLPVIAKA
 170 ...AF..D.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....E.Q...YGSELFSS
 171 ...TM..D.VV.INAKT..RRTGICGAAE.....C.LLVHKDA..L.....D.-...LGQTVIDA
 172 ...AA..A.IV.SNGKI..QRPGVCNALE.....T.LLVHRQV..A.....A.E...FIPAVAGQ
 173 ...AV..R.VA.DNAKT..QKYSPCNASE.....G.LLVARGV..A.....A.G...FLPKIGAV
 174 ...AT..R.IV.INAKT..QRPSVCNAAE.....S.LVVHAKI..A.....D.E...FLPKLQNE
 175 ...AT..D.IV.INGKV..QRPSVCNATE.....K.LLIHREV..A.....A.D...YLPSMIQA
 176 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVASGI..A.....A.K...VLPPLGKL
 177 ...AV..K.IA.DNAKT..QKYSPCNATE.....G.LLVARGV..A.....D.A...FLPQIAAI
 178 ...VA..P.IV.INAKT..QRPGVCNALE.....G.ILIHEDI..V.....A.D...VLPGLATE
 179 ...AL..T.VC.DNAKT..HRYGTCNTME.....T.LLVASGI..A.....A.K...LLPRLGKL
 180 ...AA..K.IV.INAKT..QRPSVCNAAE.....G.LVVHQAI..A.....K.G...FLSQLEKM
 181 ...SL..A.VI.ENAKT..QRPSTCNTVE.....T.LLVQESI..A.....E.E...FLPKLARR
 182 ...AV..K.IA.VNAKM..RRTGVCGAAE.....T.LLVDRAV..A.....S.T...HLVPILDA
 183 ...AL..E.VI.ANAKV..QRPTVCNALD.....T.LLVDKTI..A.....A.N...FVPQIVEY
 184 ...AI..F.VI.DNAKT..QRPSTCNTLE.....T.LLVQHSI..A.....E.E...FLPKLVSH
 185 ...AI..F.VI.DNAKT..QRPSTCNTLE.....T.LLVQHSI..A.....E.E...FLPKLVSH
 186 ...AI..P.IL.INAKT..QRVGVCNATE.....K.LLVHKDI..A.....E.S...FLPKAAAA
 187 ...AR..R.IV.INAKV..QRPSVCNAAE.....K.LLVHRDT..V.....V.T...HLAPLLED
 188 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 189 ...AV..D.II.ENAKV..QRPGVCNACE.....T.VLIHEKI..A.....K.D...LLPKVSGR
 190 ...AK..T.VV.LNAKM..RRTGVCGAAE.....T.LLVDQAV..A.....A.T...HLKPLVEM
 191 ...AE..D.LL.LDGKV..SRPSVCNALE.....T.LLVHADV..A.....D.D...FLPRARAL
 192 ...AF..D.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....E.Q...YGSELFSS
 193 ...GV..S.IV.FNAKT..QKPGVCNALE.....A.VLVNEAV..A.....Q.E...FLPLLGEK
 194 ...AI..D.VV.LNAKT..RRTGICGAAE.....C.LLIHEDI..A.....D.S...IGKDVLDL
 195 ...AI..D.VM.INAKT..DRPAVCNALE.....T.LIVHEKW..L.....E.E...NSAALINA
 196 ...AS..K.IV.VNAKT..QRPSVCNAAE.....G.LLVHEKV..A.....S.D...FLPKLEAA
 197 ...AK..T.IV.LNAKM..RRTGICGATE.....T.LLVDRAC..A.....G.T...HLAPLVAM
 198 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 199 ...AI..F.VI.DNAKT..QRPSTCNTLE.....T.LLVQHSI..A.....E.E...FLPKLVSH
 200 ...AF..N.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....Q.Q...FGSELFSS
 201 ...AT..N.IT.VNAKV..QRPSVCNAAE.....K.LLIHRDI..A.....A.K...FLPVIAKA
 202 ...AR..R.IA.LDAKM..RRTGICGAAE.....T.LLVDRAV..A.....S.T...HLAPILGD
 203 ...AK..A.VV.LNAKM..RRTGICGATE.....T.LLVDAAC..A.....K.T...HLAPLVAM
 204 ...AR..R.VV.LNAKT..RRTGICGAAE.....C.LLIDRAF..L.....A.K...HGPVLIED
 205 ...AI..F.VI.DNAKT..QRPSTCNTLE.....T.LLVQHSI..A.....E.E...FLPKLVSH
 206 ...AR..R.IA.LDAKM..RRTGICGAAE.....T.LLVDRAV..A.....S.T...HLAPILGD
 207 ...AL..R.VV.LNAKT..RRTGICGSAE.....C.LLIHQDI..A.....D.T...IGQGVVRA
 208 ...AI..A.VI.RNAKV..QRPSVCNALD.....T.VLIHQSI..A.....Y.E...FINRLVPA
 209 ...AL..A.IT.VNAKT..QRVSVCNSAE.....T.LLVHAGV..A.....G.E...FLPRVLAA
 210 ...AR..R.IA.LDAKM..RRTGICGAAE.....T.LLVDRAV..A.....S.T...HLAPILGD
 211 ...AR..R.VV.LNAKT..RRTGICGSAE.....C.LLIDRAF..L.....A.K...HGPVLIED
 212 ...AE..Q.VV.INAKT..QRPSVCNAIE.....T.VLIHKGW..A.....E.E...HTKALLQK
 213 ...AR..R.IA.LDAKM..RRTGICGAAE.....T.LLVDRAV..A.....S.T...HLAPILGD
 214 ...AL..A.IT.INAKT..HRPSVCNAAE.....K.LLVHASL..V.....E.E...FLPKVLAE
 215 ...AR..R.VV.LNAKT..RRTGICGAAE.....C.LLIDWQF..Y.....T.K...HGPVLVQD
 216 ...AV..Q.IA.LNGKT..QRPSTCNSLE.....K.VLVHQRI..A.....P.V...FLPMLAQA
 217 ...AR..R.VV.LNAKT..RRTGICGSAE.....C.LLIDRAF..L.....A.K...HGPVLIED
 218 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
 219 ...VL..K.VV.LNAKT..RRTGICGSAE.....C.LLIHEKV..A.....R.T...IGKGVIKA
 220 ...AE..R.VL.LNSKT..RRPSVCNAAE.....T.LLVDAAI..A.....E.E...ALPRLVTA
 221 ...AL..E.LI.ANAKT..QRPSTCNTLE.....T.LLVEKAI..A.....G.E...FLPKLANR
 222 ...AV..E.II.HNAKV..QRPGVCNALE.....G.LLVHRDE..A.....A.A...FLPAIAER
 223 ...SV..D.VV.ENAKA..QRPSACNALD.....T.LLVHERI..A.....E.Q...FLPMLVAK
 224 ...AL..S.VT.VNAKM..RRTGVCGSTE.....T.ILVDRAI..A.....A.T...ILPPLLDA
 225 ...AT..N.IT.VNAKV..QRPSVCNAAE.....K.LLIHRDI..A.....A.E...FLPVIAKA
 226 ...VL..K.VV.LNAKT..RRTGICGSAE.....C.LLIHEKV..A.....R.T...IGKGVIKA
 227 ...AK..K.IV.VNAKM..RRTGICGAAE.....T.LLIDRNA..A.....E.K...FAKPLLEA
 228 ...GV..S.IV.FNAKT..QKPGVCNALE.....A.VLVNEAV..A.....Q.E...FLPLLGEK
 229 ...SV..D.VV.ENAKA..QRPSACNALD.....T.LLVHERI..A.....E.Q...FLPMLVAK
 230 ...AV..P.IT.VDAKA..QYPAVCNAIE.....T.LLVHQSI..A.....T.E...FLPKVADA
 231 ...AI..A.VS.VDAKV..QYPAACNAIE.....T.LLVHHSI..A.....A.E...FLPKVAQA
 232 ...VT..R.IV.RDSKC..EYPAACNAME.....T.LLIHRDI..L.....R.T...PLFDQIID
 233 ...AL..E.VV.LNAKT..RRTGICGAAE.....C.LLIHRDI..V.....D.T...IGRDVLTA
 234 ...SL..N.VV.ENSKV..QRPSACNSLD.....T.LLVHEKI..A.....A.Q...FLPMIVER
 235 ...AV..D.IL.INSKA..QRVGVCNAAE.....T.LLVHQDV..A.....A.E...FLPRALAA
 236 ...AI..D.IL.VNAKC..SRPSVCNAAE.....T.LLIHRDV..A.....E.D...YLPAMETA
 237 ...AI..A.VS.VDAKV..QYPAACNAIE.....T.LLVHHSI..A.....A.E...FLPKVAQA
 238 ...AI..P.IT.VDAKT..QYPAACNAIE.....T.LLVHQAI..A.....A.E...FLPPLAQA
 239 ...AV..K.VA.DNAKT..NKYSPCNATE.....S.LLVARAV..A.....A.E...FLPSIGRV
 240 ...AI..D.IL.VNAKC..SRPSVCNAAE.....T.LLIHRDV..A.....E.D...YLPAMETA
 241 ...AR..D.VV.INAKT..QRPSVCNAIE.....S.LLIHEKW..A.....E.V...HGRKLLNQ
 242 ...SI..D.VV.ENAKA..QRPSACNALD.....T.LLVSEKV..A.....E.T...FLPRLAER
 243 ...AV..A.LA.LNAKM..RRTGVCGAAE.....T.LLVDRAV..A.....G.T...HLVPILEA
 244 ...AA..A.II.KNAKL..RRTGICGATE.....S.LVVDRKV..A.....K.D...FLPMAMDA
 245 ...VE..K.VV.VNAKM..RRTGICGATE.....S.LLIDRGY..P.....V.E...KVKSLLQA
 246 ...AM..R.IC.MNAKV..QRPGVCNAME.....T.LLVHAGI..A.....Q.R...FLPPMAEA
 247 ...AI..A.VS.VDAKV..QYPAACNAIE.....T.LLVHQSI..A.....A.E...FLPKVAQA
 248 ...AV..K.IT.IDAKT..QYPAACNAAE.....T.LLVHTDV..A.....A.K...FLSEVFPE
 249 ...AL..N.LL.LNGKT..QRTGVCNALE.....G.LIVHRDI..M.....A.Q...FLPLVSYA
 250 ...AI..R.LL.IDGKT..TRPAACNALE.....T.LLVHTDI..A.....P.R...FLPAAAAA
 251 ...AI..A.VA.VDAKT..QYPAACNAIE.....T.LLIHQDI..A.....R.E...FLPKIAQG
 252 ...AI..E.VI.ANAKV..QRPTVCNALD.....T.LLIHQQV..A.....A.E...FIPKIASH
 253 ...VT..R.IV.RDSKC..EYPAACNAME.....T.LLIHRDI..L.....R.T...PLFDQIID
 254 ...AI..S.VI.KNAKT..QRPSTCNTLE.....T.LLIQESI..A.....H.E...FLPKLAAE
 255 ...AI..E.IV.LNAKL..QRPSVCNAVE.....T.VLIHERWpyA.....A.D...LLETLHAR
 256 ...AI..R.LL.IDGKT..TRPAACNALE.....T.LLVHTDI..A.....P.R...FLPAAAAA
 257 ...AL..D.LL.LNGKT..QRTGVCNALE.....A.LLVHQEI..A.....S.Q...FLPKVAKA
 258 ...AE..Q.IL.INAKT..RRPSVCNAAE.....T.VLIDRAV..A.....D.T...AVPRLTAA
 259 ...AY..D.VC.FDSKV..QYPAVCNAME.....T.LLINREI..A.....E.E...FLPEMVRR
 260 ...AK..S.IV.LNAKM..RRTGVCGAAE.....T.LLIDRAA..A.....D.T...HLAPLVGM
 261 ...AV..A.IA.VNAKT..QRPSVCNAAE.....T.ILVHSAW..A.....K.E...HVSKLIEE
 262 ...AK..S.IV.LNAKM..RRTGVCGAAE.....T.LLVDRAA..A.....A.T...SLKPLVEM
 263 ...AI..R.LL.IDGKT..TRPAACNALE.....T.LLVHTDI..A.....P.R...FLPAAAAA
 264 ...SV..A.VI.ENAKV..QRPSACNALD.....T.LLVHQAI..A.....K.P...LLDKLIAK
 265 ...SI..D.VV.ENAKA..QRPSACNALD.....T.LLVSEKV..A.....E.T...FLPRLAER
 266 ...SV..A.VI.ENAKV..QRPSACNALD.....T.LLVHQAI..A.....K.P...LLDKLIAK
 267 ...SV..A.VI.ENAKV..QRPSACNALD.....T.LLVHQAI..A.....K.P...LLDKLIAK
 268 ...AM..S.LL.LNGKT..QRTGVCNALE.....G.LLVHQDV..A.....A.E...FLPKVAAQ
 269 ...AF..D.II.-NAKT..QRPSVCNAIE.....T.IVLHEKW..A.....E.Q...YGSELFSS
 270 ...AK..A.IV.LNAKM..RRPGVCGAAE.....T.LLVDRAG..A.....P.N...TLKPLVDM
 271 ...AF..D.II.-NAKT..QRPSVCNAIE.....T.IVLHEKW..A.....E.Q...YGSELFSS
 272 ...AE..R.IL.LNSKT..RRPSVCNAAE.....T.LLVDAAI..A.....E.T...ALPRLLAA
 273 ...AK..A.IV.VNAKM..RRTGICGAAE.....T.LLVDASA..V.....S.S...HLEPVVKA
 274 ...AK..A.IV.VNAKM..RRTGICGAAE.....T.LLVDASA..V.....S.S...HLEPVVKA
 275 ...AE..R.IV.VNAKT..RRTGICGAAE.....C.LLIDWRY..Y.....T.E...HGPRLIEA
 276 ...AR..E.IV.LNAKC..SNPAVCNAAE.....T.LLVDREV..A.....A.P...FLAEAGPA
 277 ...AL..N.LL.KNGKT..QRTGVCNSLE.....T.LLVHQDI..A.....P.T...FMPKVKAL
 278 ...SL..D.VV.ENAKV..QRPSACNALD.....T.LLVNEKV..A.....E.A...FLSRLVER
 279 ...AM..A.LL.LNGKT..QRTGVCNALE.....G.LIVHQDV..A.....E.A...FLSKAAVE
 280 ...AL..K.VA.LDSKI..QYPAACNAVE.....T.LLIHKDT..A.....S.E...FLNKAIPM
 281 ...AV..E.IV.LNAKT..RRTGICGAME.....C.LLIDWRF..Y.....T.Q...HGPILTDA
 282 ...TV..T.IT.VDAKT..QYPAACNAIE.....T.LLIHEAI..A.....P.Q...FLPVVAAA
 283 ...AC..E.II.FNAKV..QRPGVCNALE.....G.LLVHRSE..A.....H.T...LLPAVAQK
 284 ...AD..R.IV.INAKT..QRPSVCNAAE.....K.LLVHRAI..A.....K.E...YVPRIVKL
 285 ...AK..A.VV.LNSKM..RRPGVCGAAE.....T.LLVDRSG..V.....R.D...ILKPLVEA
 286 ...SL..N.VV.ENSKV..QRPSACNSLD.....T.LLVHEKI..A.....A.Q...FLPMIVER
 287 ...AK..A.VV.LNSKM..RRPGVCGAAE.....T.LLVDRSG..V.....R.D...ILKPLVEA
 288 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 289 ...AL..A.LL.LNGKT..QRTGVCNALE.....G.LLVHSEV..A.....P.K...FLAMAATA
 290 ...AA..N.VI.INAKV..QRPTVCNALD.....T.LLIHRDK..L.....D.-...WLPTLARA
 291 ...AE..R.IL.LNSKT..RRPSVCNAAE.....T.LLIDAAI..A.....D.H...TMPRLVAA
 292 ...AE..K.LV.VNAKM..RRTGICGSTE.....T.VLIDRAYreA.....P.A...LVRALIGA
 293 ...AI..E.VI.ANAKV..QRPTVCNALD.....T.VLVHQSI..A.....Q.T...FLPKLYAH
 294 ...AT..E.IV.LNAKL..QRPSVCNAIE.....S.LIIHRQW..F.....E.D...HGLELLKT
 295 ...AR..N.IV.LNAKL..RRTGICGAVE.....T.VLIDRQA..L.....K.K...FLPVLT-A
 296 ...AL..P.IV.INAKT..QRPSVCNAIE.....T.LLVDETI..H.....E.R...FLLELRPL
 297 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 298 ...AK..K.IV.VNAKM..RRTGICGAAE.....T.LLVDGAA..I.....D.T...HLTPLLEV
 299 ...AL..R.VV.VNAKT..RRTGICGAAE.....C.LLIHRDI..V.....E.T...IGQGVIRA
 300 ...AL..R.LL.IDGKA..TRPSACNSLE.....T.LLVHADI..A.....E.R...FLPLAAQA
 301 ...AL..R.LL.IDGKA..TRPSACNSLE.....T.LLVHADI..A.....E.R...FLPLAAQA
 302 ...SL..D.VV.ENAKV..QRPSACNALD.....T.LLVNEKV..A.....E.A...FLSRLVER
 303 ...SL..N.VV.ENSKV..QRPSACNSLD.....T.LLVHEKV..A.....A.K...FLPMIVER
 304 ...AL..R.LL.IDGKA..TRPSACNSLE.....T.LLVHADI..A.....E.R...FLPLAAQA
 305 ...AL..R.LL.IDGKA..TRPAACNSLE.....T.LLVHADI..A.....E.R...FLPLAAQA
 306 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 307 ...AI..R.LL.IDGKT..TRPAACNALE.....T.LLVHTDI..A.....P.R...FLPAAAAA
 308 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 309 ...AR..D.IV.VNSKM..RRTGICGSAE.....T.LLIDRAV..A.....D.T...HLLPLMEA
 310 ...AW..K.VC.FDAKV..QYPAVCNAIE.....T.LLVNRKI..A.....E.A...FLPKMAEM
 311 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 312 ...AI..K.LT.VDSKT..QYPAACNAIE.....T.LLVHKAI..A.....P.H...FLPLAVKA
 313 ...SV..D.LV.VNSKT..HRPSVCNSLE.....T.LLVHEKA..A.....K.R...VLPKILDR
 314 ...AK..S.IV.LNAKM..RRTGVCGAAE.....T.LLIDRAA..A.....T.T...HLAPLVTM
 315 ...AI..R.LL.IDGKT..TRPAACNALE.....T.LLVHTDI..A.....P.R...FLPAAAAA
 316 ...AE..K.VV.VNAKT..QRPSVCNAIE.....S.LLIHKAW..A.....R.Q...HGKELLDQ
 317 ...AL..R.IA.IDSKC..QYPAACNAIE.....T.LLLHKDI..A.....P.S...FLDKAIPF
 318 ...AL..A.IL.LNAKT..SRPSVCNAAE.....T.LLVHAAV..A.....E.T...FLPRALAA
 319 ...AE..T.IL.LNAKT..RRPSVCNAAE.....S.VLIDAAI..A.....E.E...AVPRLTKA
 320 ...AL..Q.IA.IDSKT..QYPAACNSIE.....T.LLIHQSI..A.....P.S...FLELAIPA
 321 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 322 ...AI..A.IT.LDAKT..QYPAACNAIE.....T.LLVHRDI..A.....E.A...FLPKVAAA
 323 ...AW..Q.VC.FDAKV..QYPAVCNAIE.....T.LLVNRNI..A.....E.V...FLPKMAEM
 324 ...AI..E.IV.HNAKV..QRPSVCNSLE.....T.LLVHEAA..A.....E.R...LIPAVLAR
 325 ...AL..A.IT.LNAKT..QKVSVCNSAE.....T.LLVHAGI..A.....A.E...FLPRVLTA
 326 ...AL..R.LL.IDGKA..TRPSACNSLE.....T.LLVHAGI..A.....E.R...FLPLAAQA
 327 ...AT..K.IV.INAKT..QRPSVCNAAE.....S.LVVHAKI..A.....D.E...FLPKLENE
 328 ...AV..R.LL.VDGKA..SRPSACNSLE.....T.LLVHADI..A.....E.R...FLPAAAAA
 329 ...AL..D.LL.LNGKT..QRTGVCNALE.....G.LLVHKDI..A.....P.R...FLPRVAKA
 330 ...AL..R.LA.LNGKT..QRPAVCNALE.....T.VLVHEKV..A.....E.A...FLPRLEKA
 331 ks.VR..H.LL.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 332 ...SV..D.VV.ENSKV..QRPSACNSLD.....T.LLVHEVV..A.....E.A...FLTKLKQR
 333 ...SV..D.VV.ENSKV..QRPSACNSLD.....T.LLVHEAV..A.....E.A...FLAKLTQR
 334 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 335 ...AE..E.IV.LNAKT..RRPSVCNAAE.....S.LLIDAAI..A.....D.V...AVPRLTGA
 336 ...AI..K.IA.INAKT..QRPGVCNAME.....T.LLVDSAI..A.....K.S...ALPLIKAE
 337 ...AL..D.LL.LNGKT..QRTGVCNALE.....G.LLVHKDI..A.....P.R...FLPRVAKA
 338 ...AR..D.IV.LNAKL..RRTGICGAVE.....T.VLIDRQA..L.....E.K...FLPVLI-A
 339 ...AL..S.VA.LDSKI..QYPAACNAIE.....T.LLVHKDI..A.....Q.V...FLEKAIPL
 340 0dgCFl.S.LV.RDSKC..DYPAACNAME.....T.LLVHRDL..L.....R.T...PVFDQIID
 341 ...AK..A.IV.LNSKM..RRPGVCGAAE.....T.LLVDRAG..A.....R.D...ALKPLIET
 342 ...AI..S.IA.LDSKI..QYPAACNAIE.....T.LLIHEDI..A.....E.M...FLKKGLPI
 343 ...AK..S.IV.LNAKM..RRTGVCGAAE.....T.LLIDRAS..Q.....D.KikpLVDTLINA
 344 ...AV..E.VV.VNAKL..RRVSVCGSAE.....T.LLIDQAA..A.....D.K...LLPPIADA
 345 ...AK..S.IV.LNAKM..RRTGVCGAAE.....T.LLIDRAA..A.....D.T...HLAPLVAM
 346 ...AF..D.IV.VNAKT..QRPSVCNACE.....T.LLVEQSF..A.....K.A...HLPALVER
 347 ...AV..E.LA.VNAKM..RRTGICGATE.....T.ILIDRAY..P.....A.Plg.IVDALIAA
 348 ...AL..R.LA.LNGKT..QRPAVCNALE.....A.VLVHEKV..A.....E.A...FLPRLEKA
 349 ...AV..R.LL.VDGKA..SRPSACNSLE.....T.LLVHADI..A.....E.R...FLPAAAAA
 350 ...AK..R.IV.MDAKI..DYPAACNAME.....T.LLVHKDL..M.....K.Tp..ELNDILVA
 351 ...AV..R.LT.LDSKT..QYPAACNAIE.....T.LLVHAEI..A.....P.R...FLPLAVQA
 352 ...AI..P.II.INAKT..QRVGVCNAAE.....K.LLVHKDV..A.....A.E...FLPQIAAA
 353 ...AK..R.IV.MDAKI..DYPAACNAME.....T.LLVHKDL..M.....KiP...ELNDILVA
 354 ...AI..P.II.INAKT..QRVGVCNAAE.....K.LLVHKDV..A.....A.E...FLPQIAAA
 355 ...AE..S.IV.LNAKT..RRPSVCNAAE.....S.LLIDAAV..A.....D.V...AVPRLTDA
 356 ...AL..D.LL.LNGKT..QRTGVCNALE.....G.LLVHKDI..A.....P.R...FLPRVAKA
 357 ...AV..R.IA.IDSKT..QYPAACNAIE.....T.LLVHQDS..A.....P.A...FLAAAVPA
 358 ...VI..K.IV.RDSKC..HYPAACNSME.....T.LLIHRDV..L.....R.T...PLFDQIID
 359 ...AK..R.IV.LDAKT..DYPAACNAME.....T.LLVHKDL..Ae....N.G...GLNDLIVD
 360 ...AI..P.II.INAKT..QRVGVCNAAE.....K.LLVHKDV..A.....A.E...FLPRIAAA
 361 ...AK..S.IV.LNAKM..RRPGVCGAAE.....T.LLIDRAA..A.....S.N...LAPL-VTT
 362 ...AL..D.LL.LNGKT..QRTGVCNALE.....A.LLVHQDI..A.....P.Q...FLPKVAKA
 363 ...AK..S.IV.LNAKM..RRPGVCGAAE.....T.LLIDRAA..A.....S.N...LAPL-VTT
 364 ...AR..N.IV.LNAKL..RRTGICSAVE.....T.VLIDRQA..L.....E.K...FLPILT-A
 365 ...AK..R.VV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.G...VLNELIYA
 366 ...AK..Q.IV.LDAKT..DYPSGCNAME.....T.LLVHKDL..Ve....K.G...WLNSISVN
 367 ...AL..R.IV.YNAKT..GRPSVCNSME.....V.LLVHEGI..A.....A.D...FLPKLERL
 368 ...AK..R.IT.VDAKI..DYPAACNAME.....T.LLVHKDL..Aq....N.G...GLNDLIVE
 369 ...AK..H.IV.MDAKI..DYPAACNAME.....T.LLVHKDL..Mk....S.P...GLDDILVA
 370 ...AK..H.IV.MDAKI..DYPAACNAME.....T.LLVHKDL..Mk....S.P...GLDDILVA
 371 ...AL..D.LL.LNGKT..QRTGVCNALE.....A.LLVHQDI..A.....P.Q...FLPKVAKA
 372 ...AV..R.VA.LDSKT..QYPAACNAIE.....T.LLVHRSV..A.....A.S...FLSAAIPE
 373 ...AK..R.IV.LDAKV..DYPAACNAME.....T.LLVHKDL..Nr....T.E...GLDDLLVE
 374 ...AL..Q.IM.VNAKT..SRPSVCNAAE.....V.LLVHEEI..A.....S.Q...FLPRLEEA
 375 ...AI..N.LL.LNGKT..QRTGVCNALE.....G.LVVHQDI..A.....N.E...FLNLCAVV
 376 ...AK..A.IV.LNAKM..RRPGVCGAAE.....T.LLVDRAA..A.....E.A...DLAPLLSV
 377 ...AR..K.IL.LDAKM..RRTGICGATE.....T.LLIDAAI..A.....P.A...LLPLLVED
 378 ...AV..D.VV.RNAKL..RRTGICGATE.....S.VVVDRVI..A.....P.A...LILALADA
 379 ...AV..D.IL.LNAKT..QRPSVCNTVE.....T.LLVHSG-..-.....S.T...VLPAVAAA
 380 ...AW..K.VC.FDAKV..QYPAVCNAIE.....T.LLINRKI..A.....D.T...FLPKMAEM
 381 ...AL..S.VA.LDSKI..QYPAACNAIE.....T.LLVHKDI..A.....P.A...FLEKAIPL
 382 ...AL..V.VV.DNSKA..QRPSACNALD.....T.LLVHEAV..A.....P.Q...FLALLANN
 383 ...AV..R.IA.IDSKT..QYPAACNAIE.....T.LLVHASI..A.....P.A...FLASAVPA
 384 ...AL..K.II.RDSKC..DYPAACNAME.....T.LLIHEDL..Lqn...S.S...FFTDVCNM
 385 ...AL..D.IA.IDSKC..QYPAACNAIE.....T.LLLHKDI..A.....A.S...FLKLAIPA
 386 ...AV..D.IV.RNAKA..QRPSACNAVE.....T.VLVLRAA..A.....E.R...LLSPVLGA
 387 ...AV..R.VA.VDSKS..QYPAACNAIE.....T.LLVHRSI..A.....Q.P...FLAAALPA
 388 ...AL..R.IA.IDSKT..QYPAACNAIE.....T.LLVHQEV..A.....S.Q...FLPAVISA
 389 ...AL..A.IV.LNAKT..HRTSVCNAAE.....S.LLVHADL..A.....D.T...FVPRVVAA
 390 ...AK..L.IV.MDAKT..DYPAACNAME.....T.LLVHKDL..Mk....S.P...GLDDILVA
 391 ...AV..P.VI.VNAKV..QRPGACNALD.....T.LLVHRAA..A.....S.T...FLPLVAAA
 392 ...AL..K.II.RDSKC..DYPAACNAME.....T.LLIHESH..Mk....S.N...FFNDVCSM
 393 ...AL..K.II.RDAKC..DYPAACNAME.....T.LLIHEDLl.A.....G.N...FFTDVCNM
 394 ...AI..D.LL.VNGKT..HRTGVCNALE.....G.LIVHKDI..A.....E.Q...FLPLAAAA
 395 ...AK..K.VV.LDAKT..DYPAACNAME.....T.LLVHKDL..Vq....N.G...CLDELIVE
 396 ...AL..A.VI.DNAKT..QRPSTCNTLE.....T.LLVQESI..A.....T.E...FLPKLVAH
 397 ...AQ..A.IV.LNAKM..RRTGVCGAME.....T.LLIDATY..Pdp...H.G...LVEPLLDA
 398 ...AL..H.IA.RDAKC..DYPAACNAME.....T.LLIHEDL..Ms....G.D...IFSDVCNM
 399 ...AL..A.II.ENAKV..QRPAVCNALD.....T.LLVDASI..A.....S.A...FLTKLADK
 400 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 401 ...SV..A.VI.ENAKV..QRPSACNALD.....T.LLVHQAI..A.....K.P...LLDKLIAK
 402 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 403 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 404 ...AV..N.IL.VNGKT..QKPSACNAFE.....T.VLVHSDI..S.....A.K...FLPLAAKA
 405 ...AL..E.IV.LNAKT..RRTGICGAME.....C.LLIDWRF..Y.....T.Q...HGSLLIDA
 406 ...AV..D.LA.LNGKV..QRPGVCNATE.....C.LLVHRAA..A.....G.K...LLPPVGRA
 407 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 408 ...AL..N.VV.LNAKL..SYPAACNACE.....C.ILLDEVL..V.....E.G...FLPKLLTK
 409 ...AR..D.IA.LNAKM..RRTGICGAME.....T.LLIDSDFsdA.....S.A...LIKALIDA
 410 ...VI..P.IV.INSKV..QRPGVCNSTE.....N.LILHNGY..-.....-.P...FRKELLEA
 411 ...AV..N.IA.VNAKT..QRPSVCNAIE.....T.VLVHRGI..A.....D.S...AVRPLVDA
 412 ...VI..P.IV.INSKV..QRPGVCNSTE.....N.LILHNGY..-.....-.P...FRKELLEA
 413 ...AL..A.VI.DNAKT..QRPSTCNTLE.....T.LLVQESI..A.....T.E...FLPKLVAH
 414 ...AL..R.IV.YNAKT..SRPSVCNSME.....V.LLVHEDI..A.....A.D...FLPKLERL
 415 ...AR..R.IV.LDAKI..DYPAGCNAME.....T.LLVHKDL..Ve....K.G...WLNSIIID
 416 ...AL..S.II.NNAKT..SRPSVCNAME.....V.LLVHENK..A.....A.S...FLPRLEQV
 417 ...AI..R.VI.HNAKT..QKPAVCNAAE.....K.LLIHEAI..A.....G.E...FLPKIVDD
 418 ...AL..R.IA.RDAKC..DYPAACNAME.....T.LLIHEDL..Ms....G.A...IFGDVCNM
 419 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 420 ...AK..Q.II.RDAKT..DYPAACNAME.....T.LLVHKDL..Sn....N.G...GLNELVVE
 421 ...AV..E.IV.LNAKT..SRPSVCNAAE.....T.VLVHSAL..A.....A.D...FLPTLLRA
 422 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 423 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 424 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 425 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 426 ...AL..S.IC.VNAKC..SRPGVCNAAE.....T.ILVHEEV..A.....N.E...FIPNLKKS
 427 ...AA..D.IV.VDAKT..NYPAGCNSVE.....T.LLINEKV..I.....S.D...KWPTVASA
 428 ...AL..S.II.NNAKT..SRPSVCNAME.....V.LLVHENK..A.....A.S...ILPRLDQM
 429 ...AK..R.IV.SDAKL..DYRAACNAMG.....T.RLVHKDLe.Q.....E.G...VLNELIFA
 430 ...AL..K.II.RDAKC..DYPAACNAME.....T.LLIHEDL..Mq....G.D...FFSDICNM
 431 ...AT..D.IA.YDAKV..QYPAVCNAVE.....T.LLVHEDV..A.....E.E...YLPDIAAR
 432 ...AL..R.IV.YNAKT..SRPSVCNSME.....V.LLVHEDI..A.....A.D...FLPKLERL
 433 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 434 ...AT..R.VL.VDSKT..NYPAGCNAVE.....Q.LLIHQDI..And...D.E...KLSKIINS
 435 ...AA..K.IV.INAKT..QRPSVCNAAE.....G.LVVHQAI..A.....K.G...FLSQLEKM
 436 ...AT..R.VA.VDSKT..QYPAACNAIE.....T.LLVHRSI..A.....T.A...FLAAAVPA
 437 ...AL..K.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.N...FISLLIPE
 438 ...AK..K.II.VDSKT..NYPAGCNAVE.....Q.LLINSHI..P.....Q.Q...QIIEILQI
 439 ...AK..Q.IV.LDAKT..DCPSGCNAME.....T.LLVHKDL..Ve....K.G...WLNSISDD
 440 ...AI..A.ML.INGKT..RRCSVCNATE.....T.ALIDSAL..P.....D.V...DKLRVVRA
 441 ...AV..S.VI.RNAKL..RRTGICGATE.....S.LVVDEAV..A.....K.Q...FIPLLADG
 442 ...GV..E.IV.IDGKL..DYPAACNSLE.....T.LLIHKDK..L.....S.E...FLPALLLR
 443 ...AI..Q.IV.RDSKC..DYPSACNAAE.....T.ILIHKDL..At....A.P...FFDSLCSM
 444 ...AI..Q.IV.RDSKC..DYPSACNAAE.....T.ILIHKDL..At....A.P...FFDALCSM
 445 ...AI..A.MV.INGKT..RRCSVCNATE.....T.ALLDAAL..S.....D.S...DKLAVVQA
 446 ...GV..E.IV.IDGKL..DYPAACNSLE.....T.LLIHKDK..L.....S.E...FLPALLLR
 447 ...AI..Q.IV.RDSKC..DYPSACNAAE.....T.ILIHKDL..At....A.P...FFDSLCSM
 448 ...AL..K.II.RDSKC..DYPAACNAME.....T.LLIHKKF..R.....H.Tq..VFEDILDM
 449 ...AR..A.IV.KDSKT..DYPAACNAME.....T.LLVHEDL..L.....K.Tp..VFDKICST
 450 ...AI..A.ML.LNGKT..RRCSVCNATE.....T.VLIDSAL..D.....S.A...YQLAIITA
 451 ...AT..K.LV.INGKT..RRCSVCNATE.....V.VLLDSAL..P.....D.P...DKIYVLQE
 452 ...AR..A.IV.KDSKT..DYPAACNAME.....T.LLIHEDL..L.....K.Tp..VFDKICST
 453 ...XX..A.IV.KDXKX..DYPAACNAME.....T.LLVHEDL..L.....K.Tp..VFDKICST
 454 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.G...FLDDLIYV
 455 ...AI..A.MV.INGKT..RRCSVCNATE.....T.ALLDAAL..S.....D.S...DKLAVVQA
 456 ...AS..K.LV.LDGKT..DYPAACNAIE.....T.LLINEAV..L.....S.S...HLPKIAET
 457 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.G...FLDDLIYV
 458 ...AA..E.VI.LDSKT..GYPAACNSLE.....T.LLVQDAA..L.....Q.A...HLPAVATA
 459 ...AL..E.II.LNAKC..QRVSVCNALE.....T.LLIHEKI..A.....K.D...FIKLLIPE
 460 ...AL..R.II.HNAKT..QKPAVCNAAE.....K.LLIHEAI..A.....Q.E...FLPKIADR
 461 ...AK..R.IV.LDAKT..NYPAGCNAME.....G.LLLNPDF..S.....-.Q...WDDVLHHL
 462 ...AK..H.IV.LDAKV..DYPAACNAME.....T.LLVHKDL..Vq....T.G...GLNQLIVE
 463 ...AR..T.VL.ANAKM..RRTGICGATE.....T.LLIDAAI..A.....P.A...LLPRLIED
 464 ...AL..R.LA.LNGKT..QRPAVCNALE.....A.VLVHEKV..A.....E.A...FLPRLEKA
 465 ...AK..A.IV.LNAKT..RRPSVCNALD.....T.LIIHSDR..L.....G.D...LAELCRPL
 466 ...AV..K.VI.VDAKT..DYPAACNSLE.....S.LLVHEDA..L.....G.T...IFPAVAEA
 467 ...AL..K.VI.VDSKT..DYPAACNSLE.....T.LLVHQDA..L.....K.E...VLPPLAKA
 468 ...AA..K.VI.IDAKL..NYPAACNAAE.....T.VLFHRAT..V.....E.Ng..NAKILVEK
 469 ...AL..Q.IA.ENAKL..QKPAACNSVE.....T.LLVHRAV..A.....R.P...FLHRVQEI
 470 ...AL..Q.IA.ENAKL..QKPAACNSVE.....T.LLVHRAV..A.....R.P...FLHRVQEI
 471 ...AA..K.VI.FNAKT..RRPSVCNALD.....T.LLVHAAK..L.....D.D...LPQITAPL
 472 ...GR..D.IV.FNAKT..RRPSVCNALD.....T.LIVHESR..I.....D.D...LPVLVVPL
 473 ...AT..N.VT.YNAKL..RNTSICGATE.....T.ILMHEKI..V.....K.K...FCNPILKK
 474 ...AV..K.VI.VDSKT..DYPAACNALE.....T.LLVHQDA..L.....E.T...LFPAIADA
 475 ...GA..D.II.HNAKT..RRVSVCNALD.....C.TIIHEKR..L.....G.D...-LPALCDQ
 476 ...AV..N.LI.RNAKV..QKPSACNALD.....T.LLIHVRA..L.....P.-...VLPAIARD
 477 ...GK..K.II.NNAKT..RRVSVCNALD.....T.LIIHADR..L.....K.D...LPELVETL
 478 ...GR..Q.IV.LNAKT..RRPSVCNALD.....T.LIMHRDQ..L.....N.D...LAAIAEPL
 479 ...GK..H.II.FNAKT..RRPSVCNALD.....T.LVIHQER..L.....A.D...L-PALVEP
 480 ...AI..T.AI.VDSKT..SYPAACNAVE.....T.LLVQESA..L.....N.S...VFPGVASA
 481 ...GA..A.II.HNAKT..RRVSVCNALD.....C.VIVHESR..L.....S.D...LPLL-CEK
 482 ...AT..N.VT.YNAKL..RNTSICGATE.....T.ILMHEKI..V.....K.K...FCNPILKK
 483 ...GK..K.II.NNAKT..RRVSVCNALD.....T.LIIHADR..L.....K.D...LPELVETL
 484 ...GK..Q.VI.FNAKT..RRPSVCNALD.....T.LVIHRDR..L.....G.DlsyLVEPLQSR
 485 ...AA..D.VV.VDAKT..SYPAACNSVE.....T.LLVQESA..L.....T.T...VFPAVASA
 486 ...GK..K.II.NNAKT..RRVSVCNALD.....T.LIIHADR..L.....K.D...LPELVETL
 487 ...AK..K.II.LDAKL..NYPAACNAVE.....T.LLVDEDA..L.....C.T...LLPSIAEA
 488 ...GK..E.IV.FNAKT..RRPSVCNALD.....T.LLIHRER..L.....D.D...LASIAEPL
 489 ...AA..A.LI.RNAKT..QKPSACNALD.....T.LLIDRAA..L.....A.A...-LPDVVRP
 490 ...AK..R.IS.LDAKT..NYPAGCNAME.....T.LLINPKF..S.....-.K...WWEVLENL
 491 ...AI..K.VI.VNSKI..QNPSVCNSAE.....K.LLVHADI..A.....K.E...FLPKLFDR
 492 ...AK..R.IS.LDAKT..NYPAGCNAXE.....T.LLINPKF..S.....-.K...WWEVLENL
 493 ...GQ..A.IV.FNAKT..RRPSVCNALD.....T.LIIHSDR..L.....C.D...LSELLQPL
 494 ...AK..R.IL.VDAKT..NYPAGCNAVE.....T.LLINPKL..Q.....H.W...--WEVLNS
 495 ...GK..E.IV.LNAKT..RRPSVCNALD.....T.LIIHSER..L.....G.D...LSELCRPL
 496 ...AR..D.VV.INAKT..QRPSVCNAIE.....S.LLIHEKW..A.....E.V...HGRKLLNQ
 497 ...AV..R.IA.VESKI..DYMAACNAAE.....T.LLIHSSL..L.....T.T...VWPAVASA
 498 ...AL..A.VA.IDAKL..NYPAACNAAE.....T.LLLHRDL..Lhs6hgT.T...AAQFLVNG
 499 ...AV..R.IA.VESKI..DYMAACNAAE.....T.LLIHSSL..L.....T.T...VWPAVASA
 500 ...AK..R.IV.LDSKT..NYCAACNAAE.....S.LLINPRC..Sgw...E.E...VLAHLII-
 501 ...AI..S.VV.RDSKC..DYPAACNAME.....T.LLIHKDF..L.....R.T...PMFDQIID
 502 ...AE..K.VV.VNAKT..QRPSVCNAIE.....S.LLIHKAW..A.....R.Q...NGKELLDQ
 503 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.E...IVEKLKKS
 504 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.Q...IVEKLKKS
 505 ...AL..K.VI.LNAKT..AKISACNALD.....K.VLISSKLpnF.....E.G...FAAMLIEA
 506 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.E...IVEKLKKS
 507 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.Q...IVEKLKKS
 508 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.E...IVEKLKKS
 509 ...VCr.R.IT.WGKYM..NCGQTCIAPD.....Y.ILCEASL..Q.....N.Q...IVWKIKET
 510 ...ASr.R.VT.WGKFV..NCGQTCIAPD.....Y.ILCDKSI..Q.....D.K...VVEKIKET
 511 ...ACr.R.IA.WGKFM..NSGQTCVAPD.....Y.ILCDPSI..Q.....N.E...IVEKLKKS
 512 ...VCr.R.IT.WGKYM..NCGQTCIAPD.....Y.ILCEASL..Q.....N.Q...IVWKIKET
 513 ...VCr.R.IT.WGKYM..NCGQTCIAPD.....Y.ILCEASL..Q.....N.Q...IVWKIKET
 514 ...AA..K.VI.IDAKL..NYPAACNAAE.....T.VLFHRAT..V.....E.Ng..DAKILVEK
 515 ...TI..E.VI.INAKT..DKISGCNALD.....K.VLVDKNI..A.....D.Yev.KIKELDEI
 516 ...ACr.R.IA.WGKFM..NCGQTCIAPD.....Y.VLCEPSL..Q.....D.L...IVQKVQEA
 517 ...ACr.R.IA.WGKFM..NCGQTCIAPD.....Y.VLCEPSL..Q.....D.L...IVQKVQEA
 518 ...AK..K.VI.INAKT..DKISGCNALD.....K.VLIDSHL..P.....D.-...FEVKVKDL
 519 ...VV..G.TV.VDSKT..DYPAACNALE.....T.LLVHESL..Lhr...K.D...FWPPLAQA
 520 ...ACr.R.IA.WGKYM..NCGQTCIAPD.....Y.VLCHPSI..Q.....S.Q...VVENIKAT
 521 ...AF..N.II.INAKT..QRPSVCNAIE.....T.IVLHENW..A.....E.Q...YGSELFSS
 522 ...AK..R.IV.LDAKV..DYPAACNAME.....T.LLIHKDL..Ie....K.G...WLKEIILD
 523 ...VR..W.MI.LDSHE..SEPDPVNAIE.....K.VLIHRQA..M.....P.S...SLAVLWNS
 524 ...TL..A.VI.LDAKT..AKISACNALD.....K.ILINKNTpnL.....E.E...KLIALHTV
 525 ...VR..W.MI.LDSHE..SEPDPVNAIE.....K.VLIHRQA..M.....P.S...SLAVLWNS
 526 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 527 ...VCr.R.IT.WGKYM..NCGQTCIAPD.....Y.ILCEASL..Q.....N.Q...IVWKIKET
 528 ...VR..W.MI.LDSHQ..SEPDQVNAIE.....K.VLIHRQA..L.....P.S...SLAVLWNS
 529 ...AA..D.IA.MSANFf.SSGQVCTNGT.....R.VFVQRGV..L.....E.R...FEALVLER
 530 ...SL..K.VI.LNAKT..DKISACNALD.....K.ILISSKLpdY.....E.D...KLRQLRKV
 531 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 532 ...TL..E.VI.INAKT..DKISGCNALD.....K.VLVDKNIedY.....E.S...KLKDLDKT
 533 ...AAr.R.IV.WGKLL..NSGQTCVAPD.....Y.LYVHKDI..E.....E.E...FIKKLEEE
 534 ...AIa.T.TV.RSSFS..NQGEICLCTS.....R.IYVEKSI..Y.....S.E...FLERFVAA
 535 ...SAk.R.VV.WGKFL..NAGQTCVAPD.....Y.VLVHKSI..K.....E.K...FINEMRRY
 536 ...ACr.R.IT.WGKFA..NCGQTCIAPD.....Y.ILCEPSI..Q.....D.R...IVEEIQKT
 537 ...AVd.A.LI.GAAYG..SAGERCMATS.....I.AVLVGDV..A.....D.R...IVPALAER
 538 ...SVd.A.LI.GAAYG..SAGERCMAIS.....V.AVLVGDV..A.....D.Q...IVPKLAER
 539 ...AI..D.II.VNAKT..TKISACNALD.....K.VLIASDI..Prk...P.E...FIQQLVLE
 540 ...AVd.A.LI.GAAYG..SAGERCMAIS.....I.AVLVGDV..A.....D.R...IVPMIAER
 541 ...AA..DiAV.TANFF..SSGQVCTNGT.....R.VFVHRSI..K.....D.A...FTQRVLER
 542 ...AA..DiAV.TANFF..SSGQVCTNGT.....R.VFVHRSI..K.....D.A...FTQKVLER
 543 ...AA..DiAV.TANFF..SSGQVCTNGT.....R.VFVHRSV..K.....D.A...FTQRVLER
 544 ...AA..DiAV.IANFF..SSGQVCTNGT.....R.VFVQRSI..K.....D.A...FTAKVLER
 545 ...AAk.R.IV.WGKYT..NAGQTCVAPD.....Y.ILVHEKA..K.....F.K...LLKAMKKY
 546 ...VR..W.VI.LDSHS..SEPDPVNAIE.....K.VLISPDQ..K.....P.S...ILVRLFNI
 547 ...AVn.R.IM.WGKCF..NSGQSCIAPD.....Y.LLCTKEV..Q.....E.K...FIETTKKV
 548 ...VTt.D.VL.LSAFR..SAGQRCSALR.....V.LFIQEDI..A.....E.K...QIKMICGA
 549 ...AVs.A.LM.GAAYG..SCGERCMAIS.....VaVCVGDQI..A.....D.A...LVAKLVPQ
 550 ...AAd.A.AV.SAGFG..SAGERCMAIS.....A.VVAVGGI..A.....D.D...LVARIKQR
 551 ...VTt.D.VL.LSAFR..SAGQRCSALR.....V.LFIQEDI..A.....E.K...QIKMICGA
 552 ...VVl.D.VL.NSAFD..SAGQRCSALR.....V.LYVQHDV..A.....P.H...ILTMLKGA
 553 ...AVs.A.LM.GAAYG..SCGERCMAIS.....VaVCVGDQI..A.....D.A...LVAKLVPQ
 554 ...AA..R.RI.IAGKWacNSGQACIGVD.....Y.VITTKDF..A.....S.K...LIDALKTE
 555 ...AA..R.RI.IAGKWacNSGQACIGVD.....Y.VITTKDF..A.....S.K...LIDALKTE
 556 ...AT..K.IV.INAKT..KRPSVCNAAE.....G.LVIHEAV..A.....A.R...FIPMLEKA
 557 ...AVs.A.LM.GAAYG..SCGERCMAIS.....VaVCVGDQI..A.....D.A...LVAKLVPH
 558 ...CIp.T.TV.KSSFA..NQGEICLCTS.....R.IFVQRSI..Y.....E.E...FLEKFVEA
 559 ...AVn.G.VL.YGIFS..SSGESCIAGS.....R.LFVQRSI..Y.....G.A...FVARLVEA
 560 ...AVn.G.VL.YGIFS..SSGESCIAGS.....R.LFVQRSI..Y.....G.A...FVARLVEA
 561 ...AAr.R.IV.WAKFL..NAGQTCIAPD.....Y.LLVHRDA..E.....E.E...LLLLMQKA
 562 ...AVn.G.VL.YGIFS..SSGESCIAGS.....R.LFVQRSI..Y.....G.A...FVARLVEA
 563 ...VVg.D.VV.TSAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...ILEMLKGA
 564 ...CIp.A.TV.RSSFA..NQGEICLCTS.....R.IFVQRSI..Y.....S.E...FLKRFVEA
 565 ...AVn.G.VL.YGIFS..SSGESCIAGS.....R.LFVQRSI..Y.....G.A...FVARLVEA
 566 ...VVa.D.VL.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 567 ...AAk.R.IA.WTKLI..NSGQICIAPD.....Y.VLVEAPI..R.....D.K...LVDSIRSA
 568 ...VR..W.MI.LDSHA..SEPDAVNAIE.....K.VLIDRDC..N.....L.S...KLTVLMDS
 569 ...VVg.D.VV.NSAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...VLAMLKGA
 570 ...AAk.R.IV.FGKFT..NAGQTCIAPD.....Y.LFVHEKV..K.....Q.T...LLEEMKKC
 571 ...VVf.D.VI.ASAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...ILTMLKGA
 572 ...AAh.R.IL.WGKSF..NCGQTCIAPD.....Y.VLIQPDL..Q.....D.K...FVQELKKA
 573 ...VVa.D.VL.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLEMLTGA
 574 ...VVf.D.VI.ASAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...ILTMLKGA
 575 ...VVf.D.VI.ASAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...ILTMLKGA
 576 ...TAr.R.LI.WGKCW..NAGQTCIGLD.....Y.LIVHKSI..L.....E.P...LIEEFKVV
 577 ...VR..W.MI.LDSHA..SEPDAVNAIE.....K.VLIDRDC..N.....L.S...KLTVLMDS
 578 ...VIs.N.LV.GASVG..AAGQRCMAIS.....V.A-VLVGA..A.....R.E...WIPDIRDA
 579 ...VIs.N.LV.GASVG..AAGQRCMAIS.....V.A-VLVGA..A.....R.E...WIPEIRDA
 580 ...VVa.D.VL.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 581 ...VVa.D.VM.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 582 ...VIs.N.LV.GASVG..AAGQRCMAIS.....V.A-VLVGA..A.....R.E...WIPEIRDA
 583 ...AAd.G.LI.ASKYR..NAGQTCVCAN.....R.VYVQDSI..K.....D.E...FLGIFIKK
 584 ...AAe.G.LI.ASKYR..NAGQTCVCAN.....R.VYVQDSI..K.....D.E...FLDIFIKK
 585 ...VVg.D.VI.TSAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.R...ILTMLKGA
 586 ...AAd.H.LA.AAAFG..SAGERCMAIS.....V.AVAVGDA..A.....E.L...LVKKVEER
 587 ...AA..DiAM.MANFY..SSGQVCTNGT.....R.VFIPAEM..K.....A.A...FEAKIAER
 588 ...VVa.D.VL.NSAFD..SAGQRCSALR.....V.LYLQEDV..A.....D.H...ILTMLKGA
 589 ...AAk.N.IV.SGAYS..YSGQRCTAVK.....R.ILVQESV..A.....D.K...LVGKIKPL
 590 ...AAe.K.IA.WAKFI..NAGQTCVAPD.....Y.LFVHESV..Q.....H.N...FKKHLIAA
 591 ...AAk.R.IC.WGKFL..NAGQTCIAPD.....Y.LLIHSDI..R.....E.K...FQQKLVET
 592 ...AVa.G.VM.RSSFT..NTGQVCLCSE.....R.VYVERPI..F.....E.R...FVAAMKAR
 593 ...AVn.G.VL.YGIFG..SSGEACIAGS.....R.LFVQRSV..Y.....D.A...FMKRLVDG
 594 ...AVn.G.VL.YGIFS..SSGEACIAGS.....R.LFVQRAV..Y.....D.E...FMTRLVAG
 595 ...AA..DiAM.MANFY..SSGQVCTNGT.....R.VFVPAAM..K.....A.A...FEAKIAER
 596 ...VIi.D.VV.TSAFD..SAGQRCSALR.....L.LCIQEDV..A.....E.R...TLRMLRGA
 597 ...TVn.N.II.AGGYS..YSGQRCTAVK.....R.ILVMNSV..A.....D.K...LVEKLKEK
 598 ...VVa.D.VM.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 599 ...AVn.G.VL.YGIFS..SSGEACIAGS.....R.LFVQRAV..Y.....D.A...FMQRLVAG
 600 ...AVs.W.SI.RAIFS..NAGQVCLAGS.....R.LYVQREI..Y.....D.E...FLSRFVNA
 601 ...VVa.D.VM.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 602 ...VR..Q.MI.IDSHV..GHPDPVNAIE.....K.VLVSPGQ..N.....P.A...PLVRLLNN
 603 ...AAn.N.IV.AGGYS..YSGQRCTAVK.....R.ILVLEKV..A.....D.K...LISKVKEK
 604 ...VCr.R.IT.WGKYM..NCGQTCIAPD.....Y.ILCEASL..Q.....N.Q...IVWKIKET
 605 ...AAd.G.LI.AAKYR..NAGQTCVCAN.....R.IYVQDSI..K.....E.Q...FLAIYLQK
 606 ...VV..K.RI.AGGKWgsCNGQACISVD.....Y.VLIEKSF..A.....P.T...LIDMLKPT
 607 ...AAr.R.IV.WAKFL..NAGQTCIAPD.....Y.LLVHEDV..V.....S.V...LLSFMQQA
 608 ...AVk.W.SH.FGIMS..NQGQICTATS.....R.IYVHQDV..F.....H.S...FLERFKQA
 609 ...VVa.D.VI.ASAFD..SAGQRCSALR.....I.LCLQEDV..A.....D.R...TLAMLKGA
 610 ...VVv.D.VL.ASAFD..SAGQRCSALR.....V.LCLQDDI..A.....E.H...TLKMLRGA
 611 ...AL..A.IVqRGCFI..NLGQNCISSE.....R.VFVHEKI..Y.....D.Q...FCKQMADK
 612 ...VVs.D.II.VSAFD..SAGQRCSALR.....L.LCIQEDV..S.....E.K...TLNMIKGA
 613 ...AAd.A.AV.SAGYG..SAGERCMAIS.....V.VVAVGGT..G.....D.D...LVERIAAR
 614 ...AAd.A.LV.GAGFG..AAGERCMAIS.....VaVPVGDKT..A.....D.A...LIERLIPK
 615 ...ALa.Q.IV.HSAFG..YQGQKCSACS.....R.LIVLEEI..Y.....D.K...LVERLKAA
 616 ...TA..K.RI.AAGKWgcNNGQACISPD.....F.IITTKSF..A.....P.K...LLEALEKV
 617 ...AK..K.IV.LDAKT..DYPAACNAME.....T.LLVHKDL..Tq....N.G...GLQELVKE
 618 ...ACr.R.IT.WGKFV..NCGQTCIAPD.....Y.ILCEASI..Q.....S.R...VIEEITKN
 619 ...VVa.D.VI.ASAFD..SAGQRCSALR.....I.LCLQEDV..A.....D.R...TLTMLKGA
 620 ...AVa.G.AS.SAIFY..NNGQTCTAGS.....R.LYVHRKV..Y.....D.K...VVEGIASE
 621 ...VAr.R.IV.WAKFL..NAGQTCLAPD.....Y.VLVHEHE..E.....E.A...LLQALAAA
 622 ...AAk.G.AV.FGGFY..CSGQVCCATE.....R.VLVDRSV..H.....E.D...FLRAVVEE
 623 ...AVe.G.VV.RAAFG..FAGQKCSACS.....L.LYVHKDI..Y.....D.E...FMKRLKAR
 624 ...ALn.Q.LV.GAAFG..AAGQRCMATS.....-.VAVMVGE..A.....R.N...WLPDFVER
 625 ...AV..K.RI.LVAKFgaCAGQACIAID.....Y.VLVEKSF..S.....S.T...LVELMKEG
 626 ...ALn.Q.LV.GAAFG..AAGQRCMATS.....-.VAVMVGE..A.....R.N...WLPDFVER
 627 ...AVq.A.IV.ESAFQ..SAGQRCSALR.....C.LYVQEDI..A.....T.P...FTEMLIGA
 628 ...AAk.Q.IV.AGAYD..YSGQRCTAIK.....R.VLVVEEV..A.....N.E...LAEKISEN
 629 ...AAk.Q.IV.AGAYD..YSGQRCTAIK.....R.VLVVEEV..A.....D.E...LAEKISEN
 630 ...AVr.D.VV.ASAFR..SAGQRCSALR.....C.LYVQDDI..A.....P.H...LIGMLKGA
 631 ...AAe.K.AA.VGKFL..HQGQICMALN.....R.IIVDASI..Y.....D.S...FVEVFKEK
 632 ...AAk.Q.IV.AGAYD..YSGQRCTAIK.....R.VLVVEEV..A.....D.E...LAEKISEN
 633 ...AAk.Q.IV.AGAYD..YSGQRCTAIK.....R.VLVVEEV..A.....D.E...LAEKISEN
 634 ...ATd.D.II.RSAFD..SSGQRCSALR.....V.LCVQDEI..Y.....D.D...LLSMIKGG
 635 ...AVd.S.GV.FGSFL..HSGQICISIN.....R.HVVHEDV..Y.....D.E...YVERLTER
 636 ...AVk.W.SL.LAAFS..NAGQRCAAGS.....R.ILVFDAV..Y.....P.E...FSEKLVSA
 637 ...AVe.A.VA.FGAFF..NQGQICMSTE.....R.VIAQRAV..A.....D.L...FVEKLAAK
 638 ...AIe.A.TI.GGSFS..GAGQKCTASS.....R.LLVMDSV..Y.....D.E...YVERLAQR
 639 ...AVr.D.IV.ASSFQ..SAGQRCSALR.....C.LYVQEDV..A.....P.T...LIEMLKGA
 640 ...AI..P.VL.VNALIq.NAGQTCSAGS.....R.VLIHRPI..F.....D.Q...VVAELKLR
 641 ...VVa.D.VI.ASAFD..SAGQRCSALR.....V.LCLQEDV..A.....D.H...VLAMLRGA
 642 ...AA..K.KA.AGQYD..DSGQVCMAGT.....R.IIVEESV..K.....D.E...FLAKFHAY
 643 ...VVt.D.VM.ASAYD..SAGQRCSALR.....I.LCIQEEV..A.....D.S...TIEMLKGA
 644 ...AVe.G.CV.RSSFG..FAGQKCSASS.....L.IYVHEKI..Y.....D.E...FIEKFVER
 645 ...AAr.E.IV.ASKTT..NCGQLCTAIE.....R.VYVHEVI..Y.....D.E...FVALLKGQ
 646 ...AVe.G.AM.ASKFR..NAGQTCVCTN.....R.FLVQSSV..V.....N.A...FSEKLAAA
 647 ...AVr.D.IV.NGAFR..SAGQRCSALR.....C.LYVQSDI..A.....D.K...LMTMLKGA
 648 ...AVr.D.IV.NSAFR..SAGQRCSALR.....C.LYVQEDV..A.....P.H...LVEMIKGA
 649 ...AAl.R.VT.QGRFL..NAGQTCVACD.....Y.LFVHKSI..K.....A.E...FIKKLKEK
 650 ...TAr.K.LI.WSKYL..NSGQTCIAPN.....Y.IAIHSKV..K.....D.E...FLKVLSEQ
 651 ...AVq.A.IV.ESAFQ..SAGQRCSALR.....C.LYVQDDI..A.....P.H...FLEMLTGA
 652 ...VAe.H.AA.AAIFH..NQGEVCIAGS.....R.LLVENSI..R.....E.R...FVGKVLAA
 653 ...AAe.G.VV.RAAFG..FGGQKCSATS.....R.LYVQREV..Y.....D.R...FVERLVEK
 654 ...AVq.A.VV.ESAFQ..SAGQRCSALR.....C.LYLQEDV..A.....E.D...VLTMLKGA
 655 ...ALn.S.IV.GAAFG..AAGQRCMALS.....T.LVTT-QG..T.....G.S...WMPELVER
 656 ...AVe.G.VA.RAAFG..FAGQKCSACS.....L.LYVHKDV..Y.....D.E...FMKRLKER
 657 ...AAq.R.LA.VGKLW..NAGQTCVAPD.....Y.VFLPKGR..S.....A.E...FIENFKLI
 658 ...TAarR.IV.WGKFV..NAGQICVAPD.....Y.ILVAPEK..E.....A.E...LVACIKEV
 659 ...AA..D.AL.AGQKVr.NAGQVCISPT.....R.FYVQAKG..H.....D.R...FLARFAEK
 660 ...TLd.A.LT.GAAFG..ASGQRCMALS.....A.AV-FVGE..S.....K.N...WIPELAER
 661 ...AAv.R.IA.QGRMV..NGGQVCVCPD.....Y.VLVPEYL..V.....D.E...FSATVLAT
 662 ...VAd.D.VI.ASAFR..SAGQRCSALR.....L.LCVQDDV..A.....D.R...VIAMIAGA
 663 ...AAe.A.LT.TAGFF..NAGQDCTSST.....R.LLVQAGV..H.....D.E...FVAALAKY
 664 ...VAd.A.VV.QSAFR..SAGQRCSALR.....L.LCVHEGI..A.....D.G...VIDMIQGA
 665 ...AVq.A.VI.ESAFQ..SAGQRCSALR.....C.LYLQEDI..A.....E.D...VLTMLKGA
 666 ...AVa.G.AV.RACFS..SAGQLCISAE.....R.LLVHRDV..F.....G.E...FVTKFVEA
 667 ...VVa.D.VL.QSSFD..SAGQRCSALR.....V.LCLQDDV..A.....D.R...TLTMLKGA
 668 ...VAd.A.VV.QSAFR..SAGQRCSALR.....L.LCVHEGV..A.....D.G...VIAMIGGA
 669 ...VK..S.VL.LDPLA..RYGPEGIPIYqpltlW.LLIHTDW..A.....A.H...HLTALIED
 670 ...TAk.R.LV.AAKLT..NLGQICVCVN.....H.VYVDPEV..H.....D.S...LVARLIYW
 671 ...AIe.R.VI.VGAYY..QSGQSCISVQ.....R.LLVHRNI..Y.....D.E...FKTRYVEK
 672 ...AA..QvLV.WGKLV..NAGQTCVAPD.....T.LFVHREV..R.....T.A...LLQRCREL
 673 ...VK..S.VL.LDPLA..QYGSEGIPIYqpltlW.LLIHTDW..A.....A.N...HLTALVED
 674 ...AVa.E.LT.HGALT..MAGQICVAAA.....R.FLVHESI..A.....K.D...FEDRIKAS
 675 ...VVr.A.VT.FAAVG..TAGQRCTTLR.....R.LIVHRSL..V.....E.Q...LLPRIEKA
 676 ...VVr.A.VT.FAAVG..TAGQRCTTLR.....R.LIVHRSL..V.....E.Q...LLPRIEKA
 677 ...VT..R.LV.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 678 ...CIp.T.TV.KSSFA..NQV-------.....-.----RSY..I.....K.K...ARSEGAQI
 679 ...AVa.A.AI.NQRFA..TAGQRCTATK.....R.VFVHREV..Y.....A.R...FRDALVEK
 680 ...VVr.A.VT.FAAVG..TAGQRCTTLR.....R.LIVHRSL..V.....E.Q...LLPRIEKA
 681 ...VVr.A.VT.FAAVG..TAGQRCTTLR.....R.LIVHRSL..V.....E.Q...LLPRIEKA
 682 ...AVe.W.SI.KGRIY..NNGETCVAAK.....R.FVVTEKV..Y.....D.E...FKEKFVAG
 683 ...AIk.N.II.HSAFS..NSGQKCSATS.....L.LVLEEEV..Yhd...E.E...FKKTLVDA
 684 ...AIk.N.II.HSAFS..NSGQKCSATS.....L.LVLEEEV..Yhd...E.E...FKKTLVDA
 685 ...AIk.N.II.HSAFS..NSGQKCSATS.....L.LVLEEEV..Yhd...E.E...FKKTLVDA
 686 ...AK..Q.IV.RDAKT..DYPAACNAME.....T.LLIHKDL..Sn....N.G...GLNELVLE
 687 ...GV..D.II.VNAKT..SKPAVCNAAE.....K.LLVNEKI..A.....E.E...--------
 688 ...AK..K.IV.KDAKT..DYPAACNAME.....T.LLVHKDL..A.....G.K...WWDLNETC
 689 ...AVk.N.II.HSAFS..NSGQKCSATS.....L.LVLEKEV..Yed...E.E...FKKCLIDA
 690 ...AIk.N.II.HSAFS..NSGQKCSATS.....L.LVLEEEV..Yhd...E.E...FKKTLVDA
 691 ...AVh.N.IV.QSAFI..TSGQRCTCAR.....R.LFIEDSE..Qg....R.A...VLERLIEV
 692 ...AA..K.IV.INAKT..QRPSVCNAAE.....G.LVVHQAI..A.....K.G...FLSQLEKM
 693 ...AI..D.II.INAKT..QRPSVCNAIE.....T.IVLHEKW..A.....Q.Q...HGSELFSS
 694 ...TIn.W.AV.LGRHW..NGGQVCVSSK.....R.MIIVDEV..Y.....D.R...FLEGYIGS
 695 ...AA..A.IV.SNGKI..QRPGVCNALE.....T.LLVHRQV..A.....A.E...FIPAVAGQ
 696 ...AK..K.IV.KDAKT..DYPAACNAME.....T.LLVHKDL..Ag....N.G...GLNELAAE
 697 ...AAk.D.VA.YSAFG..HAGQKCSAAS.....L.VILVGSV..Ats...K.R...FHNQLIDA
 698 ...AK..R.IV.SDAKL..DYPAACNAME.....T.LLVHKDLe.Q.....N.A...VLNELIFA
 699 ...AAa.E.IA.DGCFS..NAGQSCCSVE.....R.IYLHEAI..R.....D.P...FLECFRNE
 700 ...AAv.R.IA.QGRMV..NGGQVCVCPD.....Y.VLVPEYL..V.....D.E...FSATVLAT
 701 ...AAa.D.II.KSAFG..NAGQKCSAAS.....L.IILVGQA..Yrs...Q.R...LRHQILDA
 702 ...VT..R.II.RDSKC..EYPAACNALE.....T.LLIHRDL..L.....R.T...PLFDQIID
 703 ...AT..R.IV.INAKT..QRPSVCNAAE.....S.LVVHAKI..A.....D.E...FLPKLQNE
 704 ...CIp.T.TV.RSSFA..NQGEICLCTS.....R.IFVQRSI..Y.....S.E...FLKRFVEA
 705 ...AI..K.RI.IDSKT..FDNGVICASE.....Q.SIVIEKS..M.....E.E...TVLKELKN
 706 ...AK..Q.IV.LDAKL..DYPAACNAME.....T.LLVHKDL..Lq....N.G...GLNELVSD
 707 ...AV..K.QI.MDSKT..FDNGTICASE.....Q.SIIVETV..N.....R.E...AVKEELIK
 708 ...AL..K.VI.VNAKT..QRPSTCNTVE.....T.LLVNKNI..A.....D.S...FLPALSKQ
 709 ...AIp.D.VI.ASKTF..DNGTICSSDQ.....S.VIFDDKA..V.....A.E...KALKLFKE
 710 ...AV..K.RI.LDSKT..FDNGVICASE.....Q.SIVVENS..M.....K.E...IVKEELIK
 711 ...VL..N.CI.QRSHQ..ANPDRALAIE.....K.VIVLANV..N.....P.S...HLAFVINE
 712 ...AA..R.RI.IAGKWacNSGQACIGVD.....Y.VITTKDF..A.....S.K...LIDALKTE
 713 ...AL..E.VI.LNSKF..QKLGAANAVT.....T.VIVHSDF..P.....R.Y...TELVLALA
 714 ...AVk.R.IV.YSKLL..NCGQICVAAD.....Y.VLCHEKI..V.....S.V...FKEKVEET
 715 ...AMs.D.TV.LSKNF..DHGVVCASEQ.....N.LIFDNPQ..T.....A.E...KAIAKLKE
 716 ...AVy.D.IV.MSKSF..DNGMICASEQ.....A.AIVDKEI..Y.....A.D...FVKEMQSY
 717 ...AVe.D.LL.LSKRF..DNGMICATEN.....S.AVVEAPI..Y.....D.E...WLQKMQDK
 718 ...AAk.Q.IV.DSKSF..DNGIVCGSEN.....N.LIADRSV..Y.....D.D...LRRAL-EA
 719 ...AA..K.RI.VDSKA..FDNSVLCTNE.....S.VLIVEDS..V.....A.D...ALRSAMTR
 720 ...AA..K.RI.VDSKA..FDNSVLCTNE.....S.VLIVEDS..V.....A.D...ALRSAMTR
 721 ...AI..R.VI.HNAKT..QKPAVCNAAE.....K.LLIHEAI..A.....G.E...FLPKIVDD
 722 ...AI..R.DI.ISSKS..FDYGTICASE.....Q.SIICEEC..N.....H.D...AVVEELKK
 723 ...FA..A.VV.RNSLD..R--KVCNTLN.....V.CLIQRDR..A.....A.E...LVPLFLDA
 724 ...AA..R.RI.VDSKA..FDNSVLCTNE.....S.VLIAEDA..I.....A.A...RLSTALTR
 725 ...VAr.N.LA.FSLAL..YSGQMCTAPQ.....N.IYVPRDG..I.....Q.T...AEGRVGFD
 726 ...VAr.N.LA.FSLAL..YSGQMCTAPQ.....N.IYVPRDG..I.....Q.T...AEGRVGFD
 727 ...VAr.N.LA.FSLAL..YSGQMCTAPQ.....N.IYVPRDG..I.....Q.T...AEGRVGFD
 728 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 729 ...AA..E.IA.HEALFg.NHGQSCCAGS.....R.TFVHEKI..Y.....D.S...FVQHAKEL
 730 ...AK..R.IV.LDAKV..DYPAACNAM-.....-.-------..-.....-.-...--------
 731 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 732 ...AK..Q.FVkLE---..------SKQS.....R.VFVRPAL..A.....S.I...GQPHLIRI
 733 ...AK..R.IV.LDAKV..DYPAACNVME.....T.LLVHKDL..Nk....T.E...GLDDLLME
 734 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 735 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 736 ...AV..K.IT.ANAKM..SRPSVCNAAE.....V.-------..-.....-.-...--------
 737 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 738 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 739 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 740 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 741 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 742 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 743 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 744 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 745 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 746 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------
 747 ...--..-.--.-----..----------.....-.-------..-.....-.-...--------


                     280                      290         300          
                      |                        |           |          
   1 ML...RVEQV.....KIHAGPKF.....ASY.....L.....TFV..KSLRTEYGDLELCIEVV.
   2 LK...ENGVEirgc.EVTRRYIP.....DAL.....P.....ATE..EDYYTEFLDLILAVRVV.
   3 FR...SKTVElrgc.RRTCAILG.....DIV.....E.....ATE..EDWHAEYLAPILAVKVV.
   4 LK...EKGVT.....IRGCERTR.....AII.....Pwaev.ATE..TDWATEYLDLILAIRVV.
   5 YR...EKGVElrgdaATRALLGA.....DVL.....E.....ATE..EDWRTEYNAPILSIRIV.
   6 YR...EKGVElrgdaATRALLGA.....DVL.....E.....ATE..EDWRTEYNAPILSIRIV.
   7 YE...EKGVE.....LRGCEQTR.....AIC.....Dmka..ATE..EDWATEYLAPILSIKVV.
   8 YW...EKGVE.....LRGCERVR.....AIL.....GepvkaATD..EDWATEYLAPVLAVKVV.
   9 YE...EKGVE.....LRGCEQTR.....AIC.....Dmka..ATE..EDWATEYLAPILSIKVV.
  10 YC...SAGVE.....LRGCPETQ.....GLL.....Phiep.ATE..EDWYTEYLAPLLAIRIV.
  11 FR...ENNVE.....LRGCENTR.....AIL.....Pgikk.AVD..DDWSREYLDYIMAVKIV.
  12 YR...EKGVElrgdaATRALLGA.....DVL.....E.....ATE..EDWRTEYNAPILSIRIV.
  13 YR...AKGVE.....LRGCPRSR.....ELL.....GpgtleASE..EDWSSEYNAPILSVRVV.
  14 LI...ELKVE.....LRGDDCVR.....QFV.....Pqatk.ATE..DDWHAEYLELILAVRVV.
  15 LG...GMQVElrgd.ERFRALAP.....QAK.....P.....ASE..EDWYAEYLELILACRVV.
  16 YR...DKGVElrgcaQTRALLGA.....GVL.....E.....ATE..EDWRTEYTAPILSIRVL.
  17 LQ...EMNVE.....LRGCPRTL.....ALI.....Egake.ATE..EDYQTEYLDLILAVRVV.
  18 YR...DKGVElrgcaQTRALLGA.....GVL.....E.....ATE..EDWRTEYTAPILSIRVL.
  19 LK...EKGVE.....IRGCEKTK.....AIV.....Ndinl.ATE..EDWGKEYLDYILGVKVV.
  20 IS...KYGVEs14gsIKDAKVLS.....LIS.....E.....ATE..EDWDTEYLDLILSIKIV.
  21 YS...EKDVE.....LRGCDKTR.....EII.....Asais.ASE..EDWSLEYLAPILSIKVV.
  22 YR...DKGVE.....LRGCPETC.....RLV.....Pdcvp.ATE..ADWDTEYLAPILAVRVV.
  23 LR...ESHVVirgc.EETCALIS.....DAE.....Q.....ATE..ADWYREYLDLVLSIRVV.
  24 MA...ESGVTlh7tvMQVLHGPA.....KLV.....P.....LKP..EELDNEFLSLDLNVVVV.
  25 LT...SLGVE.....IRGCQITK.....EIC.....Pqvke.ATD..KDWETEYLDLILAVKVV.
  26 MA...ESGVTlh7tvMQALHGPA.....KLV.....P.....LKP..EELDNEFLSLDLNVVVV.
  27 LR...ENGVAvkgd.EVSQSIIN.....DIE.....K.....AAE..EDWGKEYLDYIIAVKVV.
  28 MA...ESGVTlh7tvMQVLHGPA.....KLV.....P.....LKP..EELDNEFLSLDLNVVVV.
  29 FA...ARGVElr8tvALLTASDI.....PVV.....A.....ALE..EDWDTEYLAPILSIKLV.
  30 YA...EKGVE.....LRGCERTR.....EIL.....Pqals.AVE..ADWSEEYLAPILAIKVV.
  31 LG...ELGVE.....LRGCAETC.....RLA.....Pgttp.AVD..SDWGAEYLDLILAVKVV.
  32 FV...EKGVElrg..CERTQAII.....SAK.....P.....ATE..ADWHTEYLDAILSIRVV.
  33 YA...EKGVElvgc.DATQALLS.....NAG.....A.....ATE..DDWYTEYMAPKLSIKLV.
  34 YA...EKHVE.....LRGCQETR.....RIL.....GssvktATE..EDWYTEYLAPILAIKVV.
  35 LD...SKNVElvg..CSETQKII.....PVA.....P.....ATE..EDWRTEYLDYKLSVKVV.
  36 MD...ARQVE.....LIGCPRTR.....AVI.....Paap..ATE..EDWRTEYLDLKLSVKVV.
  37 LA...TKGVEm11ilRAAGIAAD.....KLR.....A.....ASE..QDWSEEYLAPVIAVKVV.
  38 FV...EKGVElrg..CERTQAII.....SAK.....P.....ATE..ADWHTEYLDAILSIRVV.
  39 LK...EFHVElrad.ERALAIFE.....EAI.....P.....ATE..QDWETEFLDFILAVKVV.
  40 LL...EKGVElrgd.EAARALVA.....GIK.....P.....AVE..EDWYAEYLAPVLSVRIV.
  41 FQ...EKGVE.....LRGCERTR.....AII.....Dskp..ASE..DDWHTEYLDAILSIRIV.
  42 YA...SKGVElrac.ERARAWLA.....DAV.....A.....ATE..DDWHAEYLAPILAVRVV.
  43 LS...SHGVE.....IRGCELTK.....RIC.....Pdvke.ATE..EDWATEYLDLILAVKVV.
  44 FR...EKGVElrg..CERTRELI.....DVM.....P.....ATE..DDWHTEYLAAILSIRVV.
  45 FR...EKGVElrg..CERTRAII.....EAV.....A.....ATE..EDWSTEYLAPILSIRVV.
  46 YL...DKGVE.....LRGDPASQ.....AII.....Pemke.ARE..EDWYTEYLAPVLSVRVV.
  47 LK...ELKVQirgc.AATQKIVK.....DIV.....P.....ATD..EDFGKEFLDLILSVKVV.
  48 MA...ESGVTlh8alTQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  49 FR...EKGVElrg..CERTRELI.....DVI.....P.....ATE..DDWHTEYLDAILSIRVV.
  50 ME...EQGVTlh8amVFLKDGAA.....KVV.....D.....VTE..ADYRDEWLSLDMNVEIV.
  51 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  52 MA...ESGVTlh8alTQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  53 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  54 MA...ESGVTlh8alAQLQTGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  55 LR...EAGVTihgd.ERVRSYDS.....SVV.....P.....ATE..EDWATEYLSLDLAVRVV.
  56 YD...RHGVE.....LRGCPKTQ.....ALI.....Dcqp..ATE..EDWSTEYLAPILSVKVV.
  57 MA...ESGVTlh8alAQLQTGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  58 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  59 LM...TKGVE.....IRGCSKTV.....EIC.....Kqn8keATE..DDWYTEYLDLIIGVKVV.
  60 YR...DKQVElr9raVLADAGVG.....PLG.....D.....ATE..EDWRTEYLAPVLAIKVV.
  61 MA...ESGVTlh7tvMQALHGPA.....KLV.....A.....LKP..EELDNEFLSLDLNVVVV.
  62 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  63 LH...EHGVE.....LRGCARAL.....QWL.....Pegkp.ADD..ADWATEYLGPVLAVRVV.
  64 LV...EHGVSlrad.ARALEYLE.....TAA.....L.....AED..TDWDTEYLDYILAVKVV.
  65 MK...QHKVE.....LRGCPATC.....ALT.....Ddava.ATE..ADWDEEYLDLILAVRVV.
  66 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  67 LK...GAGVEirgc.ERSREIVP.....DIL.....P.....ARE..EDWDEEYLDLILAVKVL.
  68 MA...ESGVTlh8alAQLQTGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  69 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
  70 FR...EKGVE.....LRGCERTR.....DLI.....Dvip..ATE..DDWHTEYLAAILSIRVV.
  71 YR...DKQVElr9rtVLADAGVG.....PLV.....D.....ATE..EDWHTEYLAPVLAIKVV.
  72 LH...EHGVE.....LRGCARAL.....QWL.....Pegkp.ADD..ADWATEYLGPILAVRVV.
  73 LR...KHGVEvrgc.EKTREIVP.....DVV.....P.....ATE..DDWPTEYLDLIIAIKVV.
  74 YR...DKQVElr9raVLAEAGVG.....PLV.....D.....ATD..EDWHTEYLAPVLAIKVV.
  75 YR...DKQVElr9rtVLADAGVG.....PLV.....D.....ATE..EDWHTEYLAPVLAIKVV.
  76 YR...DKQVElr9raVLADAGVG.....PLV.....D.....VTE..EDWHTEYLAPVLAIKVV.
  77 LI...SKGVE.....IRGCSETR.....ALV.....Pqakp.ATE..EDYYTEYLAAIISVKVV.
  78 YR...DKQVElr9raVLADAGVG.....PLV.....D.....ATD..ADWHTEYLAPVLAIKVV.
  79 MA...AAGVTlh8alPLLQGGPA.....TVV.....P.....VNA..EDYDDEWLSLDLNVLLV.
  80 LA...GKGVEm11ilQAAGVPAD.....KLR.....P.....AVE..SDWYEEYLGPIIAVKVV.
  81 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
  82 LR...EHGVE.....LRGCARAL.....QWL.....Pegkp.ADD..ADWATEYLGPILAVRVV.
  83 LR...EAGVTihgd.ERVRSYDS.....SVV.....P.....ATE..EDWATEYLSLDLAVRVV.
  84 YR...ESEVElrgc.EATRRLIP.....DAV.....P.....ATK..EDWSTEYLDAIVSIRIV.
  85 LR...KHGVEvrgc.EKTREIVP.....DVV.....P.....ATE..DDWPTEYLDLIIAIKVV.
  86 FR...DAGVE.....LRVCERSR.....SLL.....Pdail.ATE..ADWGTEYLAPILSLRMV.
  87 IV...EADNAm11qaILNDNTIL.....KGH.....Lsa...ATA..EDWDTEYLAPILAIKIL.
  88 LA...GKGVEm11ilQAAGVPAD.....KLR.....P.....AVE..SDWYEEYLGPIIAVKVV.
  89 LT...DLKVE.....LRGDDCVR.....QFA.....Pqakk.ATE..EDWQAEYLELILAVRVV.
  90 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
  91 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
  92 LG...KAGVEl12ikENPKLSFV.....NAK.....P.....ATE..EDYYEEFLDLILAVKVV.
  93 LG...KAGVEl12ikENPKLSFV.....NAK.....P.....ATE..EDYYEEFLDLILAVKVV.
  94 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
  95 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
  96 FA...AKGVEmr9kaLLAAVPGA.....KLV.....D.....ATE..ADWAEEYLAPVISIKLV.
  97 LN...QADCVlr7etIRLVGEVA.....PVI.....P.....ATE..EDWDTEYLAAILAIRVV.
  98 YQ...QAGVElrgc.ERTRALAP.....AIP.....A.....ATE..ADWRAEYLAPILAIRIV.
  99 LR...DAGIEvrgc.ERTRALID.....EAV.....P.....ATE..EDWTTEYLGPTLAVRVV.
 100 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
 101 YR...EKGVElr9raVLEAAGVG.....PLV.....D.....ATD..EDWRTEYLAPVLAIKIV.
 102 YL...DKGVE.....LRGDRSSC.....AIV.....Vkmtq.VTE..DDWKTEYLAPILSVRIV.
 103 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
 104 LV...DSGVQllgc.KKTCTFLD.....TIK.....P.....ATD..EDYHNEYLDMVLNIKVV.
 105 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 106 YQ...EKGVElr9raMLEAAGFS.....GLV.....D.....AHE..EDWRLEYLAPILAIKTV.
 107 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 108 WS...KAGVEir9lkILENTFGC.....KLI.....P.....ATP..DDWGKEFLALIAAVKVV.
 109 YQ...AVGVE.....LRGCERTC.....ELV.....Pfanq.ASS..EDWATEYLAPILAVKIV.
 110 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 111 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 112 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 113 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 114 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 115 LN...TRGVE.....IRGCSKVV.....EIL.....Sgvkk.AED..SDWATEFLSPVLAIKVV.
 116 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 117 LQ...KYNVE.....LRGDEKVC.....EIL.....GdkatlATA..EDWDTEYNDYIIAIKIV.
 118 YR...EKGVElr9raVLEAAGVG.....PLV.....D.....ATD..EDWRTEYLAPVLAIKIV.
 119 LH...RLGVRfs8sfALLDGLGF.....DVT.....L.....AKA..EDFGIEWLSLTLGIKVV.
 120 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 121 YS...DIGVE.....LRGCEKTM.....AIL.....Gdina.ATE..EDWATEYLAPVLSIKVV.
 122 MH...AFGVTlh8alPYLAQGKA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 123 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 124 YQ...DKGVElr9raTLEAAGFG.....GLK.....D.....ATE..ADWHTEYLAPILSIRTV.
 125 LH...RLGVRfs8sfALLDGLGF.....DVM.....L.....AQS..EDFGIEWLSLTLGIKVV.
 126 LH...RLGVRfs8syALLDGLGF.....DIS.....P.....ATE..QSFATEWLSLALGIKVV.
 127 IV...AADDAm13ilQDNAKLGG.....HLS.....D.....ATD..SDWDTEYLAPILAVKII.
 128 LK...ESNQSve6adEEALQLLE.....NAV.....A.....ASE..SDYATEFLDYIMSVKVV.
 129 FL...EKEVE.....LRGDEAAC.....ALVsrmk.P.....AVE..EDWYAEYLAPILSVRIV.
 130 YR...EKGVElr9raVLEAAGVG.....PLV.....D.....ATD..EDWRTEYLAPVLAIKIV.
 131 MH...TFGVTlh8amPYLAEGKA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 132 YQ...EKGVElr9raTLEAAGFS.....GLV.....D.....ATE..EDWRLEYLAPVLAIRTV.
 133 MH...AFGVTlh8amPYLAEGQA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 134 IL...KIQSVefradERALKLME.....KAV.....P.....ASP..EDFATEFLDYIMSVKVV.
 135 LH...RLGVRfs8syALLDGLGF.....DIS.....P.....ATE..QSFATEWLSLTLGIKVV.
 136 YR...EKGVElr9raVLEAAGVG.....PLV.....D.....ATD..EDWRTEYLAPVLAIKIV.
 137 WS...KAGVEir9lkILENTFGC.....KLI.....P.....ATP..DDWGKEFLALIAAVKVV.
 138 MH...AFGVTlh8amPYLVEAKA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 139 LK...ESNQSve6adEEALQLLE.....NAV.....A.....ASE..SDYATEFLDYIMSVKVV.
 140 IS...KIQSVefradERALKLME.....KAV.....P.....ASP..EDFATEFLDYIMSVKVV.
 141 IS...KIQSVefradERALKLME.....KAV.....P.....ASP..EDFATEFLDYIMSVKVV.
 142 LH...RLGVRfs8syALLDGLGF.....DIS.....P.....ATE..QSFATEWLSLTLGIKVV.
 143 LA...EKDVT.....IHACNKSV.....GYF.....Dgade.ISV..DDFGQEYLALEIAVRTV.
 144 WS...KAGVEir9meILENASSC.....KLI.....P.....AAA..DDWGKEFLALVAAVKVV.
 145 LK...EYNVE.....LRADERAR.....EIL.....Kdska.ATE..SDWEDEFLDFILAIKVV.
 146 MH...TLGVTlh8arPYLADGPA.....TCV.....A.....VTE..ADYHDEWLSRDLNVKLM.
 147 MA...ASGVTlh8amPYLTSGPA.....NVV.....A.....VED..ANYNDEWLSNDLNVTLV.
 148 LS...AKHVK.....FHADPTAL.....AIL.....Qsv8epVQA..HQLRQEWLSYDLNVVIV.
 149 LH...RLGVRfs8sfSLLDGLGF.....DVT.....L.....AKA..EDFGIEWLSLTLGIKVV.
 150 LT...AKGVE.....IRGCAETQ.....AIV.....Pnaia.ATE..EDYYTEYLAPIISVKVV.
 151 LK...EYNVE.....LRADERAR.....EIL.....Kdska.ATE..SDWEDEFLDFILAIKVV.
 152 LK...EYNVE.....LRADERAR.....EIL.....Kdska.ATE..SDWEDEFLDFILAIKVV.
 153 IV...KADDAm12ai-LNDNTTL.....KGH.....Lsa...ATA..EDWDTEYLAPILAIKIL.
 154 MH...AFGVTlh8amPYLADGKA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 155 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 156 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 157 YQ...DKGVElr9raTLEAAGFS.....GLK.....D.....ATE..ADWHTEYLAPILSIRTV.
 158 IV...KADDAm12ai-LNDNTTL.....KGH.....Lsa...ATA..EDWDTEYLAPILAIKIL.
 159 LI...ERGVEirgd.SITQSLIL.....KAK.....T.....ATD..EDFAAEYLGPIISVKVV.
 160 LK...KRGVElrgd.QKALAMDS.....SIV.....L.....ASE..EDWGTEFLSLTLAVKLV.
 161 LA...SRGVEmrvd.ERASAYVP.....DGV.....P.....ATD..ADFAAEFLGPQISIAVV.
 162 LI...AAGVEvra..DEGLSGIA.....GTV.....P.....AGA..EDWGREYLDSIIAARVV.
 163 LI...DAGCE.....VRGDETAQarhd.GIV.....P.....ATE..EDWSTEYLAPIVSMRVV.
 164 LA...DAGVTvh8vlAYAKDSKA.....TVV.....E.....ATT..EDWDTEYLSYDIAAAVV.
 165 LK...ERGVElrgd.QRALALDS.....SIV.....L.....ASE..EDWGTEFLSLTLAVKVV.
 166 MH...AFGVTlh8amPYLADGKA.....KVV.....A.....VEA..ADYDDEWLSLDLNVDIV.
 167 LA...EKDVT.....IHADKRSV.....SYF.....Dgade.IAD..DAFGEEYLALEIAVRTV.
 168 LI...EAGVE.....VRAEG-LP.....GSL.....A.....ATE..ADWGKEYLDMIIAAKVV.
 169 LQ...DHGVE.....LRGDERAR.....AIV.....Psmha.ATA..EDWDTEYNDLIMAVKVV.
 170 LK...KRGVElrgd.QKALAMDS.....SIV.....L.....ASE..EDWGTEFLSLTLAVKLV.
 171 LI...AAGVE.....VRAGEGLK.....GSV.....V.....ATD..DDWGTEFLDSIIAAKVV.
 172 LT...AAGVE.....LRGCPQTV.....ALA.....Paakp.AAA..DDWGREFLDLILAVRVV.
 173 YA...AKGVEmr9raLLAGVAGA.....NLQ.....P.....VSE..QDWYEEYLAPIISIKVV.
 174 IN...KVHEVefradERSLKALS.....AGI.....P.....ATD..EDFGMEFLYYILSVKTV.
 175 LR...EQGVEvrgd.AATQAIVP.....DVV.....P.....ATD..ADWGTEYNDLIIAVKVV.
 176 YR...DKQVElr9raVLADAGVG.....PLV.....D.....ATE..EDWHTEYLAPVLAIKIV.
 177 YA...AKGVEm13haHPAIESIA.....NIV.....P.....ASE..QDWYEEYLAPVISIKVV.
 178 LA...ELGVEmrgc.SQSLPFSE.....HIV.....A.....ASE..EDWGTEFLRLCLCVKVV.
 179 YR...DKQVElr9raVLADAGVG.....PLV.....D.....ATE..EDWHTEYLAPVLAIKVV.
 180 LK...ESNQSve6adEEALQLLE.....NAV.....A.....ASE..TDYATEFLDYIMSVKVV.
 181 LK...TKEVKfh8alSILQGVSA.....DVK.....P.....VTE..QQLRNEWLTYDLNVVIV.
 182 LR...AAGCEihad.QEVLKVFF.....DAK.....P.....ATD..ADWVTEYLDAIIAVKLV.
 183 LH...CLGVRfs8shALLDGLGF.....DIE.....L.....ATE..QSFATEWLSLTLGIKVV.
 184 LS...AKNVK.....YHAKPTAL.....NIL.....Kqa8ceVTE..KELRKEWGSLDLNVVVV.
 185 LA...TKNVK.....YHAKSTAL.....NIL.....Kqa8ceVTE..KELRKEWGSLDLNVVVV.
 186 LA...AAGVEm11iiEHAGIANA.....QLV.....H.....ATD..EDWDTEYLALKIGIKVV.
 187 LH...AHGIE.....VRGCPRTV.....AFD.....Pkvks.AGE..EDWGKEYLDKIIAIKVV.
 188 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 189 IG...KQVEIrg...CQHTQSLI.....GGK.....L.....AIE..DDWAEEFLDYIVAVKVV.
 190 LI...DAGCEvrgd.EAVQAVDG.....RVK.....P.....ATP..LDWDTEYLDAIIAAKVV.
 191 LD...DAGVE.....LRGDDRTR.....QLL.....Pgvga.ATE..DDYAAEYLDLTLAARVV.
 192 LK...DRGVE.....LRGDQKALaids.SIV.....L.....ASE..EDWGTEFLSLTLAVKLV.
 193 FR...DYGVE.....IRGCEKTC.....AIL.....Pyaak.ATE..EDWGTEYLDLIISAKVV.
 194 LA...MGGVEiha..EEGLPGPD.....SMQ.....V.....ATS..EDWGKEYLDAIIAAKKV.
 195 LN...EHGIQvhgd.EKAVQMIP.....GAR.....P.....AGE..ADWQNEYLSLDLAVKVA.
 196 IN...QIHPVefradDRAQKILK.....NAQ.....P.....ASQ..EDYATEFLDYIISVKIV.
 197 LI...DAGCEvrgd.AVAQAADA.....RVI.....P.....ASD..ADWSTEYLDAIISVGVV.
 198 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 199 LS...AKNVK.....YHAKSTAL.....NIL.....Kqa8ceVTE..KELRKEWGSLDLNVVVV.
 200 LK...ERGVE.....LRGDSKSL.....AID.....Ssial.ASE..EDWETEFLSLTLAVKVV.
 201 LM...EHGVQ.....LRGDETAC.....QLVstir.P.....VTE..EDWDTEYNDLIMAVKIV.
 202 LA...AGGCE.....IRGSAEVL.....ALY.....Paakp.ATE..EDWSTEYLDAIISVALV.
 203 LI...DAGCEvrgd.QQAMQADG.....RVL.....P.....AAE..ADWSTEYLDAIISVKVV.
 204 LL...KAGVEvra..EGELAQVP.....GTV.....P.....AQP..DDFGREFLDMIIAAKVV.
 205 LA...TKNVK.....YHAKSTAL.....NIL.....Kqa8ceVTE..KELRKEWGSLDLNVVVV.
 206 LA...AGGCE.....IRGSAEVL.....ALY.....Paakp.ATE..EDWSTEYLDAIISVALV.
 207 LI...DAGVE.....VRGDKSIE.....EIE.....Gvtr..ASE..SDWGQEFLDMIIAARVV.
 208 LA...ADGVS.....FRGCPQSV.....AIN.....Atcqv.AQA..SDFDTEWLSLTLGIKVV.
 209 LH...DAGVT.....VHGDETVC.....AVD.....Prvlp.ATD..DDWAAEYLSLDMAVAVV.
 210 LA...AGGCE.....IRGSAEVL.....ALY.....Paakp.ATE..EDWSTEYLDAIISVALV.
 211 LL...KAGVEvra..EGELAQVP.....GTV.....P.....AQP..EDFGREFLDMIIAAKVV.
 212 LE...EAGVEirgd.EAVCTMLP.....SAV.....P.....ARE..TDWGTEFLAPVVSIKTV.
 213 LA...AGGCE.....IRGSAEVL.....ALY.....Paakp.ATE..EDWSTEYLDAIISVALV.
 214 LS...GAGVVlh8agSAAEAAGI.....PHV.....P.....ATE..EDWDTEYLALEMGVAVV.
 215 LL...DAGVEvra..EGELAKVP.....GTV.....P.....AEP..SDFGQEFLDKIIAVKLV.
 216 MQ...KAGVE.....LRGDEATC.....ALI.....Parp..ATP..EDWQTEYLDLILTVKVV.
 217 LL...KAGVEvra..EGELAQVP.....GTV.....P.....AQP..EDFGREFLDMIIAAKVV.
 218 MA...ESGVTlh8alAQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
 219 LL...DAGVEvra..DGALTEIE.....GTV.....P.....ATA..DDWGHEYLDMIIAAKTV.
 220 LQ...DAGVT.....VHGGF---.....-AR.....D.....ATE..DDLRREYLSMDIAVAVV.
 221 MK...ALDVT.....LHTDDLQKte...GIE.....P.....LDD..ARMRQEWLSLDLNVVVI.
 222 LG...NDGVE.....FRACPASL.....PLLgdsaiP.....MKD..EDNGQEFHDLILLVRIV.
 223 LN...GKVTFvv6kaKAYMTKAE.....QVR.....D.....ASE..GDFDTEWLSYTLGVKVV.
 224 LA...KAGCAlrgd.EETRAFSE.....RVG.....P.....ATA..EDWDTEYLDAIVSIRVV.
 225 LM...EHGVQlrgd.EMACQLVS.....TIR.....P.....VTK..EDWDTEYNDLIMAVKIV.
 226 LL...DAGVEvra..DGALTEIE.....GTV.....P.....ATA..DDWGHEYLDMIIAAKTV.
 227 LV...DAGCE.....VRASDDLA.....SVM.....Pglka.ATD..EDWATEYLDAIISARLV.
 228 FR...DYGVE.....IRGCEKTC.....AIL.....Pyaak.AKE..EDWGIEHLDLIISAKVV.
 229 LN...GKVTFvv6kaKAYMTKAE.....QVR.....D.....ASD..GDFDTEWLSYTLGVKVV.
 230 LQ...ERHVElrgd.KRTLKILP.....NIV.....S.....ATE..IDWETEYSDYILSIKIV.
 231 LA...ERQVE.....LKGDERTL.....QIL.....Peiaa.ATA..IDWETEYSDFILSIKIV.
 232 ML...RVEQVkiha.GPRFASYL.....TFS.....P.....SEV..KSLRTEYGDLECCLEVV.
 233 LA...AAGVEiha..AGGLVGPE.....EMT.....A.....AND..DDWGKEFLDKVIAAKPV.
 234 MN...DKVTFvt6kaKALMPQAT.....QIR.....D.....AVE..GDFDTEWLSYTLGVKVV.
 235 LA...EAGVTvh8vmAHAKDSGA.....NVV.....E.....ATP..EDWETEYLSYDIAAAVV.
 236 LK...EYDVE.....LRADERAK.....EIL.....Qeaka.ATE..SDWEDEFLDFILAIKVV.
 237 LA...ERQVE.....LKGDERTL.....QIL.....Peiaa.ATA..IDWETEYSDFILSIKIV.
 238 LG...EKGVSlrg..DSGTQKLI.....DCE.....P.....ATE..ADWCTEYSDLILSIKIV.
 239 YA...AKGVEm27aiDSAVELKP.....VLV.....L.....AQE..SDWFEEYLAPIISIKVV.
 240 LK...EYDVE.....LRADERAK.....GIL.....Qeaka.ATE..SDWEDEFLDFILAIKVV.
 241 LT...EKGVE.....LRGDQMIC.....ELE.....Pnakq.AEE..ADWGAEYLAPILSVKTV.
 242 LN...KSNVEfv8aySFLEGKAA.....TLR.....H.....AAD..GDFDTEWLSFTLGVKVV.
 243 LA...AAGCE.....IRGGEDVR.....ARF.....Psais.ASE..EDWRTEYLDAIISVKLV.
 244 LG...DCEVRge...AEAREIDS.....RIK.....P.....ATD..EDFYTEYLDTILSVKLV.
 245 LH...NAGCE.....IRGTAEIQ.....KID.....Peaka.VSE..EDWGTEYLDAVLSVRFV.
 246 FR...AAGVE.....LRGCERTR.....RIV.....Adcaq.AVE..EDWYAEYLDLILAIRVV.
 247 LA...EREVE.....LKGDERTL.....QIL.....Peiaa.ATA..IDWETEYSDFILSIKIV.
 248 LE...KRQVElrgd.RATQQILS.....SVK.....E.....ATD..LDWATEYSDLVLSVKVV.
 249 LK...IHKVKvnac.KTAFAFFE.....DAT.....L.....LAD..DQFGEEYLSLEIAIKVV.
 250 LR...PYGVQlrgd.HATCTLLP.....DVL.....L.....ATD..ADYAAEYLDLILAIRIV.
 251 LT...SHEVQlkg..DQLTQTYL.....DIE.....A.....ATE..EDWKTEYSDLILSIKVV.
 252 LH...SLGVRfh8tlPYLDGLGF.....DVT.....A.....AHD..ESFSTEWLSLTLGIKVV.
 253 ML...RVEQVkiha.GPRFASYL.....TFS.....P.....SEV..RSLRTEYGDLECCLEVV.
 254 LP...VKYYAdktaySILHHAGA.....EVL.....A.....VTE..DDLRKEWLCTNLNVVIV.
 255 GV...ELRGD.....QRLASAYP.....FIS.....E.....ATE..DDWYTEYLAPILAVKLV.
 256 LR...PYGVQlrgd.HATCTLLP.....DVL.....L.....ATD..ADYAAEYLDLILAIRIV.
 257 LA...EHKVKinac.TQSGGYFE.....NCT.....Y.....MEE..DDFGQEYLDLEIAIRQV.
 258 LR...EHGVT.....IHGDL--P.....GLV.....P.....ATD..TDWGEEYLTLDIALKVV.
 259 YE...EVGVElr9yaIAEKLGSA.....NIA.....K.....ATE..DDWKTEYNDFILSIKLV.
 260 LI...DAGCEvrgd.DAVQRADA.....RVK.....P.....ATD..QDWDTEYLDAVIAAKVV.
 261 LR...IKEVQiagd.EQIKAVAP.....FVK.....P.....ADE..SDWGTEYLDLQVAMKIV.
 262 LI...EAGCEvrgd.DVVQKTDA.....RVK.....P.....AND..DDWDTEYLDAIIAAKVV.
 263 LR...PYGVQlrgd.HATCTLLP.....DVL.....L.....ATD..ADYAAEYLDLILAIRIV.
 264 LN...GKVAFva6kaKALMSSAA.....ELR.....D.....AQA..GDFDTEWLSYTLGVKVV.
 265 LN...KSNVEfv8aySFLEGKAA.....ALR.....H.....VAD..GDFDTEWLSFTLGVKVV.
 266 LN...GKVAFva6kaKALMHAAA.....ELR.....D.....AQA..GDFDTEWLSYTLGVKVV.
 267 LN...GKVAFva6kaKALMSSAA.....ELR.....D.....AQA..GDFDTEWLSYTLGVKVV.
 268 LA...AHKVRinvs.KNAQQYFE.....HAN.....V.....ISD..DDFGQEYLDLEIAIRQV.
 269 LK...KRGVElrgd.QKALAMDS.....TIV.....L.....ASE..EDWGTEFLSLTPAVKLV.
 270 LI...DAGCEvrgd.AAVQAVDA.....RVK.....P.....ATD..DDWDTEYEDAIIAARVV.
 271 LK...KRGVElrgd.QKALAMDS.....TIV.....L.....ASE..EDWGTEFLSLTPAVKLV.
 272 LQ...HAGVT.....--------.....VHL.....D.....PDE..ADLRREYLSLDIAVAVV.
 273 LL...DAGCE.....VRGSQPVR.....NVV.....Eglea.ATE..EDWRTEYLDAIISVAVV.
 274 LL...DAGCE.....VRGSQPVR.....NVV.....Eglea.ATE..EDWRTEYLDAIISVAVV.
 275 LL...EKGVEvra..GDELAKVP.....GTV.....R.....ATD..EDWGREFLDRIIAVKLV.
 276 LL...AAGVRl17rpDLAGAGPA.....AVE.....P.....ATE..EDWAAEYLDLCLAVKVV.
 277 FN...EHKVK.....VHGCERSL.....QYF.....Dnasl.ATQ..DDWHAEYLAMEIAVRIV.
 278 MN...KAKVEli8ayNLLEGKAA.....SLR.....K.....IVE..GDFDTEWLSYTLGIKVV.
 279 LA...SHKVKinac.SRAAKYFT.....GCT.....V.....LDD..SEFGQEYLDLEIAIRIV.
 280 FN...SNDVK.....LIGDKKSF.....QLG.....Vafe..ANY..EDWQTEYLDLILSIKIV.
 281 LA...AAGVE.....VRGDRELArhd..GVV.....P.....ADP..DDYGREFLDMICAAKLV.
 282 LH...EKGVS.....LRGDAAAQ.....TIV.....Pmea..ATE..EDWRTEYSDLVLAVRLV.
 283 LG...DAGVS.....FRACPRAL.....PLL.....AphgvpMAE..TDPGTEFHDLVMVVKVV.
 284 LL...DHGVEvr6aeTLALAQGM.....QVA.....E.....ATS..ADWDEEYLRLCMAVKVV.
 285 LI...EAGCE.....VRGDSDVQ.....GVD.....Prvrs.AAD..SDWNTEYGDAIISARVV.
 286 MN...DKVTFvt6kaKELMEQAK.....QVR.....D.....AIE..GDFDTEWLSYTLGVKVV.
 287 LI...EAGCE.....VRGDSDVQ.....GVD.....Prvrs.AAD..SDWNTEYGDAIISARVV.
 288 ML...RTEQVrphiiVYICHSFL.....KGH.....P.....SEV..KSLRTEYGDLECCIEVV.
 289 LA...KHQVKincc.ANTQQYFA.....AAQ.....V.....LSD..EEFGQEYLDLELAVRQV.
 290 LQ...QQGVKlv8slGALAAAGI.....EAE.....A.....ASD..ESFGTEWLSLTLGVKVV.
 291 LQ...GAGVT.....VHGGL---.....-SG.....D.....PDK..ADLCREYLSMDIAVAVV.
 292 GC...EVRGD.....DAVQGMDA.....RVK.....P.....AQE..ADWDTEYLDAIVSIRMV.
 293 LS...ALGVSfh8aeAIGKDAGT.....VTH.....Q.....ASD..ETFGTEWLSLNLGVRVV.
 294 MQ...SHDIK.....IHGDSVVM.....EKF.....Ppaik.AVE..RDWEKEYLSSEISVKIV.
 295 LQ...EKGCEirat.EDIVFLLP.....DVK.....L.....ASE..EDWSQEYLDAILSVKTV.
 296 LE...EKGTE.....IRGCEKSL.....KIL.....Ggkr..ASE..EDFHTEYGENILNVRVV.
 297 ML...RTEQVrpha.XXXXASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 298 LT...DAGCE.....IRASAAVL.....KVA.....Pglkt.ATE..EDWSTEYLDAIISVATV.
 299 LL...ESGVE.....VRADAALLgia..GTV.....P.....ATD..EDWGREYLDSIIAVKVV.
 300 LR...ERKVElrgd.AATRAVLP.....EIA.....P.....ASD..DDYAAEFLDLILAMRVV.
 301 LR...ERKVElrgd.AATRAVLP.....EIA.....P.....ASD..DDYAAEFLDLILAMRVV.
 302 MN...KAKVTfv8ayNLLEGKAS.....SLR.....K.....ITE..GDFDTEWLSYTLGIKVV.
 303 MS...DKVTFva6kaKALMAQAT.....QIR.....D.....AVE..GDFDTEWLSYTLGVKVV.
 304 LR...ERKVElrgd.AATRAVLP.....EIA.....P.....ASD..DDYAAEFLDLILAMRVV.
 305 LR...ERKVElrgd.AATRAVLP.....EIA.....P.....ASD..DDYAAEFLDLILAIRVV.
 306 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 307 LR...PYGVQlrgd.HATCTLLP.....DVV.....L.....ATD..ADYAAEYLDLILAIRIV.
 308 ML...RTEQVrpha.XXXXASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 309 LR...EAGCEirat.DEVRQRYP.....TAE.....P.....ASD..ADFVTEYLDAIISVALV.
 310 YI...KAGVElr9yiLLAEKGLS.....PLS.....K.....ATE..EDWSLEYNDLILSIKLV.
 311 ML...RTEQVrpha.XXXXASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 312 LR...EKGVE.....LRGDPLCR.....ELV.....Pdlip.ATE..DDWSTEYADLILSIKVV.
 313 LD...KAGVV.....LHADTTVA.....ALA.....Pet7krVSR..RDWAKEYLDLELAVKVV.
 314 LI...DSGCE.....VRGDQTVQ.....QVD.....Prvkp.ASD..EDWDTEYLDAVIAAKLV.
 315 LR...PYGVQlrgd.HATCTLLP.....DVV.....L.....ATD..ADYAAEYLDLILAIRIV.
 316 LE...NAGVE.....IRGDELVC.....ELH.....Psskq.ASK..EDWETEFLAPVLSVKTV.
 317 FN...ESGVK.....LLGDQVCN.....SLG.....Ienk..AEE..SDWSTEYLDLVLSVKVV.
 318 LR...DAGVTvhgd.ARVAAFDP.....TVV.....P.....ATE..EDWDREYLSLDIAAAVV.
 319 LQ...DAGVT.....VHA-----.....---.....D.....PTE..EELRAEFLSMDIALAVV.
 320 FL...QAGVR.....LLGDSASR.....ALG.....Vees..ASE..EDWATEYLDLILSVKVV.
 321 ML...RTEQVrpha.XXXXASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 322 LQ...QAGVE.....LRGDAIAC.....DLV.....Pmsl..ASE..ADWATEYCDLILAIKVV.
 323 YL...KAGVElr9ysLLSEKGLS.....PLS.....R.....ATD..EDWSLEYNDLILSIKLV.
 324 LA...ESGVT.....IHADERAR.....QLF.....Pdala.AED..DAWSVEHLSLDIAVRVV.
 325 LR...DAGVT.....VHGDETVRavdp.SAV.....P.....VTD..EDWATEYLSLDMAVGVV.
 326 LR...ERKVElrgd.AATQAVLP.....DIA.....A.....ASD..DDYAAEFLDLILAIRVV.
 327 IN...KVHEIefradERALKVLS.....AGI.....P.....ATD..DDFGTEFLDYILSVKTV.
 328 LR...ARNVE.....LRGDAATR.....AVL.....Peiaa.ASD..DDYAAEFLDLILAIRVV.
 329 LA...EHQVK.....INACPPAA.....AYF.....Dacty.MAE..EDFGQEYLDLEIAIRQV.
 330 MR...EKGVElrac.PRALPLLK.....EAV.....P.....ARE..DEWDREYLDLVLRVKVV.
 331 ML...RTEQNgg6llSGVRSHSD.....TSL.....P.....SEV..KSLRTEYGDLECCIEVV.
 332 LA...GKVTLva6saKSLLADFE.....DQR.....D.....AVE..GDFDTEWLSYTLGVKVV.
 333 LA...GKVTLva6saKSLLAGFE.....DQR.....D.....AVE..GDFDTEWLSYTLGVKVV.
 334 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLELCIEVV.
 335 LT...AAGVT.....V-------.....-HA.....D.....PSE..DELRAEFLSMDIALAIV.
 336 FD...KANTKlkg..CLKTQEII.....DVE.....S.....VTE..EDYDTEYLDNILNMRVV.
 337 LA...EHQVK.....INACPPAA.....AYF.....Dacty.MAE..EDFGQEYLDLEIAIRQV.
 338 LQ...EKGCE.....IRATEDIV.....SLV.....Ptfal.ACE..EDWSQEYLDAILSVKTV.
 339 FN...SNDVK.....LIGDKRTV.....ELG.....Vkye..ASV..EDWQTEYLDLILSIKIV.
 340 ML...RTEQVrpha.XXXXASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 341 LI...DAGCE.....VRGDSVVQ.....SID.....Prvkp.ATD..NDWDTEYGEAIISARVV.
 342 FS...SEGVT.....LKGDTKSQ.....ALG.....Vknk..ADE..SDWSKEYLDLILSIKIV.
 343 GC...EVRGD.....DAVRAADA.....RVK.....P.....ASN..EDWDTEYLDAVIAAKVV.
 344 LI...KAGCE.....LRGDAAAR.....AIE.....Ptmkk.ATV..EDWTTEYLAPILSVAVV.
 345 LI...DAGCEvrgd.AIVQHADA.....RVK.....P.....ATD..QDWDTEYLDAVIAAKVV.
 346 LS...AKGVS.....LVGNEGAC.....TLD.....Priaq.ANE..DDWSTEYLDLRLAIRVV.
 347 GC...EVRGD.....RDVAALSP.....HVE.....S.....ASA..GDWDTEYLDAIVSIAMV.
 348 MR...EKGVElrac.PRALPLLK.....EAV.....P.....ARE..DEWDREYLDLVLRVKVV.
 349 LR...ARNVE.....LRGDAATR.....AVL.....Peiaa.ASD..DDYAAEFLDLILAIRVV.
 350 LK...TAGVN.....LYCGPVAH.....KVL.....Gy....PKA..DSLHLEYSSMACTVEIV.
 351 LR...EKGVE.....LRGDPRCR.....QLV.....Pdlip.ATE..DDWSTEYADLILSIKVV.
 352 LA...EANVVl11iiSGAAIEGL.....DLN.....H.....AAE..EDWDTEYLALKMGIKVV.
 353 LK...AAGVN.....LYCGPVAH.....KVL.....Gy....PKA..DSLHLEYSSMACTVEIV.
 354 LA...EANVVl11iiSGAAIEGL.....DLN.....H.....AAE..EDWDTEYLALKMGIKVV.
 355 LQ...AAGVT.....VHID----.....---.....-.....PTE..DELRAEFLSMDIALAIV.
 356 LA...EHQVK.....INACPPAA.....AYF.....Dacty.MAE..EDFGQEYLDLEIAIRQV.
 357 LE...AAGVR.....LRGDSRSQ.....ALG.....Vaea..ATE..DDWDREYLDLILSVRVV.
 358 ML...RTEQVriha.GPQFASYL.....TFS.....P.....SEA..KSMRTEYSDLECCLEVV.
 359 LR...TEGVT.....MFGGPRID.....ALQ.....Efni..QAT..QTFNREYSSPACTVEIV.
 360 LA...EANVVl11iiSGAAIEGL.....DLN.....H.....ATE..EDWDTEYLALKMGIKVV.
 361 LL...EAGCEvrgd.DAVQRVDP.....RVK.....P.....VAE..EDWDTEYEAAIMSVKLV.
 362 LA...EHQVKinac.SKAAAYFE.....ACT.....A.....MAE..EDFGQEYLDLEIAIRQV.
 363 LL...EAGCEvrgd.DAVQRVDP.....RVK.....P.....VAE..EDWDTEYEAAIMSVKLV.
 364 LQ...KKGCE.....IRATEDIV.....FLM.....Pdakl.AFE..EDWSHEYLDAIVSVKTV.
 365 LQ...ANGVT.....LYGGPKAS.....GKL.....Ni....PEV..KSFHHEYSSKACTVEIV.
 366 LR...SEGVT.....LYGGPKAS.....SLL.....Nv....PLA..RSLHHEYCSLACTVEIV.
 367 LV...RGRIEa10rlDPQAARYI.....GGE.....A.....AGA..DDFDTEFLDYILAVKTV.
 368 LQ...TKGVS.....LYGGPKAS.....SLL.....Mi....PEA..RTFRHEYSSLACTVEVV.
 369 LK...TEGVN.....IYGGPIAH.....KAL.....Gf....PKA..VSFHHEYSSMACTVEFV.
 370 LK...TEGVN.....IYGGPIAH.....KAL.....Gf....PKA..VSFHHEYSSMACTVEFV.
 371 LA...EHQVKinac.SKAAAYFE.....ACT.....E.....MVE..EDFGQEYLDLEIAIRQV.
 372 FR...KAGVV.....LRGDAASV.....ALGvse..P.....ATD..DDWRTEYLDLILAVKVV.
 373 LE...KEGVV.....IYGGPVAH.....DTL.....Kl....PKV..DSFHHEYNSMACTLEFV.
 374 LA...GQVELrad..SQAQALLN.....QAT.....P.....AGE..QDFDTEFLDFILAVKVV.
 375 LR...QEGVKina..---DSQAA.....TYF.....Dnatv.LGD..DEFGEEYLDLEIAIRVV.
 376 LI...ESGCEvrgd.AEMQRVDT.....RVK.....P.....VAE..EDWSTEYGEPIIAAKVV.
 377 LA...AKGCT.....FRADDRAR.....AIV.....Ptlaa.ASA..DDFDTEWLDAVLSVAVV.
 378 MAgdcELRGD.....ETAVQLDD.....RIT.....P.....ASE..DDWNTEYLGPIASVKVV.
 379 LR...KAGVTlh7rvRAALPASI.....ESV.....P.....ATD..EDWATEYMDLDLAVGMV.
 380 YL...SAGVElr9yaLLEKRGLS.....PLS.....R.....ATE..EDWSLEYNDLILSIKLV.
 381 FD...SNDVK.....LIGDKKSV.....ELG.....Lkyk..AIE..EDWKTEYLDLILSIKIV.
 382 MA...GRVELva8ygLLKEFEGV.....SLR.....E.....AQE..GDFDTEWLSYTLGVKVV.
 383 FQ...AAGVT.....LRGDEHSR.....QHG.....Isda..ATD..EDWRTEYLDMILAVRVV.
 384 LK...REGVKins..GPKLNQML.....TFG.....P.....PQA..KSLKFEYGALECSIEVV.
 385 FE...KLGVT.....LLGDELSQsfg..IIT.....K.....AEE..SDWSTEYLDLKLSVKVV.
 386 LT...EAGVT.....IHADEIAL.....PHS.....Pgaia.VTA..EDYATEHMSLDVSVRVV.
 387 FA...AAGVK.....LRGDAESV.....ALG.....Vaea..ATE..EDWSTEYLDLILAVKLV.
 388 FQ...AEAVE.....LRGCPRAC.....ALG.....Vara..ASD..DDWGREFSDRILAVKVV.
 389 LQ...EAGVT.....VHGDERFQaed..GVL.....P.....ATD..EDYGQEYLSLDISAAVV.
 390 LK...TEGVN.....IYGGPIAH.....KAL.....Gf....PKA..VSFHHEYSSMACTVEFV.
 391 LA...QHGVEl12laDAPGHEAW.....NLK.....P.....ASP..TDFGCEFLALIVAIKIV.
 392 LQ...KEGVKvns..GPKLRKQL.....TFG.....P.....PAA..KSMKTEYGALECAIEVV.
 393 LK...REGVKins..GPKLNQLL.....TFG.....P.....PQA..KSLKFEYGALECSIEVV.
 394 LH...SKEVKinas.AQAASYFD.....NAK.....V.....IQD..DEFGEEYLDLEIAVGIV.
 395 LQ...IKGVV.....IHGGPRAS.....SLL.....Hi....PEA..RSLHHEYSSLACTIEIV.
 396 LK...HKNVK.....YHADPTAL.....SIL.....Ekq8siVQE..QQLRQEWGSLDLNVVIV.
 397 GC...ELRGD.....ARARAIDP.....RIA.....P.....AAD..NDWDTEYLEAILSVAVV.
 398 LK...REGVKina..GPRLNQQL.....TFG.....P.....PAA..KSLRHEYGALECCIEIV.
 399 LL...PLGVTlvaeeKAKAILGE.....RAI.....K.....AQA..DDFSREWLSLNLGVKVV.
 400 LQ...SNGVT.....LYGGPRAS.....KIL.....Ni....PEA..RSFNHEYCAKACTVEVV.
 401 LN...GKVAFvv6kaKALMNAAA.....ELR.....D.....AQA..GDFDTEWLSYTLGVKVV.
 402 LQ...SNGVT.....LYGGPRAS.....KIL.....Ni....PEA..RSFNHEYCAKACTVEVV.
 403 LQ...SNGVT.....LYGGPRAS.....KIL.....Ni....PEA..RSFNHEYCAKACTVEVV.
 404 LN...DAAQVkv6ck-NSIGFFP.....NAE.....L.....ATN..EDYQAEYLAQEIAVKVV.
 405 LI...KAGVE.....VRADGDLA.....KIK.....Gtti..AQP..DDFGHEFLDMICAAKLV.
 406 LA...DAGVE.....LRCDPTAL.....TIL.....Kra8vpARP..DDFGKEFLDKILAVRVV.
 407 LQ...SNGVT.....LYGGPKAS.....KIL.....Nl....PEA..RSFNHEYCSKACTVEVV.
 408 LR...EADVRvmfe.NEVWLKNW.....GIA.....D.....DGL..ADFSKEWGDKILNLKVV.
 409 GV...EVRGD.....DRIQALND.....RVT.....A.....ASA..NDWDTEYLDAIVSVAMV.
 410 LA...KEGVE.....LLLDPSSL.....ALY.....Pngkp.VKE..QDYLEEFLDLRLSVKTV.
 411 MS...ERGVTvhgd.EESIRLDP.....RIV.....P.....AAP..DEYDNEYLSLDLALRIV.
 412 LA...KEGVE.....LLLDPSSL.....ALY.....Pkgkp.VKQ..QDYLEEFLDLRLSVKTV.
 413 LK...HKNVK.....YHADPTAL.....SIL.....Ekq8siVQE..QQLRQEWGSLDLNVVIV.
 414 LV...RNRIEa10rlDPQAARHI.....G--.....-gea..AGA..DDFDTEFLDYILAVKTV.
 415 LR...TEGVT.....LYGGPKAS.....PLL.....Ni....PMA..RMLHHEYNSLACTVEIV.
 416 LV...AERKEa10rlDSKASQFV.....SGQ.....A.....AET..QDFDTEFLDYVLAVKVV.
 417 LL...AAGVE.....LRGDQKAR.....SID.....Srvig.ASA..EDWDTEYNDLIMAIKIV.
 418 LK...REGVK.....IYAGPRLN.....QQL.....Tfgp..PAA..KSLKHEYGALECCIEVV.
 419 FE...KFKVKih8alTYFNNSNL.....EIF.....K.....ANE..NTFDTEWLDFALSVKLV.
 420 LQ...REGVK.....LYGGPRAS.....GIL.....Ni....VET..SAFHHEYSSLACTVEIV.
 421 LH...EAGVVlh8slAAARAAGL.....PAQ.....P.....VTD..EDWAAEFHGLEIAVGVV.
 422 FK...KFKVKih8alAYFNNSNL.....KIF.....K.....ANE..NTFDTEWLDFALSVKLV.
 423 FE...KFKVKih8tlAYFNNSNL.....EIF.....K.....ANE..NTFDTEWLDFALSVKLV.
 424 FE...KFKVKih8alAYFNNSNL.....KIF.....K.....ANE..NTFDTEWLDFALSVKLV.
 425 LQ...SNGVT.....LYGGPRAS.....KIL.....Ni....PEA..RSFNHEYCAKACTVEVV.
 426 LD...EFNVIifg..CKKTAKII.....DCE.....L.....ANE..QNYSTEYLDFKLNLKIV.
 427 LV...DANVE.....IRATPELI.....EAL.....Pad9ktATE..EDFKTEFLAHIIAAKSV.
 428 LV...AERKEa10rlDSKASQFV.....SGQ.....A.....AET..QDFDTEFLDYVLAVKVV.
 429 LQ...TNGVT.....LYGGPRAS.....AVL.....Si....PEA..RSFHHEYCSKACTVEVV.
 430 LK...HEGVKina..GPVLNKLL.....TFG.....P.....PLA..KTMKHEYGALECCIEVV.
 431 YA...EADVEmrgdeATRSVLDR.....DIE.....A.....ATD..DDWTSEYGDLIVAIKVV.
 432 LV...RDRIEa10rlDPQAARHI.....G--.....-gea..AGA..DDFDTEFLDYILAVKTV.
 433 FE...KFKVKih8tlAYFNNSNL.....EIF.....K.....ANE..NTFDTEWLDFALSVKLV.
 434 LI...NAKVTsh9ksKLTNFNQE.....FIK.....D.....AAD..DAFDKEYLSFDISVKPV.
 435 LK...ESNQSve6adEEALQLLE.....NAV.....A.....ASE..SDYATEFLDYIMSVKVV.
 436 FQ...AAGVT.....LRGDAESQ.....SLG.....Vnes..AQE..EDWSTEYLDLTLSVRVV.
 437 FE...KFKVKih8alAYFNNSNL.....EVF.....K.....ANE..NTFDTEWLDFALSVKLV.
 438 LI...AAKVTi17niNINIKGDD.....YIK.....D.....VEA..DSFDKEYLSFDISVKLV.
 439 LR...SEGVT.....LYGGPKAS.....SLL.....Nv....PLA..RSLHHEYCSLACTLEIV.
 440 LQ...DAGVTvh6vaELEAFGAT.....DVV.....E.....ATE..NDWDSEYLSFDIAVAVV.
 441 LE...NCELRgd...ETAQACDA.....RVN.....P.....ASA..SDWDEEYLDAVLSIRVV.
 442 LK...EQGKHik9ecLKYLEGEN.....DVC.....E.....LIE..DLYHHEFSSNEMCVKSV.
 443 FK...AEGVK.....LHAGPKLA.....ALL.....Kfap..PPA..ESMSFEYGSLECTLEVV.
 444 FK...AEGVK.....LHAGPKLA.....ALL.....Kfap..PPA..ESMSFEYGSLECTLEVV.
 445 LQ...EAGVTih6vaELEAFGAT.....DVV.....E.....ATE..TDWDSEYLSFDIAVAVV.
 446 LK...EQGKHik9ecLKYLEGEN.....DVC.....E.....LIE..DLYHHEFSSNEMCVKSV.
 447 FK...AEGVK.....LHAGPKLA.....ALL.....Kfap..PPA..ESMSFEYGSLECTLEVV.
 448 LR...AENVKfnp..GPRLARSL.....KFG.....P.....REA..DSMSIEYGGLECAVEIV.
 449 LK...ESGVA.....IFSGPTLA.....KHL.....Tfgp..PQA..HSLKHEYGDMACTIEIV.
 450 LQ...EAGVTvh6vaQLEAVGAS.....GIV.....P.....ADE..HDWAEEYLSLDIACALV.
 451 LQ...KAGVTlhgekKQLDPLIN.....DVV.....Q.....AEE..TDWTDEYLSFDIAVAIV.
 452 LK...ESGVA.....IFSGPTLA.....KHL.....Tfgp..PQA..HSLKHEYGDMACTIEIV.
 453 LK...ESGVA.....IFSGPTLA.....KHL.....Tfgp..PQA..HSLKHEYGDMACTIEIV.
 454 LQ...TKGVT.....LYGGPRAS.....AKL.....Ni....PET..KSFHHEYSSKACTVEIV.
 455 LQ...EAGVTih6vaELEAFGAT.....DVV.....E.....ATE..TDWDSEYLSFDIAVAVV.
 456 LT...EAKVTl11vlKDMPKVSA.....LVE.....P.....SVD..QDYNTEFSDLILAIKTV.
 457 LQ...TKGVT.....LYGGPRAS.....AKL.....Ni....PET..KSFHHEYSSKACTVEIV.
 458 LA...AKGVElr9kaALADTPGL.....TLV.....D.....ATD..ADFSTEFLALTLAVKTV.
 459 FE...KFKVKih8ilEHFKNSKL.....EIS.....K.....ADE..STFDTEWLDYAISIKSV.
 460 LI...AARVA.....LRGDQASLgidg.RLT.....P.....ASD..ADWDTEYNDLVMGIKIV.
 461 IT...EGGVTi19sgKLNDDIKA.....KIV.....D.....AKD..GDFDKEFLSLDCAVKFI.
 462 LR...NEGVT.....LYGGPKAS.....ALL.....Nl....PEA..HSFHHEYNSMACTVEIV.
 463 LA...ALGCG.....FRADDRAR.....AIV.....Pslpa.AGP..ADFDTEWLDAMLSVSVV.
 464 MR...EKGVElrac.PRALPLLK.....EAV.....P.....ARE..DEWDREYLDLVLRVKVV.
 465 SE...HQVIIfa9leLLPSYPAT.....LLK.....H.....AEP..EHYGTEFLSLKMSVKTV.
 466 LL...AKGVRl13lkNISSPPAD.....LLE.....D.....AVD..SDFDTEFLDLVLAVKTI.
 467 LI...AKGVTl13ieNLTLKEAG.....MLR.....D.....ACE..SDFRTEFLDLTLAVKTI.
 468 MK...EAGIK.....IYGGPKAI.....GAS.....Lar...AGA..ASMHTEYGDEQITVEVV.
 469 FA...TCEETt18slLTERGARK.....NVF.....H.....AQA..ETWDREYLDYQVSVRVV.
 470 FA...TCEETt18slLTERGARK.....NVF.....H.....AQA..ETWDREYLDYQVSVRVV.
 471 QE...KKVVIya9akLQGSYPES.....LLE.....R.....ARP..EHFGTEFLSLKLSVKTV.
 472 EE...KNVQIfa9ykLLGRYPDE.....LLE.....M.....ASP..EHFGTEFLSLKMSIKTV.
 473 LE...ENNCKiygdrFLKKYYKG.....KIY.....P.....AKE..KDWSTEYLSSTVSVKTV.
 474 LI...SKGVCl13mkTLPAVPSH.....LLQ.....D.....AID..SDYRTEFLDLILAVKTIt
 475 LK...ESKVTi10qaLEGYYPAE.....LLQ.....P.....ATP..ESFGTEFLDYKMAVKTV.
 476 LT...AHGVT.....LRADPPAL.....AAL.....Qta8qaATD..ADYGTEFLALTASIRTV.
 477 SQ...KNVIIya9hvLDKNYPEQ.....LLI.....K.....AKP..QDFGHEFLDYKLAIKTV.
 478 AE...KQVIIfa9psLLGRYPSE.....LLQ.....K.....AEE..KHFGTEFLSLKMSVKTV.
 479 LQ...EKQVMl10qaLQGSYPDD.....LLH.....Q.....AEP..EHFGTEFLSLKMSVKTV.
 480 LA...AKGVSlr9kaAITSLSLE.....GVQ.....D.....ATT..QDYDTEHLSLTIGVKTV.
 481 LK...ADKVIi10qaLEGHYPAG.....LLK.....P.....ATP..ESFGTEFLDYKMAIKTV.
 482 LE...ENNCKiygdrFLKKYYKG.....KIY.....P.....AKE..KDWSTEYLSSTVSVKTV.
 483 SQ...KHVIIya9hvLDKNYPEQ.....LLI.....K.....AKP..QDFGHEFLDYKLAIKTV.
 484 QV...ELFVDda6qeLHGFYPKA.....LLH.....Q.....AKP..EHFGTEFLSLKMSVKTV.
 485 LA...AKGVElr9kaALSPEITT.....NIK.....D.....ATA..KDYDTEFLSLTLAVKTV.
 486 SQ...KNVIIya9qvLDKNYPEQ.....LLM.....K.....AKP..QDFGHEFLDYKLAIKTV.
 487 LL...QNGVSl13vaSLSPSQAA.....LLQ.....D.....SME..SDYDTEFLDLILAIKTVs
 488 AE...KKVIIfa9paLLSRYPSE.....LLQ.....K.....AEE..KHFGTEFLSLKMSVKTV.
 489 LL...ESGVEvr8aqAALAGAGL.....NVT.....S.....AQL..GDYGTEFLALVASLRTV.
 490 TL...EGGVTi20gkLTEAIQCK.....TVD.....A.....DEE..QDFDKEFLSLDLAAKFV.
 491 LS...NEGVE.....IRGDKEVQ.....LID.....Nrvel.AKD..FDWDTEYNDLIIAVHLV.
 492 TL...EGGVTi20gkLTEAIQCK.....TVD.....A.....DEE..QDFDKEFLSLDLAAKFV.
 493 QE...KKVVIfa9peLVGNYPEE.....LLQ.....H.....AEP..EHFGTEFLSLKMSVKTV.
 494 LI...ENGVTl12ykEHNSTSDH.....IVD.....L.....DES..KDFDKEFLSLDIAVAFV.
 495 AE...HQVIIfa9lsLLASYPEQ.....LLQ.....H.....AEP..EHFGTEFLSLKLSVKTV.
 496 LT...EKGVE.....LRGDQMIC.....ELE.....Pnakq.AEE..ADWGAEYLAPILSVKTV.
 497 LM...SNSVCl13rdANVPKTSE.....FVT.....A.....SSP..ADYSTEFLGPTIAVKAV.
 498 MT...EAGVS.....FYAGPQAI.....AAG.....L.....ASElaASLHMEYGDAHMTVEVV.
 499 LM...SNSVCl13rdANIPKTSE.....FVT.....A.....SSP..ADYSTEFLGPTIAVKAV.
 500 --...AGNVKl15yaGDDAALKG.....NVV.....D.....AEE..GDFSREFLSLDIAVKFI.
 501 TL...RAENVtiha.GPQFASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 502 LE...NAGVE.....IRGDELVC.....ELH.....Psskq.ASK..EDWETEFLAPVLSVKTV.
 503 LK...DFYGEd39psRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 504 LK...DFYGEd39ssRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 505 LI...ESKVE.....VIVDKSLE.....YFE.....Ntkti.ENE..DIWYEEFLDYKIVIGTI.
 506 LK...DFYGEd39psRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 507 LK...DFYGEd39ssRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 508 LK...DFYGEd39psRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 509 VK...EFYGEn39atRYIAPTVL.....TDV.....D.....PKT..KVMQEEIFGPILPIVPV.
 510 LK...EFYGEd39ktCYIEPTVL.....ADV.....N.....PES..KVMQEEIFGPVLPIVSV.
 511 LK...DFYGEd39psRYIAPTIL.....VDV.....D.....PQS..PVMQEEIFGPVMPIVCV.
 512 VK...EFYGEn39atRYIAPTVL.....TDV.....D.....PKT..KVMQEEIFGPILPIVPV.
 513 VK...EFYGEn39atRYIAPTVL.....TDV.....D.....PKT..KVMQEEIFGPILPIVPV.
 514 MK...EAGIK.....IYGGPKAI.....AAS.....Lar...AGA..VSMHTEYGDEQITVEVV.
 515 LK...AKGVEvladeASKEVLSE.....NAV.....I.....PNE..DTWYEEFLAMKIVLGAV.
 516 VK...GFYGEn39atRYIAPTIL.....TDV.....D.....PGT..KVMQEEIFGPILPIVPV.
 517 VK...GFYGEn39atRYIAPTIL.....TDV.....D.....PGT..KVMQEEIFGPILPIVPV.
 518 AE...TLENDykve.ILVDGKVE.....DVL.....Dkptl.PTK..DTWTEEFLALKIVLSSV.
 519 LV...SAGIQl16daSLRTSYAS.....QII.....A.....AQP..ADFTTEFLDLILAVKAT.
 520 LQ...EFYGGd39asCFIAPTIL.....TDV.....S.....AES..KVMEEEIFGPVLPIVSV.
 521 LK...ERGVElrgd.NKAVAIDT.....SIL.....L.....ATE..EDWETEFLSLTLAVKVV.
 522 LR...TEGVI.....LYGGPVAS.....SLL.....Ni....PQA..HSFHHEYSSLACTAEIV.
 523 LK...EKGFE.....IKGDGELV.....EAF.....Pqlql.AKD..NEWGNAYLTKTVAFKLV.
 524 LK...EKNVA.....ILVDKEVQ.....TVL.....TgetliAEN..TIWSEEFLALKCCIGMV.
 525 LK...EKGFE.....IKGDGELV.....EAF.....Pqlql.AKD..NEWGNAYLTKTVAFKLV.
 526 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 527 VK...EFYGEn39atRYIAPTVL.....TDV.....D.....PKT..KVMQEEIFGPILPIVPV.
 528 LM...EKGFE.....IRGDAELV.....QAF.....Pqlql.VKE..GEWGNPYLTKTVAFKLV.
 529 VK...RIRVGa50ngQYVEPTVF.....TGC.....H.....DDM..RIVREEIFGPVMSILVF.
 530 LK...AHSVSilvsdRVGTILPE.....EEV.....I.....QDD..SIWYEEFLALKCSIGLV.
 531 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLEVCIEVV.
 532 LS...SLGVEiivdkNVNAILSE.....RDL.....I.....SKD..EVWFEEFLAMKIAIGEA.
 533 IK...NQFGDn39ktFQIEPTIL.....KNV.....T.....WND..PVMEREIFGPIFPILPF.
 534 AK...KWRTGd53ggYFMPATVI.....TGV.....S.....DSS..RVMQEEIFGPVTCVSPF.
 535 IN...IFYKGe37dtLQLYPTII.....NNI.....D.....WES..NIMKEEIFGPILPIIEY.
 536 LL...EFYQTd39sqCYIAPTVL.....KDV.....L.....PHF..KIMQEEIFGPLLPIVTV.
 537 AR...TLVVGd50qgFFTGGTLF.....DHV.....T.....PSM..RIYQEEIFGPVLGCVRV.
 538 AK...ALKVKn50qgFFTGGTLF.....DHV.....T.....PEM..KIYKEEIFGPVLACVRV.
 539 LK...KRDVE.....ILTDEAFS.....TLD.....Gtspi.EDE..SSWYEEFLDYKIVLGQT.
 540 AR...KLVIGd50egFFTGGTLF.....DHV.....T.....PDM..RIYKEEIFGPVLGCVRV.
 541 VK...RIRVGk50sgQYVAPTVF.....GDC.....R.....DDM..KIVREEIFGPVMSILDF.
 542 VK...RIRVGk50sgQYVAPTVF.....GDC.....R.....DDM..KIVREEIFGPVMSILEF.
 543 VK...RIRVGk50sgQYVAPTVF.....GDC.....R.....DDM..KIVREEIFGPVMSILDF.
 544 VK...RIRVGk50dgQYVAPTVF.....GDC.....R.....DDM..KIVREEIFGPVMSILDF.
 545 IK...SMYGKd39dtLSIEPTIL.....DKI.....T.....WDE..AIMQEEIFGPILPVLTY.
 546 LQ...EQGFE.....LRGDERLLeeykdHLK.....P.....VKA..SEWSTPYLDKIIAFKIV.
 547 IT...QWYGEk39neRYIAPTIV.....VDV.....K.....PTD..PIMQEEIFGPILPIITI.
 548 AQ...ELKIGd47shNGYFFPPY.....IYE.....I.....QKI..SQLKQEVFGPILHIIRFn
 549 IQ...SLKIGa50rgFFMGGCLF.....DRV.....T.....PEM..RIYKEEIFGPVLCIVRV.
 550 VA...QLRVGp51dgFWLGPSVL.....DHV.....T.....PDM..ACYRDEIFGPVLSILRV.
 551 AQ...ELKIGd47shNGYFFPPY.....IYE.....I.....QKI..SQLKQEVFGPILHIIRFn
 552 MA...ELKVGn46qqQGIFVPPT.....LFE.....L.....ENL..HHLKHEVFGPVLHVVRFh
 553 IQ...SLKIGa50qgFFMGGCLF.....DRV.....T.....PQM..RIYKEEIFGPVLCIVRV.
 554 LE...TFFGQn43dkLKISPTIL.....LDV.....P.....EAS..SMMQEEIFGPLLPIITV.
 555 LE...TFFGQn43dkLKISPTIL.....LDV.....P.....EAS..SMMQEEIFGPLLPIITV.
 556 IN...QVQPVewradDKALPLFE.....QAV.....P.....AKA..EDFETEFLDYIMSVKVV.
 557 IQ...SLKIGa50qgFFMGGCLF.....DRV.....T.....PQM..RIYKEEIFGPVLCIVRV.
 558 TR...RWKVGi53ggYFMLPTVI.....THI.....K.....DES..CCMKEEIFGPVTCVVPF.
 559 AR...KLRVGd50agFFYLPTIL.....DGL.....S.....NHA..RICREEIFGPVLVALPF.
 560 AR...KLRVGd50agFFYLPTIL.....DGL.....S.....NHA..RICREEIFGPVLVALPF.
 561 IV...SFYGTn39esRYIAPAIL.....RDV.....N.....PEA..PIMQSEIFGPLLPVLTY.
 562 AR...KLRVGd50agFFYLPTIL.....DGL.....S.....NHA..RICREEIFGPVLVALPF.
 563 MG...ELTLGn49crHGTFVPPT.....LIE.....L.....DSI..AELKREVFGPVLHVVRF.
 564 TR...KWKVGv53agYFMLPTVI.....TDI.....K.....DES..RCMTEEIFGPVTCVVPF.
 565 AR...KLRVGd50agFFYLPTIL.....DGL.....S.....NHA..RICREEIFGPVLVALPF.
 566 MR...ELALGn45caQGTFVPPT.....IIE.....I.....GNV..DELKREVFGPVLHVVRYr
 567 ID...TFEAGn37vnLKISPTVV.....VDP.....D.....PAE..PLMTDEIFGPILPVLTV.
 568 LR...SKGFR.....LKGDEELV.....QEM.....Pelel.ARH..EDWSRPYLSRTVAFKLV.
 569 MN...ELTMAn49crHGTFVPPT.....LIE.....L.....DSI..DELKREVFGPVLHVVRF.
 570 IK...EFYSDn39elRKMEPTLM.....DAP.....S.....FNS..PVMQDEIFGPILPVYGY.
 571 LR...ELSIGr45tqNGTFVAPT.....IIE.....I.....ESL..RDLKREVFGPVLHVVRYk
 572 YQ...RFYPEl44atKFLPPTVI.....ADV.....K.....PDD..AIMSGEIFGPLLPIVPV.
 573 MR...ELAVGn45caQGTFVPPT.....LIE.....L.....DSI..DELKREVFGPVLHVVRYr
 574 LR...ELSIGr45tqNGTFVAPT.....IIE.....I.....ESL..RDLKREVFGPVLHVVRYk
 575 LR...ELSIGr45tqNGTFVAPT.....IIE.....I.....ESL..RDLKREVFGPVLHVVRYk
 576 LK...EFFGEd39aeRYIAPTVI.....VDP.....D.....LDS..PLMQDEIFGPVLPIVTY.
 577 LR...SKGFR.....LKGDEELV.....QEM.....Pelel.ARH..EDWSRPYLSRTVAFKLV.
 578 LA...KVRPGp50ngNWVGPTLF.....AGV.....R.....PDM..AIYREEVFGPVLCLAEV.
 579 LA...KVRPGp50dgNWVGPTLF.....AGV.....R.....PDM..AIYREEVFGPVLCLAEV.
 580 MH...ELALGn45caHGTFVPPT.....LIE.....I.....GSI..DELKREVFGPVLHVVRYr
 581 MH...ELALGn45caHGTFVPPT.....LIE.....I.....GSI..DELKREVFGPVLHVVRYr
 582 LA...KVRPGp50dgNWVGPTLF.....AGV.....R.....PDM..AIYREEVFGPVLCLAEV.
 583 VA...ELKVGn46saLAYNPTVI.....TDI.....S.....ADM..DIASEEIFGPIAPVFTF.
 584 VA...ELKVGn46saLAYNPTVI.....TDI.....S.....ADM..DIASEEIFGPIAPVFTF.
 585 LH...ELHIGr45tgVGTFVPPT.....IIE.....L.....EKL..SDLQREVFGPVLHVIRYr
 586 AL...AVKVNn50egFWVGPTVL.....DHV.....K.....TEM..TAYTEEIFGPVLVVVRV.
 587 VA...RIRVGn50kgAFVAPTVF.....TDC.....T.....DDM..TIVKEEIFGPVMSILTY.
 588 MA...ELRVGk46eqNGIFVPPT.....LLE.....I.....DHI..SQIEHEVFGPVLHVIRFn
 589 VE...KLTIGn42knNLFYPTLL.....DNV.....N.....VDM..KIAWEEPFGPVLPIIRV.
 590 LE...KFYGKs47eeHYCGPTLI.....EGV.....D.....PHS..LIMQEEIFGPILPVMTF.
 591 LK...DFYGDs39etNFISPTLV.....DSP.....D.....FDS..PLMKEEIFGPILPLYSF.
 592 AE...ALRIGy51ngAYVQPTIW.....TGL.....P.....DSA..RCIQEEIFGPVCHIAPF.
 593 AR...KLRIGd50dgFFYRPTIL.....EGL.....P.....NSA..RICQEEIFGPVLVAMPF.
 594 AR...KLRVGd50ngFFYQPTIL.....EGL.....P.....NSA..RICQEEIFGPVLVAMPF.
 595 VA...RIRAGn50kgAFVAPTVF.....TDC.....T.....DDM..TIVKEEIFGPVMSILSY.
 596 MA...EYTLGn47diQGTFVPLT.....LIE.....L.....DSI..EALTQEVFGPVLHVVRYq
 597 IS...KLKMGn44egNLIEATLF.....DNV.....T.....TDM..RLAWEEPFGPVLPIIRI.
 598 MH...ELALGn45caHGTFVPPT.....LIE.....I.....GSI..DELKREVFGPVLHVVRYr
 599 AR...KLRVGd50hgFFYQPTIL.....EGL.....P.....NSA..RICQEEIFGPVLVAMAF.
 600 AE...SLIAGd43egWLIRPTVV.....TDL.....P.....ATA..RLCREEIFGPVAVVAPF.
 601 MH...ELALGn45caHGTFVPPT.....LIE.....I.....GSI..DELKREVFGPVLHVVRYr
 602 LQ...AKGFK.....LRGDAELC.....EQF.....PdhltlAKE..NEWGKAYLDRTVAFRTT.
 603 MN...KLVVGn43egNLIYPTLF.....DNV.....T.....TDM..RLAWEEPFGPVLPIIRV.
 604 VK...EFYGEn39atRYIAPTVL.....TDV.....D.....PKT..KVMQEEIFGPILPIVPV.
 605 VA...QLSIGd46spLTMNPTVI.....SDI.....T.....ADM..DIAHEEIFGPISTIFTF.
 606 IK...SFFGEn43dkLYVEPTIL.....LDP.....P.....LDS..EIMNEEIFGPILPIITV.
 607 IR...DFFGAd39asRYIAPTIL.....REI.....A.....AGS..AIMEEEIFGPLLPVLTY.
 608 VE...TTSKIg53dgYFVQPTVF.....TGT.....T.....DSM..AIVREEVFGPVVIIEPF.
 609 LR...ELRIGr45saHGSFVPPT.....IIE.....I.....DDI..AQLRREVFGPVLHVIRF.
 610 MA...ECRMGn50wqTGTFVMPT.....LIE.....L.....ENF..AELEKEVFGPVLHVVRYn
 611 IN...SLKQGp48kgNYFLPTVL.....ANV.....T.....ENM..TIFQEEAFGPVCSIIKF.
 612 ID...SYTVGn47qdLGNFVLPT.....LIE.....L.....DDI..DQIKEEVFGPVLHIVKFk
 613 TT...GLRVGd49dgHWLGPTLF.....DHV.....T.....PQM..SIYTDEIFGPVLSVVRA.
 614 IE...KLKVGp51ngFFCGPSLF.....DNV.....T.....RDM..EIYKEEIFGPVLSTVRA.
 615 AE...SIHLGp45egFFVPLTIL.....ADL.....P.....PDH..RLAREEIFGPVLVVFKV.
 616 LE...KFYGRd43hqLKIAPTIF.....MDV.....P.....LDS..GIMKEEIFGPLLPIITV.
 617 LE...QEGVT.....LFSGPRVN.....GLV.....Hf....TKA..NTFHYEYNSKACTIEVV.
 618 IK...EFYTDn39seCYIAPTVL.....KDV.....T.....GES..KVMKEEIFGPVLPIITV.
 619 LA...ELRIGr45taHGTFVAPT.....IIE.....I.....DGI..ADLEREVFGPVLHVLRFk
 620 AS...ALPIGh46ggYFIQPTIL.....TKT.....D.....PSM..SVVREEIFGPVLCAMAFd
 621 IH...HFYGSd39ddCYLAPTIL.....SKV.....H.....PES..ALLCEEIFGPILPIIIY.
 622 AR...SWKLGd48tsLYYRPTVL.....DNV.....G.....TDT..LINRDETFGPIVPLIPV.
 623 TE...AIKPDd44pgFYVEPTIV.....TDL.....P.....KDA..YIARNEIFLPVLSVFKC.
 624 AR...KLKVNn50qgNFVGPTIF.....DGV.....T.....ENM..TIYTEEVFGPVLCVVGV.
 625 IK...KMFGDn43ddLFMEPTIL.....LDP.....P.....LES..AIMTEEIFGPVLPIITV.
 626 AR...KLKVNn50qgNFVGPTIF.....DGV.....T.....ENM..TIYTEEVFGPVLCVVGV.
 627 MD...ALHIGq42pnAGTFIAPT.....LIK.....I.....GGI..ADLEREIFGPVLHIATF.
 628 VA...KLSVGd42dgRLLTPGLF.....DHV.....T.....LDM..KLAWEEPFGPILPIIRV.
 629 VA...KLSVGd42dgRLLTPGLF.....DHV.....T.....LDM..KLAWEEPFGPILPIIRV.
 630 ME...ELVSGd40peGGHFVAPA.....LLQ.....V.....GGI..ADLEREIFGPVLHLATFa
 631 VS...QLQTGn43qgNLMSPTIL.....SEV.....T.....NDM..PVAKEEIFGPIAPIIKA.
 632 VA...KLSVGd42dgRLLTPGLF.....DHV.....T.....LDM..KLAWEEPFGPILPIIRV.
 633 VA...KLSVGd42dgRLLTPGLF.....DHV.....T.....LDM..KLAWEEPFGPILPIIRV.
 634 MK...ELKIGn44deNFVAPTI-.....-IE.....I.....DNI..SDLKDEQFGPILHIVRF.
 635 AA...ALPTGt43dgLVVEPTVL.....SDA.....T.....NDM..AAACNEHFGPVAPVIPF.
 636 AK...ALKLGv47agFYMQPTVI.....SDP.....D.....PRS..ELSQTELFGPITALYRV.
 637 AR...TLRAGd43dgAILQPAIV.....DGV.....T.....PEM..ALYREESFGPVVTVARV.
 638 MK...TLKIGh48egYYMAPTLL.....LGT.....Q.....NDW..EINQEEVFAPLASVIRIs
 639 MD...ELALGd40peTGTFVAPT.....LIE.....V.....GGI..ADLEREVFGPVLHVATFr
 640 FE...AIEVGp45dgFYVAPVLF.....GPC.....N.....PNS..RIAQEEVFGPVLCVIPF.
 641 LA...ELTVGp45tnEGTFVAPT.....IIE.....L.....SAP..DLLTREVFGPVLHVIRFr
 642 AD...AHVMGd46gsNWIEPTLI.....EPK.....N.....NQS..EVVQSEVFGPVLTFQTF.
 643 MA...QAIIGd49enNSTFVPPT.....LIE.....L.....DKI..SSLKKEIFGPVLHVVRY.
 644 TK...SIKVGd45kgYYVEPTVI.....TDL.....K.....PDS..YIVRNEIFLPAVAIIKV.
 645 MS...ERQFGd46kgHFYPPTLL.....TNC.....R.....QDM..EIVQEEIFGPVLPVLKY.
 646 MN...SELHVg47ggRFFTPTLV.....SHA.....N.....AEM..KVAHEETFGPLAAVIPF.
 647 MD...ELTVGd42paTGHFIAPT.....VIR.....V.....QGI..AQMTREIFGPVLHVATFe
 648 MD...ELRLGd40psRGWFIPPT.....MLK.....V.....SGI..ADLEREIFGPVLHVATFr
 649 II...LFYGEd43sdKYIAPTLI.....DQP.....S.....LES..RVMKEEIFGPILPILEF.
 650 RQ...KLFQNs28yeSQKFDFQI.....LET.....S.....FND..PKFDYELFCSALMLVEY.
 651 MD...ALTVGn42pnAGTYIAPT.....LIK.....I.....GGI..GDIEREIFGPVLHVATF.
 652 AE...RMQPGd49kgLFIGPTVF.....DGV.....T.....DTM..AIGREEIFGPVLAVFGF.
 653 TR...EIVKIg51kgFYVEPAII.....EGV.....A.....PDS..YLWKTELFLPILLVDKF.
 654 ME...LLDLDd42pqSGTFVAPT.....MIS.....I.....NGI..SDLKEEIFGPVLHVATF.
 655 AK...KLTINg50ngNFIGPTII.....TGV.....K.....PGM..KCYDQEIFGPVLVVVDT.
 656 TD...QIKPDd44pgFYVEPTIV.....TDL.....P.....KDA..YIARNEIFLPVLSVFKC.
 657 AL...NMYPHf46dvRKIAPTLL.....TGV.....T.....TEM..DIMKNEIFGPIFPIFEY.
 658 LQ...ERYGSk44dqKFIQPTIV.....SNV.....P.....DDD..ILMQDEIFGPIIPIIKP.
 659 IA...STRVGn46agFFYAPTVV.....AAG.....T.....DEL..RLMKEEPFGPIAVVTPF.
 660 AK...KLKVAg51kgNFVGPTIL.....TDV.....K.....PHM..RCYKEEIFGPVLVCLNV.
 661 WR...RMFPSi48rsRKIAPTLI.....RDV.....T.....PTM..RIASEEVFGPVLSVLGY.
 662 AR...ELTIGd43as-GNFVAPH.....IFE.....L.....NRA..SELTEEVFGPILHVVRY.
 663 AR...STRFGs45pgFYFEPTVL.....DGL.....N.....QDD..ALVQNEIFGPVLTVQTF.
 664 AQ...ELVLGn48dlMANSIAPA.....AFE.....V.....SSL..AEVKDEIFGPVLQIVRWg
 665 MD...ALNLGn42ppEGTFVAPT.....LIK.....V.....AGI..GALEREIFGPVLHVATFr
 666 VE...SMKLGt47gpFVHEPTVL.....TGV.....T.....ETM..LCRDGETFGPVVSLYEV.
 667 MH...ELTLGn45caHGTFVPPT.....LIE.....I.....GSI..DELKREVFGPVLHVVRYr
 668 LQ...ELAVGd45paGAQHIAPC.....AYE.....L.....ARV..ADLRQEVFGPVLHVVRWg
 669 LL...GQGID.....IQAAAPIL.....ERF.....Pqlqp.LGE..GFDSTE--RPHLRLQPV.
 670 TE...RFSKGd39keKLIFPTVV.....TDV.....K.....LDD..SLLSEELFGPVLPVVK-.
 671 VK...GLVSGd43ngAMLDATVM.....ENV.....P.....KDC..DASAEEAFGPLSILVPF.
 672 LA...QRYGSs47aqRFIAPTVL.....ADV.....P.....EHA..RIAQEEIFGPVLPVVTF.
 673 LL...GHGIA.....VQAAAPIL.....EQF.....Pql...QPL..GQGFDSTERPHLRLQPI.
 674 FA...AVHVGp44agAFLTPTLF.....RID.....D.....VAS..PLVQEELFGPIVSLETF.
 675 YA...SVKVGn47adAYYVRPAI.....VRM.....P.....KQS..AVVERETFAPILYVMVY.
 676 YT...SVKVGn47adAYYVRPAL.....VRM.....P.....KQS..AVVERETFAPILYVMVY.
 677 ML...-----.....--------.....---.....-.....---..-----------------.
 678 --...-----l18ggYFMLPTVI.....THI.....K.....DES..CCMKEEIFGPVTCVVPF.
 679 TR...TLAVGd43egNLLWPTVI.....EEV.....P.....DDA..TLVVEETFGPVLPLRQF.
 680 YA...SVKVGn47adAYYVRPAI.....VRM.....P.....KQS..AVVERETFAPILYVMVY.
 681 YA...SVKVGn47adAYYVRPAI.....VRM.....P.....KQS..AVVERETFAPILYVMVY.
 682 MK...EIKFGd46dgYFYPATVL.....GNV.....K.....PGQ..PAYDDELFGPVASLIKA.
 683 AS...SMAVGn44npYLMTPGIK.....YGT.....K.....KGD..FTHMNELFVPILSVMKA.
 684 AS...SMAVGn44npYLMTPGIK.....YGT.....K.....KGD..FTHMNELFVPILSVMKA.
 685 AS...SMAVGn44npYLMTPGIK.....YGT.....K.....KGD..FTHMNELFVPILSVMKA.
 686 LQ...REGVK.....MFGGPRAS.....GLL.....Ni....AET..NTFHHEYSSLACTVEIV.
 687 --...-----.....--------.....---.....-.....---..-----------------.
 688 CW...NSKEGvq...LYGGPKAS.....VLL.....Ki....SEA..KSFHLEYSSLACTIEIV.
 689 AS...SLAIGs44neHLMSPAIK.....YGT.....K.....KGD..FTHTNELFAPILSVMKA.
 690 AS...SMAVGn44npYLMTPGIK.....YGT.....K.....KGD..FTHMNELFVPILSVMKA.
 691 TE...NILVDd46skKGFVTPGI.....VDV.....T.....GVE..DLPDEEHFGPLLKVYRF.
 692 LK...ESNQSve6adEEALQLLE.....NAV.....A.....ASE..SDYATEFLDYIMSVKVV.
 693 LK...ERGVElrgd.QRALALDS.....SIV.....L.....ASE..EDWGTEFLSLTLAVKVV.
 694 VV...NLKAGd46sgNFVQPTIL.....TDV.....A.....EDN..PARYWEFFGPVSMLFRA.
 695 LT...AAGVE.....LRGCPQTV.....ALA.....Paakp.AAA..DDWGREFLDLILAVRVV.
 696 LQ...KQGVQ.....LYGGPKAS.....VLL.....Ki....SEA..KSFHLEYSSLACTIEIV.
 697 VT...SLKVGy44tgRLWSPGVR.....YGV.....R.....RGS..YFHLTEFFGPVLGVMTA.
 698 LQ...SNGVT.....LYGGPKAS.....KIL.....Nl....PEA..RSFNHEYCSKACTVEVV.
 699 MR...KYKLGh49asCYLAPTLL.....TGL.....T.....AEM..NIMQEETFGPVACVQTV.
 700 WR...RMFPSi48rsRKIAPTLI.....RDV.....T.....PTM..RIASEEVFGPVLSVLGY.
 701 AS...SIRVGs44egRYWSPGVR.....SGI.....K.....PGD..PYHLTEYFGPITGIMYA.
 702 ML...RVEQVkiha.GPKFASYL.....TFS.....P.....SEV..KSLRTEYGDLECCIEVV.
 703 IN...KVHEVefradERSLKALS.....AGI.....P.....ATD..EDFGMEFLDYILSVKTV.
 704 AR...MWKVG.....IPSDP---.....---.....-.....---..-----------------.
 705 QG...AYVLNe41pkNTKVLVAR.....ENK.....V.....GHN..VAYSREKLTPILAFYVE.
 706 LR...SEGVE.....LFGGPRVS.....ALQ.....Elsi..PAT..HTFHLEYNSPACTVEIV.
 707 QG...AYFLSp40pkDRRLIVAE.....ETH.....V.....GLK..YPFSREKLAPIIAFYTV.
 708 MA...ESGVTlh8alTQLQAGPA.....KVV.....A.....VKA..EEYDDEFLSLDLNVKIV.
 709 NG...AYLCNd41paDVKLLMVP.....LTT.....T.....GPE..DWMSHEKLSPVLGWFIV.
 710 QG...AYFLNe40kkGSKVLISE.....QTT.....V.....GKN..NPYSREKLTPILAFYTV.
 711 LS...QAGYKqgvd.EHLHRNYA.....EIP.....L.....VDA..SEWPLPYLDQRLAWHYE.
 712 LE...TFFG-.....--------.....---.....-.....---..-----------------.
 713 AE...GAVLLg10vpDCVLELAS.....EEE.....Y.....QGL..SQYGLRDAARTLCLKTV.
 714 IM...QF---.....--------.....---.....-.....---..-----------------.
 715 LK...TYVCNd40adTEVLLVGP.....LKG.....L.....QDV..EPMCREKLSPTLGYYIV.
 716 GV...YLVNKk48ppKTNILLAE.....CAF.....V.....GEG..EPLTREKLSPVLALLKS.
 717 GA...YLVPKk39peGKDVLLFE.....LDK.....K.....NIG..EKLSSEKLSPLLSVYKA.
 718 QG...AAVLEa39pyPIRLIAVP.....QSV.....F.....DQN..SPWLREKLAPIVSLMGV.
 719 AG...AHILDa39tpKTRVLVAP.....FDH.....V.....ISE..EMLAHEKLSPVIGMTTV.
 720 AG...AHILDa39tpKTRVLVAP.....FDH.....V.....ISE..EMLAHEKLSPVIGMTTV.
 721 LL...AAGVK.....LRGDQKAR.....SID.....Srvig.ASA..EDWDTEYNDLIMAIKIV.
 722 QG...GYFMTa40seDIKVLIGK.....QNG.....V.....GNG..NPLSFEKLTTVLAFYTV.
 723 LQ...QAGTAr33ggYQTEALAE.....PLP.....E.....AQL..GREWEWEETPETSLMIV.
 724 HG...AHILDa40pk-TRVLIAP.....FT-.....-dv...IGE..EVLTHEKLCPVLGMTTV.
 725 EV...AAALGa53eqARVHTPLL.....LRA.....D.....AGN..DALGQEWFGPIAFVVAT.
 726 EV...AAALGa53eqARVHTPLL.....LRA.....D.....AGN..DALGQEWFGPIAFVVAT.
 727 EV...AAALGa53eqARVHTPLL.....LRA.....D.....AGN..DALGQEWFGPIAFVVAT.
 728 --...-----.....--------.....---.....-.....---..-----------------.
 729 AL...KRKVGd46vgYFIKPTIF.....SNV.....T.....DNM..RIAKEEIFGPVQSIFKF.
 730 --...-----.....--------.....---.....-.....---..-----------------.
 731 --...-----.....--------.....---.....-.....---..-----------------.
 732 YQ...EIFRE.....YGLLSTQC.....LLS.....Y.....SDF..EKLQSKT--NIVNTINV.
 733 LA...KEGVV.....IYGGPVAQ.....DTL.....Kv....PKV..DSFHHEYSSMACTLEFV.
 734 --...-----.....--------.....---.....-.....--P..DDFDTEFLDYIMAIKVV.
 735 --...-----.....--------.....---.....-.....---..-----------------.
 736 --...-----.....--------.....---.....-.....---..-----------------.
 737 --...-----.....--------.....---.....-.....---..-----------------.
 738 --...-----.....--------.....---.....-.....---..-----------------.
 739 --...-----.....--------.....---.....-.....---..-----------------.
 740 --...-----.....--------.....---.....-.....---..-----------------.
 741 --...-----.....--------.....---.....-.....---..-----------------.
 742 --...-----.....--------.....---.....-.....---..-----------------.
 743 --...-----.....--------.....---.....-.....---..-----------------.
 744 --...-----.....--------.....---.....-.....---..-----------------.
 745 --...-----.....--------.....---.....-.....---..-----------------.
 746 --...-----.....--------.....---.....-.....---..-----------------.
 747 --...-----.....--------.....---.....-.....---..-----------------.


        310                          320            330               3
         |                            |              |                
   1 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTED.....EN...TA
   2 ....R.....D.....LDEA....IAH....I.TKY.....GSGHSEAIVTRD.....YF...KA
   3 ....D.....G.....LDGA....IEH....I.NRY.....SSQHTDSIITEN.....YT...RA
   4 ....D.....S.....LESA....LEH....I.HRY.....GTKHSEAIVTTN.....YQ...TA
   5 ....D.....G.....LDAA....IEH....I.NTY.....GSQHTDAIITEN.....FS...DA
   6 ....D.....G.....LDAA....IEH....I.NTY.....GSQHTDAIITEN.....FS...DA
   7 ....D.....D.....VDEA....IDH....I.TQY.....SSGHTESIITEN.....LT...TS
   8 ....K.....D.....IDEA....IEH....I.NRW.....GSHHTDAIVTED.....YG...RS
   9 ....D.....D.....VDEA....IDH....I.TQY.....SSGHTESIITEN.....LT...TS
  10 ....A.....G.....LDEA....IEH....I.THY.....GSHHTETIVTED.....FT...RA
  11 ....D.....S.....FDKA....VEH....I.NTY.....GTKHSEAIITEN.....YT...RA
  12 ....D.....G.....LGAA....IEH....I.NTY.....GSQHTDAIITEN.....FS...DA
  13 ....D.....S.....LDEA....IAH....I.NRY.....GSHHTDAIVTES.....FT...DA
  14 ....D.....D.....LDEA....VAH....I.NRY.....GSLHTEAIVTRD.....YH...NA
  15 ....D.....D.....LDQA....IDH....I.NRY.....GSLHTESIITSD.....YG...RA
  16 ....D.....N.....LEQA....IEH....I.NTY.....GSHHTDSIVTEN.....FS...DA
  17 ....D.....S.....FEEA....LAH....I.RRY.....STGHSEAIVTND.....YL...RA
  18 ....D.....N.....LEQA....IEH....I.NTY.....GSHHTDSIVTEN.....FS...DA
  19 ....K.....D.....LDEA....ISH....I.NKY.....GTKHSESIVTKN.....YF...NS
  20 ....N.....S.....LDEA....LNH....I.YDH.....GTKHSEAIITEN.....YT...NS
  21 ....A.....G.....LDEA....IEH....I.NNY.....SSKHTEAIITED.....QD...RA
  22 ....A.....G.....LDEA....IEH....I.HRH.....GSGHTDAIVTED.....YG...RA
  23 ....G.....G.....IEEA....MDH....I.ARY.....GSLHTESIVTND.....YA...NA
  24 ....E.....N.....MDGA....IAH....I.REH.....GTQHSDAILTCD.....MH...NA
  25 ....D.....G.....IEEA....LDH....I.SKY.....STGHSESIITEN.....YE...NA
  26 ....E.....N.....MDGA....IAH....I.REH.....GTQHSDAILTSD.....MH...NA
  27 ....K.....D.....VDEA....ISH....I.NKY.....GTGHSEAIITES.....YK...NS
  28 ....E.....N.....MDGA....IGH....I.REH.....GTQHSDAILTCD.....MH...NA
  29 ....A.....N.....MDEA....IEH....I.NNH.....GSHHTDALVSEN.....YT...LA
  30 ....E.....N.....LDEA....IAH....I.NHY.....GSHHTDAIVTES.....YS...KG
  31 ....D.....G.....LDAA....IAH....I.QQY.....SSLHTEVIVTRN.....YP...NS
  32 ....D.....G.....LNQA....IDH....I.NHY.....GSHHTDSIISEH.....QG...EA
  33 ....D.....D.....MDEA....IEH....I.NKY.....GSQHSDAIVSQN.....YS...KT
  34 ....E.....H.....IDQA....IEH....I.NKY.....GSHHTDAIVTEN.....YS...KV
  35 ....G.....D.....LEEA....IEH....I.NTY.....GSGHTDSIITNS.....KE...KA
  36 ....A.....G.....LDEA....IGH....I.NTY.....GSGHTDGIITRS.....GE...KA
  37 ....A.....D.....LDEA....IAH....I.NTY.....SSGHTEAIVTEN.....YT...SA
  38 ....D.....G.....LNQA....IEH....I.NHY.....GSHHTDSIISEH.....QG...EA
  39 ....D.....S.....LDEA....IQH....I.NRY.....NTKHSESIISDN.....YF...AT
  40 ....E.....D.....IDQA....ITH....I.ATY.....GSQHTDAIVTED.....YS...RA
  41 ....D.....G.....LEQA....IEH....I.NHY.....GSHHTDSIITEH.....QG...QA
  42 ....D.....S.....LEEA....IAH....I.NTY.....GSHHTDAIVTES.....VT...DA
  43 ....E.....N.....IDEA....LEH....I.SKY.....STGHSESIVTEN.....YT...NA
  44 ....S.....G.....LDEA....IEH....I.NHY.....GSHHSDAIVSDH.....QS...QI
  45 ....D.....G.....LDQA....IEH....I.NHF.....GSHHTDSIVSEN.....LA...DT
  46 ....S.....S.....LDQA....IEH....I.TIY.....GSQHTDSIITEN.....YS...NA
  47 ....D.....S.....LEEA....IDH....I.FKY.....STKHSEAIITEN.....YT...NA
  48 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  49 ....S.....G.....LDEA....IEH....I.NHY.....GSHHSDAIVSDH.....QS...QV
  50 ....S.....D.....MEQA....IDH....I.RTY.....GTSHSDAILTQS.....LH...NA
  51 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  52 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  53 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  54 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  55 ....D.....S.....LDEA....VAH....I.RAY.....SSAHTEAIITDS.....QA...AA
  56 ....D.....G.....LDDA....IQH....I.NRY.....GSHHTDSIVTEN.....YT...RG
  57 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  58 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  59 ....D.....S.....IDAA....IEH....I.NKY.....GSKHSEAIVTRD.....YF...NA
  60 ....D.....D.....LDAA....IEH....I.NEY.....SSQHTDAIVTED.....HD...RA
  61 ....E.....N.....MDGA....IAH....I.REH.....GTQHSDAILTCD.....MH...NA
  62 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  63 ....D.....T.....IDEA....MDH....I.ARW.....GSGHTDAIVTEN.....LS...AA
  64 ....D.....S.....LDEA....IAH....I.NRH.....NTKHSETIVTDS.....YA...AS
  65 ....D.....N.....LDQA....IDH....I.RRH.....TSLHTEVIVTSN.....YA...NA
  66 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  67 ....D.....S.....VEDA....IEH....I.NCH.....GTGHSEAIISED.....YS...SV
  68 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
  69 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTCD.....MR...NA
  70 ....S.....G.....LDEA....IEH....I.NHY.....GSHHSDAIVSDH.....QS...QI
  71 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
  72 ....D.....T.....IDEA....MDH....I.ARW.....GSGHTDAIVTEN.....LS...AA
  73 ....K.....N.....VDEA....IEH....I.KKY.....STGHSESILTEN.....YS...NA
  74 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
  75 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
  76 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
  77 ....A.....D.....VDEA....IAH....I.NQY.....SSQHTEAIVTEN.....YT...NA
  78 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
  79 ....D.....D.....IDQA....IDH....I.RTH.....GTNHSDAILTRS.....LS...SA
  80 ....D.....D.....LDAA....MIH....I.NTH.....GSQHTDAIVTED.....YG...RA
  81 ....S.....S.....LEEA....ISW....I.NQH.....TSHHSEAIITRD.....IK...AA
  82 ....D.....T.....IDEA....MDH....I.SRW.....GSGHTDAIVTEN.....LS...AA
  83 ....D.....S.....LDEA....VAH....I.RAY.....SSAHTEAIITDS.....QA...AA
  84 ....P.....G.....LDEA....IEH....I.ARH.....SSGHTESILTED.....WS...RA
  85 ....K.....N.....VDEA....IEH....I.KKY.....STGHSESILTEN.....YS...NA
  86 ....D.....S.....IDEA....MAH....I.ERY.....GSGHTEAIVTAD.....YQ...RS
  87 ....S.....G.....IDEA....IEH....I.NTH.....GSHHTDVIITDN.....YT...KS
  88 ....D.....D.....LDAA....MIH....I.NTH.....GSQHTDAIVTED.....YG...RA
  89 ....D.....G.....LNEA....IDH....I.NAY.....GSLHTEAIVTRD.....YH...NS
  90 ....D.....S.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
  91 ....S.....S.....LEEA....ISW....I.NQY.....TSHHSEAIITRD.....IK...AA
  92 ....D.....D.....VDEA....IAF....I.EKY.....GSKHSDAIITEN.....YT...KA
  93 ....D.....D.....VDEA....IAF....I.EKY.....GSKHSDAIITEN.....YT...KA
  94 ....S.....S.....LEEA....IFW....I.NQH.....TSHHSEAIITRD.....IK...VA
  95 ....S.....S.....LEEA....ISW....I.NQH.....TSHHSEAIITRD.....IK...AA
  96 ....D.....S.....LDEA....IAR....I.NRY.....GSHHTDAILTTN.....HP...NA
  97 ....K.....N.....LEEA....MDH....I.DAH.....SSRHTEVIVTEN.....HA...TA
  98 ....A.....D.....LDEA....IEH....I.ERY.....GSHHTDSIVTEN.....YT...RA
  99 ....A.....G.....FDDA....VAH....I.ERY.....SSGHTEAIVTES.....YP...LA
 100 ....S.....S.....LEEA....ISW....I.NQH.....TSHHSEAIITRD.....IK...AA
 101 ....D.....G.....IDAA....IEH....I.NEY.....GSHHTDAIVTED.....HD...RA
 102 ....S.....S.....LDQA....LEH....I.NLY.....GSHHTDSIVTED.....YS...RA
 103 ....S.....S.....LEEA....ISW....I.NQH.....TSHHSEAIITRD.....TK...AA
 104 ....D.....S.....IDDA....ISH....I.TKY.....GSGHSEAIITTN.....YS...NA
 105 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 106 ....A.....G.....LDEA....IAH....I.NEY.....GSHHTDSIITEN.....YS...TG
 107 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTED.....EN...TA
 108 ....D.....S.....LDEA....LSH....I.ARY.....GSGHTESIVTQN.....YT...SS
 109 ....D.....T.....MDEA....ILH....I.NRY.....GSHHTDSIITEN.....YT...KS
 110 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTED.....EN...TA
 111 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 112 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTED.....EN...TA
 113 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 114 ....D.....S.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 115 ....K.....D.....FQDA....LDH....I.QQY.....SSGHSESIVTNN.....QN...TA
 116 ....D.....S.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 117 ....S.....S.....IDEA....IDF....I.NEH.....NTKHSEAIITEN.....YT...RS
 118 ....D.....G.....IDAA....IEH....I.NEY.....GSHHTDAIVTED.....HD...RA
 119 ....A.....D.....IDTA....VDH....I.RQY.....SSGHSEAILTDD.....IH...AA
 120 ....D.....S.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 121 ....A.....D.....MDEA....IAH....I.NRY.....GSHHTDSIITEN.....YS...KA
 122 ....T.....D.....IDAA....IDH....I.REH.....GTSHSDAILTRS.....LS...SA
 123 ....D.....S.....VQDA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 124 ....D.....G.....VDAA....IEH....I.NTY.....GSAHTDSIVTEN.....YS...TG
 125 ....A.....D.....IDTA....VDH....I.RTY.....SSGHSEAILTDD.....IH...AA
 126 ....N.....D.....IDTA....IAH....I.RTY.....SSGHSEAILTDD.....IH...TA
 127 ....D.....G.....LDAA....IDH....I.NTH.....GSHHTDVIITNN.....YS...KS
 128 ....D.....S.....FEQA....ISW....I.NKY.....SSHHSEAIITNN.....IS...RA
 129 ....A.....D.....IDEA....ITH....I.ATY.....GSQHTDTIVTEN.....YS...RA
 130 ....D.....G.....IDAA....IEH....I.NEY.....GSHHTDAIVTED.....HD...RA
 131 ....A.....D.....IDTA....IDH....I.RTH.....GTSHSDAILTRS.....LS...SA
 132 ....D.....G.....LDAA....IAH....I.NTY.....GSAHTDSIITEN.....YT...TG
 133 ....A.....D.....IDAA....ISH....I.REH.....GTSHSDAILTRS.....LS...SA
 134 ....D.....S.....LDEA....INW....I.NTY.....TTSHSEAIVTQD.....IS...RA
 135 ....N.....G.....IDTA....IAH....I.RTY.....SSGHSEAILTDD.....IH...AA
 136 ....D.....G.....IDAA....IEH....I.NEY.....GSHHTDAIVTED.....HD...RA
 137 ....D.....S.....LDEA....LSH....I.ARY.....GSGHTESIVTQN.....YT...SS
 138 ....A.....D.....IDAA....INH....I.REH.....GTSHSDAILTRS.....LS...SA
 139 ....D.....S.....FEQA....ISW....I.NKY.....SSHHSEAIITNN.....IS...RA
 140 ....D.....S.....LDEA....INW....I.NTY.....TTSHSEAIVTQD.....IS...RA
 141 ....D.....S.....LDEA....INW....I.NTY.....TTSHSEAIVTQD.....IS...RA
 142 ....S.....D.....IDTA....IAH....I.RTY.....SSGHSEAILTDD.....IH...VA
 143 ....D.....D.....FDGA....LEH....I.KRF.....GSGHTEVIVTEN.....DQ...TA
 144 ....D.....S.....LDEA....LSH....I.ARY.....GSGHTESIVTQN.....YT...SS
 145 ....D.....S.....VDEA....INH....I.NKY.....GTKHSEAIISND.....YA...TG
 146 ....D.....G.....FEQA....VAH....I.RHY.....GTQHSDAILTRS.....IQ...AA
 147 ....D.....D.....LDAA....VAH....I.REH.....GTQHSDAILTRS.....LS...NA
 148 ....D.....D.....IEQA....IAH....I.REY.....GSQHSDGILTGS.....QR...LA
 149 ....S.....D.....IDDA....VSH....I.RQY.....SSGHSEAILTDD.....IH...AA
 150 ....S.....G.....IDEA....IEH....I.NQY.....SSHHSEAIITDN.....HP...KA
 151 ....D.....S.....VDEA....INH....I.NKY.....GTKHSEAIISND.....YA...TG
 152 ....D.....S.....VDEA....INH....I.NKY.....GTKHSEAIISND.....YA...TG
 153 ....S.....G.....IDEA....IEH....I.NTH.....GSHHTDVIITDN.....YT...KS
 154 ....T.....D.....IDAA....IDH....I.REH.....GTSHSDAILTRS.....LS...HA
 155 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 156 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 157 ....D.....G.....VDAA....IEH....I.NTY.....GSAHTDSIVTEN.....YS...TG
 158 ....S.....G.....IDEA....IEH....I.NTH.....GSHHTDVIITDN.....YT...KS
 159 ....E.....S.....LDAA....IRH....I.NLY.....SSKHTESIVTRN.....LA...AA
 160 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...NV
 161 ....D.....S.....LAAA....TDH....I.NHY.....GSGHTDAIVTSN.....IA...AS
 162 ....D.....G.....VQEA....IGH....I.ARY.....GSNHTDCILTED.....AA...AV
 163 ....D.....G.....VRGA....IDH....I.SHY.....ATGHTESILTED.....ED...TA
 164 ....D.....S.....LDRA....VAH....I.RLW.....SSGHTEAIVTTS.....QQ...AA
 165 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...NV
 166 ....T.....D.....IDAA....IDH....I.REH.....GTSHSDAILTRS.....LS...HA
 167 ....D.....N.....YEGA....IEH....I.QEF.....GSGHTEVIITEN.....DE...TA
 168 ....D.....D.....VDAA....IAH....I.RQY.....GSNHTDCVITED.....DA...VA
 169 ....D.....S.....EEEA....IQH....I.NAH.....NTKHSEAIITDN.....YQ...NS
 170 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...NV
 171 ....D.....N.....LDAA....IDH....I.RTY.....SSSHTDAILTED.....DA...AA
 172 ....D.....D.....LDAA....LAH....I.VEY.....GSQHTEAIVTSN.....HP...RA
 173 ....A.....G.....IDEA....IAH....I.NQY.....SSHHTDAILTRD.....HM...HA
 174 ....D.....N.....LDEA....IEH....I.NTY.....SSRHSESIVTHD.....YF...NA
 175 ....D.....S.....EAAA....ITH....I.NRY.....NTQHSEAIVTDN.....YQ...AG
 176 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
 177 ....S.....G.....VEEA....IAH....I.NRY.....SSHHTDAILTRD.....HM...HA
 178 ....R.....S.....FEDA....KSY....I.RKY.....GSQHTEAIITEN.....YT...TA
 179 ....D.....G.....LDAA....IEH....I.NHY.....GSHHTDAIVTED.....HD...RA
 180 ....D.....S.....FEQA....ISW....I.NKY.....SSHHSEAIITNN.....IS...RA
 181 ....K.....G.....IEEA....VEH....I.REY.....GSEHSESILTES.....QK...LA
 182 ....D.....G.....IGGA....IEH....I.ETF.....SSHHTEAIIAED.....PK...AV
 183 ....S.....D.....IDAA....IAH....I.RRH.....SSGHSEAILTDD.....IH...AA
 184 ....E.....D.....IHAA....IEH....I.RQY.....GTQHSESILTSS.....QN...LA
 185 ....E.....D.....IHAA....IEH....I.RQY.....GTQHSESILTSS.....QN...LA
 186 ....D.....S.....LDEA....IAH....I.NRH.....STGHTESIIAED.....YS...AI
 187 ....D.....S.....TREA....IDW....I.NHY.....GTRHSEAIVTAN.....YE...EA
 188 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 189 ....P.....N.....VDEA....IEH....I.NHF.....GTKHSEAILTEN.....LS...HA
 190 ....D.....G.....LAGA....VAH....I.EAH.....GSHHTDSIVTED.....VA...TA
 191 ....E.....S.....DDEA....LNH....I.AEY.....GSNHTEVIVTDR.....LP...TA
 192 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...NV
 193 ....Q.....G.....VDEA....MDH....I.YQY.....GTKHSETIITEN.....YT...TA
 194 ....A.....S.....IDEA....IAH....I.RRY.....HSAHTDCIITEN.....DA...AV
 195 ....G.....S.....LEEA....CDH....I.ETY.....GTKHSEAIITEN.....PE...TA
 196 ....N.....S.....LGEA....IDW....I.NTY.....TSHHSESIITRD.....IQ...AA
 197 ....D.....G.....VGAA....VEH....I.NTH.....GSHHTEAIVAED.....SQ...VA
 198 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 199 ....E.....D.....IHAA....IEH....I.RQY.....GTQHSESILTSS.....QS...LA
 200 ....S.....T.....TEEA....IHH....I.NTY.....GSMHSEAIITEN.....EE...NV
 201 ....D.....S.....LDDA....ISH....I.NHY.....STHHSESIITNN.....IT...RG
 202 ....D.....G.....ISGA....IDH....I.NRY.....SSHHTEAIVAED.....AQ...TV
 203 ....D.....G.....VKAA....VDH....I.NTY.....GSHHTEAILAED.....AG...AA
 204 ....D.....G.....VDGA....IAH....I.RRY.....GSSHTESILTEN.....DV...TA
 205 ....E.....D.....IHAA....IEH....I.RQY.....GTQHSESILTSS.....QN...LA
 206 ....D.....G.....ISGA....IDH....I.NRY.....SSHHTEAIVAED.....AQ...TV
 207 ....E.....D.....LDDA....LDH....I.RTY.....GSNHTDAIIAED.....DA...AV
 208 ....D.....D.....LSKA....VSH....I.RAH.....SSGHSDGILTQS.....LK...SA
 209 ....D.....S.....LDDA....VAH....I.RRW.....GSGHTEAIVTRS.....LP...AS
 210 ....D.....G.....ISGA....IDH....I.NRY.....SSHHTEAIVAED.....AQ...TV
 211 ....D.....G.....VDEA....IAH....I.RRY.....GSSHTESILTEN.....DA...TA
 212 ....A.....G.....IDEA....IRH....I.RQY.....GTRHSEAILTEN.....QE...NA
 213 ....D.....G.....ISGA....IDH....I.NRY.....SSHHTEAIVAED.....AQ...TV
 214 ....A.....D.....LDAA....LAH....I.RAH.....SSGHTEAIVTED.....RA...AA
 215 ....D.....G.....VEEA....IAH....I.RRH.....GSGHTESILTEN.....DA...TA
 216 ....N.....S.....LEEA....LEH....I.ARY.....GSHHTEAICTNH.....HA...HA
 217 ....D.....G.....VDEA....IAH....I.RRY.....GSSHTESILTEN.....DA...TA
 218 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
 219 ....G.....S.....IDDA....ITH....I.RTY.....GSNHTDCIITED.....DA...AA
 220 ....D.....G.....VDAA....IAH....I.NEY.....GTGHTEAIVTTN.....MA...AA
 221 ....D.....N.....LTKA....VEH....I.REY.....GSQHSEAILTSD.....YQ...LA
 222 ....D.....D.....MDEA....LAH....I.AAY.....GSNHTEIICTRD.....HG...NA
 223 ....A.....D.....VQEA....IDH....M.REH.....NASHSDAIMTNH.....LQ...NA
 224 ....A.....D.....LDEA....LAH....I.AAH.....SSDHTDCILTED.....AA...AA
 225 ....D.....S.....LDDA....ISH....I.NHY.....STHHSESIITNN.....IT...RG
 226 ....G.....S.....IDDA....ITH....I.RTY.....GSNHTDCIITED.....DA...AA
 227 ....D.....G.....ISGA....IEH....I.NTW.....SSAHTEAVIAED.....PA...VV
 228 ....Q.....G.....VDEA....MDH....I.YQY.....GTKHSETIITEN.....YT...TA
 229 ....A.....D.....VQEA....IDH....M.REH.....NASHSDAIMTNH.....LQ...NA
 230 ....D.....S.....IEDA....IAH....I.NEY.....GSRHTDAIITED.....ST...SV
 231 ....D.....S.....LTEA....IAH....I.NQY.....GSRHTDAIITED.....VA...AV
 232 ....D.....G.....VQDA....IEH....I.HKY.....GSSHTDAIITEN.....EQ...TA
 233 ....A.....D.....IDDA....IAH....I.RKY.....HSQHTDCIITED.....ES...AV
 234 ....S.....D.....VKDA....IDH....M.RVH.....NASHSDAIMTNS.....LE...NS
 235 ....D.....S.....LDRA....VEH....I.RLW.....TSGHTEAIVTTS.....QQ...AA
 236 ....D.....S.....AEEA....IDH....I.NKY.....GTKHSEAIISND.....YA...TG
 237 ....D.....S.....LTEA....IAH....I.NQY.....GSRHTDAIITED.....VA...AV
 238 ....D.....S.....LEAA....IDH....I.NQY.....GSKHTDGIISED.....LT...AA
 239 ....A.....G.....VDEA....IAH....I.NRY.....SSHHTDAILTRD.....HM...HA
 240 ....D.....S.....AEEA....IDH....I.NKY.....GTKHSEAIISND.....YA...TG
 241 ....H.....D.....VQEA....VRH....I.QQY.....GTNHSEAILTEN.....GE...HA
 242 ....A.....D.....VAEA....IAH....M.RKH.....NASHSDAILTND.....IQ...SA
 243 ....D.....G.....VFEA....IEH....I.GTY.....SSHHTEAIVAED.....PV...AV
 244 ....D.....G.....PDEA....IPF....V.SEH.....SSAHTDAIVTED.....AQ...VA
 245 ....D.....D.....MDDA....LSH....I.ARY.....SSGHTDAILTEN.....RE...VA
 246 ....N.....D.....MEEA....IEH....I.TRY.....GSQHTEAIVTGN.....FE...RA
 247 ....D.....S.....LTEA....IAH....I.NQY.....GSRHTDAIITED.....VA...AV
 248 ....D.....S.....LDSA....IAH....I.NNY.....GSGHTDAIITED.....GK...AA
 249 ....D.....N.....MSQA....LDH....I.HQF.....GSHHTEVICTED.....RM...RA
 250 ....P.....N.....LDAA....LEH....I.RRY.....GSDHTEVIVTAD.....PA...HA
 251 ....D.....S.....LEAA....INH....I.NTY.....GSKHTDAIITED.....KN...SA
 252 ....N.....D.....IDEA....VEH....I.RHY.....STGHSEAILTDN.....IH...TA
 253 ....D.....G.....VQDA....IEH....I.HKY.....GSSHTDAIITEN.....EQ...IA
 254 ....Q.....D.....IEAA....VAH....I.REY.....GSQHSEAILTES.....LQ...LA
 255 ....A.....D.....VDEA....IGH....I.RRY.....GTKHSEAIITEN.....EV...NV
 256 ....P.....N.....LDAA....LEH....I.RRY.....GSDHTEVIVTAD.....PA...HA
 257 ....D.....H.....FDHA....IQH....I.ARF.....GSQHTEVICTEN.....EV...TA
 258 ....D.....N.....LDAA....VEH....I.NTW.....GTGHTEAIVTGD.....LA...AA
 259 ....D.....S.....IEEA....IDH....I.NKY.....GSHHTDAIITEN.....KT...KR
 260 ....D.....D.....VDDA....ITH....I.HEH.....GSHHTDAIVAED.....AK...TA
 261 ....N.....S.....VDEA....IAH....I.DRY.....GSKHSEAIVSET.....DA...NV
 262 ....D.....G.....VDGA....IAH....I.QNH.....GSHHTDAIVSEN.....EA...AA
 263 ....P.....N.....LDAA....LEH....I.RRY.....GSDHTEVIVTAD.....PA...HA
 264 ....Q.....D.....VQEA....IEH....M.REH.....NASHSDAIMTND.....LY...NA
 265 ....A.....D.....VAEA....IAH....M.RKH.....NASHSDAILTND.....IQ...SA
 266 ....Q.....D.....VQEA....IEH....M.REH.....NASHSDAIMTND.....LY...NA
 267 ....Q.....D.....VQEA....IEH....M.REH.....NASHSDAIMTND.....LY...NA
 268 ....T.....D.....FDHA....INH....I.RRF.....GSHHTEVICTQN.....EL...TA
 269 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...KV
 270 ....D.....G.....VGEA....IDH....I.QRH.....GSHHTDAIVTDD.....SN...TA
 271 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...KV
 272 ....D.....G.....VDAA....IAH....I.NEY.....GTGHTEAIVTTN.....LD...AA
 273 ....D.....G.....ISGA....IEH....I.GTY.....SSNHTEAVIAED.....PD...VV
 274 ....D.....G.....ISGA....IEH....I.GTY.....SSNHTEAVIAED.....PD...VV
 275 ....D.....G.....VDEA....MAH....I.RRH.....GSQHTDAIVTRD.....QP...TA
 276 ....S.....G.....LDEA....LAH....I.ARY.....GTGHSEAIVTGD.....AG...AA
 277 ....D.....D.....FDTA....IEH....I.ETY.....SSGHTEVIATQD.....FS...RA
 278 ....N.....D.....VDEA....IFH....M.RKH.....NASHSDSILTNN.....LQ...SA
 279 ....D.....D.....FDHA....IDH....I.RAF.....GSHHTEVISTKN.....DA...TA
 280 ....N.....D.....LEEA....IAH....I.QKF.....SSKHTDGIITEN.....IN...NA
 281 ....D.....G.....VDEA....IDH....I.RTY.....GSNHTDAIITED.....QK...AA
 282 ....P.....S.....LDAA....IAH....I.NEY.....GSGHTDAIATED.....AA...AA
 283 ....D.....S.....QDEA....QDY....I.AQH.....GSNHTEIICTRN.....HQ...NA
 284 ....A.....D.....VDEA....IAH....I.NQH.....STKHSESIITAN.....DA...HA
 285 ....D.....G.....CGGA....IDH....I.QRH.....GSRHTDAIVTED.....PE...TA
 286 ....S.....D.....VKDA....IDH....M.RVH.....NASHSDAIMTNS.....LE...NS
 287 ....D.....G.....CGGA....IDH....I.QRH.....GSRHTDAIVTED.....PE...TA
 288 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 289 ....K.....D.....FDQA....VAH....I.HRF.....GSRHTEVICTEN.....EL...TA
 290 ....A.....D.....IDEA....IAH....I.RHY.....SSGHSEAILTDN.....LA...AA
 291 ....D.....G.....VDAA....IAH....I.NEY.....GTGHTEAIVTTN.....MA...AA
 292 ....D.....G.....AEDA....IAH....I.AAH.....ASHHTDAIITDD.....GA...RA
 293 ....D.....D.....MDMA....IAH....I.RRF.....SSGHSEGILSDN.....IH...AT
 294 ....D.....S.....VSEA....IDH....I.NRY.....GTRHSEAIITEN.....KM...NA
 295 ....E.....G.....IEGA....IAH....I.RRY.....SSGHTESIIAED.....MK...VV
 296 ....K.....G.....FEEA....LEH....I.AIY.....GSQHSESIITQN.....HS...IA
 297 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 298 ....D.....G.....ISGA....IAH....I.QTY.....SSNHTEAVIAED.....PA...VV
 299 ....E.....N.....IDEA....IAH....I.RHF.....GSNHTDCIVTED.....DA...AA
 300 ....A.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQD.....PD...NA
 301 ....A.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQD.....PD...NA
 302 ....N.....D.....VDEA....IFH....M.RKH.....NASHSDSILTNN.....LQ...SA
 303 ....A.....D.....VKEA....IDH....M.RVH.....NASHSDAIMTNS.....LI...NS
 304 ....A.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQD.....PD...NA
 305 ....P.....D.....LDTA....LAH....I.RQH.....GSDHTEVIATQD.....AD...NA
 306 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTEDg33hlKN...TA
 307 ....P.....N.....VDAA....LEH....I.RRY.....GSDHTEVIVTAD.....PA...HA
 308 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 309 ....D.....G.....VAGA....IDH....I.ESH.....SSHHTEAIVTDD.....AA...MA
 310 ....D.....T.....IKEA....IAH....I.NTF.....GSHHTDGIITEN.....AS...RR
 311 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 312 ....G.....S.....LDEA....IAH....I.QQY.....GSRHTEAIVTED.....AA...AA
 313 ....S.....G.....IDEA....IEH....I.RAY.....SSGHTEVIVTKD.....LD...NA
 314 ....D.....G.....VDGA....IVH....I.HNH.....GSHHTDAIVAED.....AQ...AA
 315 ....P.....N.....VDAA....LEH....I.RRY.....GSDHTEVIVTAD.....PA...HA
 316 ....E.....N.....VQEA....VKH....I.QQY.....GTNHSEAILTEN.....DK...NA
 317 ....S.....S.....IDQA....LDH....I.SRH.....GSRHTDSIVTND.....PK...TA
 318 ....D.....S.....LDDA....IAH....I.RRH.....GTGHSEAIVTRS.....QT...AA
 319 ....D.....G.....VDAA....IAH....V.NEY.....GSGHTEAIVTAD.....LA...AA
 320 ....P.....D.....LEGA....LDH....I.RRY.....SSRHTEAIVSND.....QE...TA
 321 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 322 ....P.....D.....LDAA....LDH....I.ATY.....GSGHTEAIVTED.....AA...AA
 323 ....D.....T.....IKEA....VDH....I.NTF.....GSHHTDGIITEN.....AS...RR
 324 ....A.....G.....LDAA....IDH....I.TKY.....STKHTESIITND.....LA...NA
 325 ....D.....S.....LDQA....LDH....I.RRW.....SSGHTEAIVTRS.....LA...AS
 326 ....P.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQD.....AD...NA
 327 ....D.....N.....LDEA....IEH....I.NTY.....SSRHSESIVTHD.....YF...NA
 328 ....P.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQT.....PA...NA
 329 ....D.....S.....FEVA....TQH....I.AKF.....GSHHTEVICTDN.....EL...TA
 330 ....S.....G.....LEEA....LAH....I.ARY.....GSRHTEAICTED.....PK...AA
 331 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 332 ....A.....D.....VAEA....IDH....M.RVH.....NASHSDAIMTNS.....LE...SS
 333 ....A.....D.....VAEA....IDH....M.RVH.....NASHSDAIMTNS.....LE...SS
 334 ....D.....N.....VQDA....IDH....I.HKY.....GSSHTDVIVTED.....EN...TA
 335 ....D.....G.....VDGA....ISH....I.NEY.....GTGHTEAIVTTD.....LA...AA
 336 ....D.....G.....VEEA....IEH....I.VRF.....GSGHSEAIVTQN.....VT...TA
 337 ....D.....S.....FEVA....TQH....I.AKF.....GSHHTEVICTDN.....EL...TA
 338 ....E.....G.....VEGA....IEH....I.VRY.....SSGHTESIIAED.....VG...VV
 339 ....D.....D.....LEEA....INH....I.QKF.....SSKHTDGIITEN.....ST...SA
 340 ....D.....S.....MQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EN...TA
 341 ....D.....G.....CGGA....IDH....I.QRH.....GSHHTDAIVTAD.....PV...AA
 342 ....R.....N.....VNEA....IEH....I.RKY.....SSRHTEAIVTED.....KM...VA
 343 ....D.....G.....VEGA....IAH....I.QAH.....GSHHTDAIVTAD.....VA...AA
 344 ....D.....G.....VAGA....ARH....I.ASY.....GSGHTDAIITED.....AA...AA
 345 ....D.....D.....VDDA....IVH....I.HDH.....GSHHTDAIVAED.....AQ...TA
 346 ....A.....D.....TNEA....IAH....I.NQY.....GTKHSEAIITES.....LA...ER
 347 ....D.....G.....LDGA....LAH....I.DAH.....SSRHTDAIVTED.....AA...TA
 348 ....S.....G.....LEEA....LAH....I.ARY.....GSRHTEAICTED.....PK...AA
 349 ....P.....D.....LDTA....LAH....I.RQY.....GSDHTEVIATQT.....PA...NA
 350 ....D.....D.....VQSA....IDH....I.HRY.....GSAHTDCVVTTD.....DK...VA
 351 ....G.....S.....LDEA....IAH....I.ERY.....GSRHTEAIVTED.....AA...AA
 352 ....S.....D.....LDAA....IDH....I.NTH.....STGHTESIIAED.....YA...AI
 353 ....D.....D.....VQSA....IDH....I.HRY.....GSAHTDCVVTTD.....DK...VA
 354 ....S.....D.....LDAA....IDH....I.NTH.....STGHTESIIAED.....YA...AI
 355 ....D.....G.....VDGA....ISH....I.NEY.....GTGHTEAIVTTD.....LA...AA
 356 ....D.....S.....FEVA....TQH....I.AKF.....GSHHTEVICTDN.....EL...TA
 357 ....S.....D.....LEEA....LEH....I.RRH.....GSRHTEAIASQD.....GA...TA
 358 ....D.....S.....MQDA....VDH....I.HKY.....GSFHTDVIITEN.....ED...TA
 359 ....D.....D.....VYAA....IEH....I.NHH.....GSAHTDCIIAED.....HK...VA
 360 ....S.....D.....LGAA....IDH....I.NTH.....STGHTESIIAED.....YA...AI
 361 ....D.....G.....VDAA....LAH....I.AQH.....GSHHTEAIVTAD.....QS...VA
 362 ....E.....D.....FDAA....AKH....I.ARF.....GSHHTEVICTNN.....EV...TA
 363 ....D.....G.....VDAA....LAH....I.AQH.....GSHHTEAIVTAD.....QS...VA
 364 ....E.....S.....VEGA....IAH....I.KRY.....SSGHTESIIAED.....ME...IV
 365 ....E.....D.....VHGA....IDH....I.HQH.....GSAHTDCIVTED.....SE...VA
 366 ....D.....D.....VYAA....IDH....I.NRY.....GSAHTDSIVTED.....HE...VA
 367 ....A.....S.....VEEA....VGH....I.EAR.....GTHHSDGIVTEN.....RH...AA
 368 ....E.....D.....VYAA....IDH....I.HQH.....GSAHTDSIITED.....QE...VA
 369 ....D.....D.....VQSA....IDH....I.HRY.....GSAHTDCIVTTD.....DK...VA
 370 ....D.....D.....VQSA....IDH....I.HRY.....GSAHTDCIVTTD.....DK...VA
 371 ....E.....D.....FDAA....AKH....I.ARF.....GSHHTEVICTNN.....EV...TA
 372 ....E.....D.....LAEA....VEH....V.RRF.....GSRHTECIVTED.....EA...AA
 373 ....D.....D.....VQSA....IDH....I.NRY.....GSAHTDCIITTD.....GK...AA
 374 ....S.....S.....VEEA....ISH....I.DQH.....STGHSEAIVTEN.....SQ...TA
 375 ....P.....S.....FAAA....VEH....I.AQF.....GSHHTEVICTKN.....AA...TA
 376 ....D.....G.....LDGA....LLH....I.ARY.....GSHHTEAIVTQD.....EA...AA
 377 ....D.....G.....VEDA....LDH....I.ARH.....GSSHTEAIIAED.....PE...AA
 378 ....D.....G.....LDEA....IEW....V.EGH.....SSHHTDAILTED.....AE...AA
 379 ....D.....S.....LDEA....VQH....I.RKW.....STGHTEAIITND.....LA...NA
 380 ....D.....T.....IKEA....IDH....I.NTF.....GSHHTDGIITED.....AS...RR
 381 ....D.....D.....LEEA....IKH....I.QKY.....SSKHTDGIITEN.....SN...TA
 382 ....A.....D.....VNEA....AAH....M.QKH.....NASHSDTILTNN.....IE...SA
 383 ....P.....S.....MDAA....LEH....I.RRH.....GSRHTEAIATTD.....DQ...AA
 384 ....K.....N.....LEEA....IDH....V.HTY.....GSGHTDVIVTEN.....PT...SA
 385 ....S.....S.....VDEA....MLH....I.RRY.....GSRHTDAIATTN.....KE...IA
 386 ....D.....D.....LDAA....IEH....I.RTH.....STQHTEAIVTND.....LA...NA
 387 ....D.....D.....LEAA....TDH....I.RSY.....GSRHTEVILTED.....AQ...TA
 388 ....E.....S.....LEEA....LEH....I.ARH.....GSRHTDAICTTD.....PE...TA
 389 ....P.....D.....LDGA....IAH....I.RRW.....SSQHTEAIVTED.....LA...AA
 390 ....D.....D.....VQSA....IDH....I.HRY.....GSAHTDCIVTTD.....DK...VA
 391 ....G.....S.....IDEA....LDH....I.ALY.....G-GHSEAILTGD.....PI...SA
 392 ....S.....D.....IEDA....INH....I.HKY.....GSGHTDCIVTEN.....KE...RA
 393 ....K.....D.....LEEA....IDH....V.HTY.....GSGHTDVIVTEN.....DS...AA
 394 ....D.....D.....LDAA....FEH....I.TRF.....GSHHTEVICTAN.....EI...TA
 395 ....D.....D.....VYAA....IDH....I.HRH.....GSAHTDSIITED.....HE...VA
 396 ....K.....D.....IQQA....IAH....I.TEY.....GTQHSEAILTSS.....PR...LA
 397 ....D.....G.....LDEA....LAH....I.ARH.....ASGHTDAIVAAD.....QD...VA
 398 ....P.....S.....LEEA....INH....I.HTF.....GSGHTDVIVTEN.....DA...AA
 399 ....S.....D.....LDEA....LAH....I.RKY.....SSQHSDGILSND.....LA...QT
 400 ....E.....D.....VYGA....IDH....I.HRH.....GSAHTDCIVTED.....HE...VA
 401 ....Q.....D.....VQEA....IEH....M.REH.....NASHSDAIMTND.....LY...NA
 402 ....E.....D.....VYGA....IDH....I.HRH.....GSAHTDCIVTED.....HE...VA
 403 ....E.....D.....VYGA....IDH....I.HRH.....GSAHTDCIVTED.....HE...VA
 404 ....S.....S.....FDTA....IGH....I.NEF.....TSDHTEVIISQD.....IS...RS
 405 ....D.....G.....VDAA....IAH....I.REF.....GSNHTDAIITED.....AQ...AA
 406 ....A.....D.....LDGA....LDH....I.ARY.....GSLHTEAIVTRD.....LA...SA
 407 ....E.....D.....VYGA....VDH....I.HRH.....GSAHTDCIVTED.....PE...VA
 408 ....N.....G.....IDEA....LEH....I.AHF.....GSAHSESIITQD.....EV...IA
 409 ....D.....G.....FDEA....TAH....I.ARH.....SSAHTDVIVTSD.....DA...VA
 410 ....S.....S.....LEEA....LAF....I.EKT.....SSGHTEAIVTED.....LN...TA
 411 ....D.....D.....LEEA....VDH....I.AKH.....GSGHSETIVTKS.....MS...SQ
 412 ....S.....S.....LEEA....LAF....I.EKT.....SSGHTEAIVTED.....LN...TA
 413 ....K.....D.....IQQA....IAH....I.TEY.....GTQHSEAILTSS.....PR...LA
 414 ....A.....S.....VEEA....VGH....I.EAH.....GTHHSDGIVTEN.....RH...AA
 415 ....D.....D.....VYAA....IDH....I.NLY.....GSAHTDSVVAED.....HE...VA
 416 ....S.....S.....LEEA....VAH....I.ESH.....STHHSDAIVTEN.....AE...AA
 417 ....H.....N.....NDEA....ITW....I.NDH.....TTHHSETIISED.....LN...HV
 418 ....P.....S.....LDEA....INH....I.HTY.....GSSHTDVIVTEN.....DA...AA
 419 ....K.....D.....CDEA....IEH....I.NKH.....SSLHSETIISND.....AS...NI
 420 ....E.....D.....VFDA....INH....I.HEH.....GSAHTECIVTED.....RE...VA
 421 ....D.....S.....VQDA....VEH....I.ARW.....TSAHTEAVLATD.....VR...VT
 422 ....K.....D.....CDEA....IEH....I.NKH.....SSLHSETIISND.....AS...NI
 423 ....K.....D.....CDEA....IEH....I.NKH.....SSLHSETIISND.....AS...NI
 424 ....K.....D.....CDEA....IEH....I.NKH.....SSLHSETIISND.....AS...NI
 425 ....E.....D.....VYGA....IDH....I.HRH.....GSAHTDCIVTED.....HE...VA
 426 ....K.....N.....LEES....LEH....I.SEF.....SSGHSEAVISES.....YS...IC
 427 ....P.....T.....VEDA....MAH....I.NSH.....GSSHTDCIITDN.....ET...TA
 428 ....S.....S.....LEEA....VAH....I.ESH.....STHHSDAIVTEN.....AE...AA
 429 ....E.....D.....VYGA....IDH....I.HRH.....GSGHTDCIVTED.....PE...VA
 430 ....K.....S.....MDEA....VNH....I.HTY.....GSGHTEVIVTEN.....SE...SA
 431 ....D.....S.....LESA....IDH....I.NTN.....GSKHTESIVTED.....DG...RA
 432 ....A.....S.....VEEA....VWH....I.ETH.....STHHSDGIVTEN.....RH...AA
 433 ....K.....D.....CDEA....IEH....I.NKH.....SSLHSETIISND.....AS...NI
 434 ....A.....S.....AADA....ISH....I.NTH.....SSKHTESIITEN.....KA...TA
 435 ....D.....S.....FEQA....ISW....I.NKY.....SSHHSEAIITNN.....IS...RA
 436 ....D.....D.....LACA....TEH....I.RRY.....GSRHTEVILTED.....LA...TA
 437 ....K.....D.....CNEA....IEH....I.NKH.....SSLHSETIISNN.....AS...NI
 438 ....D.....N.....VDEA....IKH....I.NEH.....SSKHTECIITED.....KA...IA
 439 ....D.....D.....VYAA....IHH....I.NLY.....GSAHTDSIVTED.....HE...VA
 440 ....D.....G.....VDAA....IEH....I.EKY.....STHHTEAIATNN.....VF...TA
 441 ....A.....E.....LKEA....CDF....I.NQH.....SSGHTEAILTEE.....AT...AA
 442 ....S.....S.....MDEA....IAH....I.NQY.....GSHHTDVILTQD.....EK...LA
 443 ....D.....N.....VEEA....VAH....I.IRY.....GSGHTESIITEN.....TN...TA
 444 ....D.....N.....VEEA....VAH....I.IRY.....GSGHTESIITEN.....TN...TA
 445 ....D.....G.....VDGA....LAH....I.AKY.....STKHTEAIATQN.....IE...TA
 446 ....S.....S.....MDEA....IAH....I.NQY.....GSHHTDVILTQD.....EK...LA
 447 ....D.....N.....VEEA....VAH....I.IRY.....GSGHTESIITEN.....TN...TA
 448 ....D.....D.....VTGA....INH....V.HKH.....GSSHTDVIVTNN.....EE...TA
 449 ....K.....D.....MYDA....IDH....I.HKF.....GSSHTDVIVTDN.....EE...NA
 450 ....D.....G.....VDAA....MEH....I.RTY.....STKHTEAIATGN.....IV...TA
 451 ....D.....G.....VEEA....VAH....I.NRY.....GTSHTEGIAARD.....YK...TT
 452 ....K.....D.....MYDA....IDH....I.HKF.....GSSHTDVIVTDN.....EE...NA
 453 ....K.....D.....MYDA....IDH....I.HKF.....GSSHTDVIVTDN.....EE...NA
 454 ....E.....D.....VYGA....IDH....I.HQH.....GSAHTDCIVTED.....SE...VA
 455 ....D.....G.....VDGA....LAH....I.AKY.....STKHTEAIATQN.....IE...TA
 456 ....P.....S.....LQSA....MQH....I.NTH.....GSKHTDCIITSS.....EA...AA
 457 ....E.....D.....VYGA....IDH....I.HQH.....GSAHTDCIVTED.....SE...VA
 458 ....S.....S.....LDDA....ITH....I.NTR.....GSHHTDCILTAS.....AE...QA
 459 ....K.....D.....CDEA....IEH....I.NQH.....SSLHSETIISNN.....AL...NI
 460 ....P.....D.....VTAA....IDW....I.NTH.....TTHHSETIISQD.....PD...NI
 461 ....P.....N.....TVDA....INH....I.NEH.....SSKHTDAIITES.....KE...DA
 462 ....D.....D.....VHSA....IDH....I.HRH.....GSAH-DCIIAED.....LE...VA
 463 ....D.....D.....LDAA....LDH....I.ARH.....GSSHTEAIVTEN.....AD...AA
 464 ....S.....G.....LEEA....LAH....I.ARY.....GSRHTEAICTED.....PK...AA
 465 ....D.....T.....LDEA....LSH....I.ATY.....SSRHSEALITRD.....NA...VK
 466 ....P.....Sts7saVEDA....ISH....I.NSH.....SSKHTDLIVTES.....KE...IA
 467 ....Psn6ltD.....VEAA....IAH....I.NSH.....SSKHTDIIITES.....EN...IA
 468 ....E.....D.....MDAA....VDH....I.NKY.....GSHHTECILTSN.....VD...TA
 469 ....P.....N.....LEEA....LRH....I.ARH.....STKHSEVIVTRD.....RA...RA
 470 ....P.....N.....LEEA....LRH....I.ARH.....STKHSEVIVTRD.....RA...RA
 471 ....S.....S.....IEEA....LDH....I.AEY.....SSRHSEAIITND.....PE...AK
 472 ....G.....S.....LEEA....LNH....I.ARH.....SSKHSEAIIASD.....QT...TI
 473 ....K.....D.....CDDA....ISH....I.NKY.....GTMHTDSIITKN.....KK...TA
 474 t7gsS.....S.....VETA....VAH....I.NSH.....SSKHTDIILTRS.....KD...IA
 475 ....K.....S.....FEDA....LGH....I.QEN.....SSRHSECIVTEN.....KE...RA
 476 ....S.....G.....LEEA....LDF....I.AAH.....G-NHTDVILTRD.....PT...QA
 477 ....P.....N.....IKAA....IDH....I.QQF.....SSHHSEAVIAED.....ES...AI
 478 ....G.....N.....LEEA....LAH....I.SRY.....SSMHSEAIIATD.....PE...VR
 479 ....S.....S.....LEEA....LEH....I.TRY.....SSRHSEAIIATD.....PE...TT
 480 ....S.....S.....IDEA....ITH....I.NTH.....GSHHTDAIMTSD.....SA...EA
 481 ....N.....S.....FENA....LGH....I.QEY.....SSRHSESIVTEN.....PE...RA
 482 ....K.....D.....CNGA....ISH....I.NKY.....GTMHTDSIITKN.....KK...TA
 483 ....P.....N.....IKAA....IGH....I.QQF.....SSHHSEAIIAED.....ES...AI
 484 ....A.....N.....LDEA....LEH....I.ATY.....SSRHSEAIIATD.....AA...TV
 485 ....P.....D.....LSAA....IAH....I.NTH.....GSHHTEAILTAD.....QA...EA
 486 ....P.....N.....IKAA....IDH....I.QQF.....SSYHSEAVIAED.....ES...AI
 487 a6slS.....S.....LDAA....MAH....I.NAH.....SSKHTDVIITSS.....KE...TA
 488 ....D.....S.....LEDA....LKH....I.ARF.....SSMHSEAVIASD.....AV...VK
 489 ....S.....G.....LDEA....LDF....I.AER.....G-GHTDVILTRD.....PA...QA
 490 ....T.....S.....TESA....IQH....I.NTH.....SSRHTDAIVTEN.....KA...NA
 491 ....N.....N.....LKEA....IDW....I.GKH.....TTHHTEAILTNS.....AE...NA
 492 ....T.....S.....TESA....IQH....I.NTH.....SSRHTDAIVTEN.....KA...NA
 493 ....G.....N.....LEEA....LSH....I.ATY.....SSQHSEAIIADD.....PA...VK
 494 ....E.....S.....TEAA....VLH....I.NTH.....SSKHTDAIVTEN.....SE...NA
 495 ....D.....T.....LDDA....LEH....I.AAY.....SSQHSEAVITED.....PA...VK
 496 ....H.....D.....VQEA....VRH....I.QQY.....GTNHSEAILTEN.....GE...HA
 497 ....E.....S.....VQEA....IQH....I.NSH.....SSHHTDSIVTED.....EA...SM
 498 ....D.....D.....LAAA....IAH....V.NRH.....GSHHTDTILTVD.....KA...AA
 499 ....E.....S.....VQEA....IQH....I.NSH.....SSHHTDSIVTED.....EA...SM
 500 ....D.....S.....VQEA....VIH....I.NEH.....SSKHTDAIVTEC.....KQ...TA
 501 ....D.....S.....MQDA....VDH....I.HKY.....GSAHTDVIITEN.....EE...TA
 502 ....E.....N.....VQEA....VKH....I.QQY.....GTNHSEAILTEN.....DK...NA
 503 ....R.....S.....LDEA....IKF....I.NQR.....EKPLALYVFSNN.....DK...VI
 504 ....R.....S.....LEEA....IQF....I.NQR.....EKPLALYVFSNN.....EK...VI
 505 ....D.....S.....QDHA....IDM....I.NKY.....CGGHSAAIITRD.....NE...AA
 506 ....R.....S.....LDEA....IKF....I.NQR.....EKPLALYVFSNN.....DK...VI
 507 ....R.....S.....LEEA....IQF....I.NQR.....EKPLALYVFSNN.....EK...VI
 508 ....R.....S.....LDEA....IKF....I.NQR.....EKPLALYVFSNN.....DK...VI
 509 ....K.....N.....VDEA....INF....I.NER.....EKPLALYVFSHN.....HK...LI
 510 ....R.....N.....LDEA....IQF....I.NQR.....EKPLALYVFSKD.....KQ...VI
 511 ....R.....S.....LDEA....VKF....I.NQR.....EKPLALYVFSNN.....DK...VI
 512 ....K.....N.....VDEA....INF....I.NER.....EKPLALYVFSHN.....HK...LI
 513 ....K.....N.....VDEA....INF....I.NER.....EKPLALYVFSHN.....HK...LI
 514 ....E.....D.....MDAA....VDH....I.NKY.....GSHHTECILTSN.....VD...TA
 515 ....D.....S.....IDEA....MEK....I.NTY.....SGGHSSAIMTTD.....KE...AA
 516 ....K.....N.....ADEA....IQF....I.NER.....EKPLAFYVFSHN.....SK...LI
 517 ....K.....N.....ADEA....IQF....I.NER.....EKPLAFYVFSHN.....SK...LI
 518 ....E.....S.....FDEA....VEK....I.NTY.....SGGHSSVIITED.....DN...KA
 519 ....D.....S.....LDSA....ISH....I.TTH.....SSGHTDLILTSS.....SSpnrAA
 520 ....K.....N.....VDEA....IEF....I.NRR.....EKPLALYVFSNN.....KK...LI
 521 ....A.....T.....VEEA....IHH....I.NTY.....GSMHSEAIITEN.....EE...NV
 522 ....D.....D.....VYAA....IDH....I.NLY.....GSAHTDSIVAED.....NE...VA
 523 ....D.....S.....LDGA....IAW....I.NQY.....SSGHADSIATES.....YQ...ES
 524 ....S.....E.....LEEA....IEM....I.NLY.....SGGHSASIMTTN.....NS...NA
 525 ....D.....S.....LDGA....IAW....I.NQY.....SSGHADSIATES.....YQ...ES
 526 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTEN.....EK...TA
 527 ....K.....N.....VDEA....INF....I.NER.....EKPLALYVFSHN.....HK...LI
 528 ....D.....S.....LESA....IAW....I.NEH.....SSGHADSIVTES.....YQ...ES
 529 ....D.....D.....EDEA....IAR....A.NRT.....AYGLAAGVVTGN.....LA...RA
 530 ....D.....S.....TEDA....IAA....I.NKY.....SGGHSASIMTRD.....DE...KA
 531 ....D.....S.....VQEA....IDH....I.HKY.....GSSHTDVIVTE-.....--...--
 532 ....D.....G.....IEDA....ISK....I.NTY.....SGGHSSAILTED.....KA...VA
 533 ....E.....N.....LDEV....IRL....V.NSK.....DKPLAIYYFSED.....KN...KI
 534 ....D.....T.....EDEA....VSK....A.NGV.....RYGLSATVWSRD.....VA...RV
 535 ....D.....S.....IDEV....IDK....I.NSR.....AKPLALYYFSSN.....KE...NQ
 536 ....N.....G.....LSEA....INF....I.NAR.....EKPLALYIFSSD.....KT...VI
 537 ....K.....D.....FAEA....VSL....I.NAH.....EYGNGVACYTSD.....GG...IA
 538 ....P.....D.....FASA....VAL....V.NAH.....EFGNGVACFTRD.....GH...VA
 539 ....V.....S.....LEDA....IVK....I.NKY.....GGGHSAAIITSN.....ED...KA
 540 ....K.....D.....FGEA....VDL....I.NAH.....EFGNGVSCFTSD.....GG...IA
 541 ....E.....S.....EDEV....IAR....A.NDT.....HYGLAAGVVTEN.....LS...RA
 542 ....E.....S.....EDEV....IAR....A.NDT.....HYGLAAGVVTEN.....LS...RA
 543 ....E.....S.....EDEV....IAR....A.NDT.....HYGLAAGVVTEN.....LS...RA
 544 ....E.....S.....EDEV....IAR....A.NDT.....HYGLAAGVVTEN.....LS...RA
 545 ....T.....N.....IEDA....LYQ....I.KLR.....EKPLALYYFGEN.....EK...MQ
 546 ....D.....N.....LSEG....ITW....I.NQY.....SSGHADCLVTDS.....YT...ES
 547 ....D.....N.....AVDA....INF....V.NQG.....EKPLALYVFSNK.....KT...DI
 548 k...S.....Q.....LNEV....ISD....I.NST.....GYGLTFSLQSRI.....QS...QI
 549 ....D.....S.....LEQA....MQL....I.NDH.....EYGNGTCIFTRD.....GE...AA
 550 ....D.....T.....YEEA....IDL....I.NAN.....PYGNGTAIFTND.....GG...AA
 551 k...S.....Q.....LNEV....ISD....I.NST.....GYGLTFSLQSRI.....QS...QI
 552 a...S.....E.....FNQV....IAQ....I.NST.....GFGLTSGIHSRI.....DE...SI
 553 ....D.....S.....LEQA....MQL....I.NDH.....EYGNGTCIFTRD.....GE...AA
 554 ....Q.....K.....IEDG....FQV....I.RSK.....SKPLAAYLFTNN.....KE...LE
 555 ....Q.....K.....IEDG....FQV....I.RSK.....PKPLAAYLFTNN.....KE...LE
 556 ....S.....S.....LEEL....LHQ....I.---.....------------.....--...--
 557 ....D.....S.....LEQA....MQL....I.NDH.....EYGNGTCIFTRD.....GE...AA
 558 ....D.....S.....EEEV....IQR....A.NSV.....KYGLAATVWSCN.....VG...RV
 559 ....D.....D.....EAAL....VAD....A.NDS.....VFGLAAGIWTRD.....YK...RA
 560 ....D.....D.....EAAL....VAD....A.NDS.....VFGLAAGIWTRD.....YK...RA
 561 ....T.....S.....LDEA....LAF....V.RKG.....NDPLAVYLFSAS.....AS...VR
 562 ....D.....D.....EAAL....VAD....A.NDS.....VFGLAAGIWTRD.....YK...RA
 563 ....Prt...A.....LDKL....IDQ....I.NGT.....GYGLTLGVHTRI.....DE...TI
 564 ....D.....S.....EEEV....ITR....A.NSV.....RYGLAATVWSKD.....VG...RI
 565 ....D.....D.....EAAL....VAD....A.NDS.....VFGLAAGIWTRD.....YK...RA
 566 r...S.....G.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 567 ....Q.....N.....LDEA....ISF....V.NSR.....PKPLAAYLFTKA.....KA...VR
 568 ....P.....G.....IEAA....TDW....I.NTH.....SSGHADSIVTDS.....YE...DS
 569 ....Pra...A.....LDTM....IGQ....I.NGT.....NYGLTMGIHTRI.....DE...TI
 570 ....E.....A.....LDEA....VSF....I.QSR.....PKPLALYLFTGS.....KD...IE
 571 r...D.....D.....MESL....IDD....I.NST.....GYGLTFGLHTRL.....DE...TI
 572 ....R.....D.....VEAA....VDL....I.NSR.....DQPLALYLFAGD.....NR...VK
 573 r...S.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 574 r...D.....D.....MESL....IDD....I.NST.....GYGLTFGLHTRL.....DE...TI
 575 r...D.....D.....MESL....IDD....I.NST.....GYGLTFGLHTRL.....DE...TI
 576 ....E.....N.....IDEC....LEF....I.QNR.....PHALTLYLFSRD.....QA...IQ
 577 ....P.....G.....IEAA....TDW....I.NTH.....SSGHADSIVTDS.....YE...DS
 578 ....D.....N.....LEQA....IRL....I.NES.....PYGNGTSIFTSS.....GA...AA
 579 ....D.....S.....LEQA....IRL....I.NES.....PYGNGTSIFTSS.....GA...AA
 580 r...N.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 581 r...S.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 582 ....D.....S.....LEQA....IRL....I.NES.....PYGNGTSIFTSS.....GA...AA
 583 ....S.....S.....EEEV....IRA....A.NDT.....IYGLAAYFYSSD.....YA...RA
 584 ....S.....S.....EEEV....IRA....A.NDT.....IYGLAAYFYSSD.....YA...RA
 585 r...D.....D.....LDRL....VDD....V.NAT.....GYGLTFGLHTRL.....DE...TI
 586 ....E.....D.....LEAG....IAL....I.NSN.....PYGNGTAIFTSS.....GA...NA
 587 ....E.....T.....EEEV....IRR....A.NDT.....DYGLAAGVCTND.....IT...RA
 588 a...D.....R.....FEQI....IDD....I.NST.....GFGLTSGLHSRI.....DA...TI
 589 ....K.....D.....INQA....IEI....A.NQS.....EYGLQSSVFTSD.....ID...RA
 590 ....K.....E.....ISEV....IHF....I.NER.....PKPLALYCYTHS.....QM...NM
 591 ....T.....N.....FKDL....EVT....I.NSF.....DKPLSLYVFSEN.....SS...FT
 592 ....D.....T.....DAEV....VKR....V.NDS.....RYGLAASVWTRD.....LA...RA
 593 ....D.....D.....EASL....IAQ....A.NDS.....VFGLAAGIWTRD.....YK...RA
 594 ....D.....D.....EASL....IAQ....A.NDS.....VFGLAAGIWTRD.....YK...RA
 595 ....E.....T.....EEEV....IRR....A.NDT.....EYGLAAGVCTND.....IS...RA
 596 r...R.....E.....LDSI....IDQ....I.NGS.....GYGLTLGLHTRI.....DE...TI
 597 ....N.....D.....KDEA....IKI....A.NAS.....KYGLQSSVFTRD.....IN...EA
 598 r...S.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 599 ....D.....D.....EASL....IAQ....A.NDS.....VFGLAAGIWTRD.....YK...RA
 600 ....D.....T.....EADG....IAA....A.NNT.....PYGLNAMLFTEN.....LS...RA
 601 r...S.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 602 ....Q.....N.....LKTA....IAW....I.NSH.....SSGHGDCIATDS.....YQ...ES
 603 ....K.....D.....KDEA....IEI....A.NKS.....EYGLQSAVFTEN.....ID...DA
 604 ....K.....N.....VDEA....INF....I.NER.....EKPLALYVFSHN.....HK...LI
 605 ....S.....D.....EAEV....IKH....A.NDT.....IYGLAAYFYSND.....LA...RS
 606 ....R.....D.....IQES....IGI....I.NTK.....PKPLAIYAFTND.....EN...LK
 607 ....R.....S.....FDEA....LAF....I.GQR.....DDSLALYLFSSK.....RA...TE
 608 ....A.....T.....EEEA....IRR....A.NDT.....IYGLGAAVFTRD.....LE...RA
 609 ....Pra...G.....LDAL....VDA....I.NAT.....GYGLTFGLHTRL.....DD...TV
 610 r...N.....Q.....LAEL....IEQ....I.NAS.....GYGLTLGVHTRI.....DE...TI
 611 ....S.....D.....EHDL....IRK....A.NGT.....AFGLGCSILSSD.....IK...RA
 612 y...E.....E.....MNNI....FEK....I.NSS.....GYGLTIGIHSRI.....EE...NI
 613 ....E.....T.....YAEA....IEL....V.NAN.....RYGNGTAIFTGN.....GG...AA
 614 ....Q.....S.....YEDA....LNL....V.MDN.....DYGNGTAIYTAD.....GD...TA
 615 ....K.....D.....FARA....IEI....A.NDT.....EYALTGGVFSRS.....PA...NI
 616 ....D.....K.....IHES....FAL....I.NSM.....TKALAAYLFTKD.....SK...LQ
 617 ....N.....N.....VDEA....IEH....I.PSY.....GSSPPECIVTED.....PK...VA
 618 ....S.....G.....VDEA....IQF....I.NER.....EKPLVVYVFSNK.....NK...LI
 619 r...E.....G.....LDAL....VDQ....I.NAT.....GYGLTFGLHTRL.....DE...TI
 620 e...D.....T.....IDSV....VRE....A.NNS.....VYGLAASIYTRD.....IS...VA
 621 ....R.....T.....LNEA....LAI....M.RTH.....SEPLAVYLFSDN.....RQ...VQ
 622 ....S.....G.....DEEA....LAV....A.NDS.....HLGLQAAVYTSS.....LR...RA
 623 ....N.....S.....IEEA....VDD....I.NSM.....DYGLTGGIFTED.....PK...EI
 624 ....D.....T.....LEDA....VEF....I.NRN.....PNGNGVALFTQD.....GG...AA
 625 ....E.....K.....IEDG....IEF....I.NSK.....PKPLAIYAFTKN.....NT...LQ
 626 ....D.....T.....LEDA....VEF....I.NRN.....PNGNGVALFTQD.....GG...AA
 627 ....K.....Shq...LDEV....IGA....I.NAT.....GYGLTFGLMTRI.....DD...RV
 628 ....K.....D.....ADEA....VAI....A.NKS.....DFGLQSSVFTRD.....FQ...KA
 629 ....K.....D.....AEEA....VAI....A.NKS.....DFGLQSSVFTRD.....FQ...KA
 630 a...E.....D.....LPAV....IAA....I.NAR.....GYGLTFGLHSRI.....DA...RV
 631 ....K.....D.....EAEA....IAI....A.NDS.....PYGLSGSIFTGS.....LH...RG
 632 ....K.....D.....AEEA....VAI....A.NKS.....DFGLQSSVFTRD.....FQ...KA
 633 ....K.....D.....AEEA....VAI....A.NKS.....DFGLQSSVFTRD.....FQ...KA
 634 ....K.....Sne...MDAL....IEN....I.NDS.....GFGLTMGIHTRV.....EK...RA
 635 ....S.....D.....DDEA....VEI....A.NST.....EYGLSGSVHAGD.....TG...RA
 636 ....S.....G.....FDQA....VSV....V.NDS.....PYGLTASIHTRD.....ID...RA
 637 ....D.....S.....DEAA....IQM....A.NDS.....EFGLSAAVFSRD.....VP...RA
 638 ....D.....D.....IEEA....IAI....T.NET.....RFGLTGGIITQS.....LR...NS
 639 a...E.....D.....IDRV....IDD....I.NAR.....GFGLTFGLHTRI.....DG...RV
 640 ....K.....D.....EAEA....IAI....A.NGT.....DYGLVASVWTRD.....GA...RQ
 641 r...A.....D.....MDAM....VER....I.NAW.....GYGLTFGLHTRL.....DE...TV
 642 ....R.....D.....EAEG....VAL....A.NST.....AYGLSGIVYTGS.....AE...RA
 643 ....Ssq...D.....LPAL....LAE....I.NAT.....GYGLTMGVHTRI.....DE...TI
 644 ....K.....S.....IDDA....IND....I.NSM.....DYGLTGGIFTED.....PE...EY
 645 ....T.....D.....ADQA....LEL....A.NDH.....QFGLASVIYTEN.....YR...TA
 646 ....E.....D.....EEDA....VRM....A.NDT.....QFGLASYFYAND.....LS...RV
 647 a...R.....D.....LDRV....IDD....I.NAM.....GYGLTFGLHTRI.....DD...RV
 648 g...D.....Q.....LDQM....IAD....I.NAR.....GFGLTFGLHTRI.....DS...RV
 649 ....T.....D.....IQTV....VQF....I.NDR.....PNPLALYYFGS-.....-K...HA
 650 ....S.....D.....FKDL....IAK....I.KSR.....KKPLALYLFSNN.....KA...NI
 651 ....Ksg...D.....LDRV....ISA....I.NAT.....GYGLTFGLMTRI.....DD...RV
 652 ....D.....T.....EEEA....VRL....A.NDS.....DYGLAAGLWSQD.....ID...RI
 653 ....D.....T.....LEEA....VRK....A.NDT.....EYGLTAGIFSED.....PK...EV
 654 ....K.....Sre...LDAV....IDA....I.NAT.....GYGLTFGLQTRI.....DD...RV
 655 ....T.....D.....LDDA....IGL....I.NRN.....KYGNGAAIFTRS.....GA...AG
 656 ....N.....S.....IQEA....IED....I.NSM.....DYGLTGGIFTED.....PN...EI
 657 ....D.....Q.....MEDV....IEF....I.NRR.....PRPLALYYFDFD.....QA...RA
 658 ....R.....T.....LGQQ....VDY....VtRNH.....DTPLAMYIFSDD.....PK...EV
 659 ....G.....D.....FDEV....IRR....A.NSL.....PFGLASYVFTGS.....SS...RA
 660 ....D.....T.....VDQA....IQL....I.NAN.....PYGNGTAVFTSS.....GA...VA
 661 ....S.....T.....TDEV....IDH....I.NSR.....PAPLVAYWFGPD.....DQ...DF
 662 ....Kaa...Q.....FDDL....LDD....I.ATT.....GYALTLGVQSRI.....DD...TI
 663 ....D.....T.....EDQA....VAM....G.NGV.....PYGLASSVWTRD.....HA...RA
 664 sgelK.....S.....PEAV....IEQ....I.NAL.....GYGLTLGLQTRI.....DS...RA
 665 s...N.....E.....LDQV....IAA....I.NAT.....GYGLTFGLQTRI.....DD...RV
 666 ....G.....S.....DDEA....IAL....A.NDT.....EYGLNSSVWTRD.....VR...RG
 667 r...S.....Q.....LDKL....LEQ....I.RAT.....GYGLTLGIHTRI.....DE...TI
 668 pg..-ta8aaD.....VEAL....VAQ....I.NAL.....GYRLTLGVQTRI.....DS...RA
 669 ....A.....D.....LTEA....IAW....I.NKN.....GCRQSETILTDS.....QS...AA
 670 ....K.....T.....VPEV....LDI....L.RGS.....PYPLGLYIFSND.....ST...EI
 671 ....D.....D.....FDEA....LKE....V.NNS.....RYGLQAGVFTRD.....IY...KA
 672 ....D.....H.....LDTV....LAG....L.DAA.....AKPLALYLWSND.....AA...QV
 673 ....A.....D.....LTEA....IAW....I.NKN.....GCRQSETILTDS.....QS...AA
 674 ....T.....D.....ESEA....VSK....A.NAT.....CYGLAASVFTTD.....LS...RA
 675 ....D.....N.....FDDA....IDV....H.NAV.....PQGLSSAIFTND.....MR...EA
 676 ....D.....N.....FDDA....IEL....H.NAV.....PQGLSSAIFTND.....MR...EA
 677 ....-.....-.....----....---....-.---.....------------.....--...--
 678 ....D.....S.....EEEV....IQR....A.NSV.....KYGLAATVWSCN.....VG...RV
 679 ....D.....H.....LDEV....VEL....V.NAS.....PFGLQAGVFTQD.....IR...VM
 680 ....D.....N.....FDDA....IDV....H.NAV.....PQGLSSAIFTND.....MR...EA
 681 ....D.....N.....FDDA....IDV....H.NAV.....PQGLSSAIFTND.....MR...EA
 682 ....K.....D.....NQDA....MRI....A.NDS.....RFGLGGGIFSKD.....EA...AA
 683 ....K.....D.....LKEA....IDI....V.NST.....GYGLTAGFESLD.....ER...EW
 684 ....K.....D.....LKEA....IDI....V.NST.....GYGLTAGFESLD.....ER...EW
 685 ....K.....D.....LKEA....IDI....V.NST.....GYGLTAGFESLD.....ER...EW
 686 ....E.....D.....VFAA....IDH....I.NQH.....GSAHTECIVTED.....SE...VA
 687 ....-.....-.....----....---....-.---.....------------.....--...--
 688 ....D.....D.....VYAA....IDH....I.HDH.....GSSHTDCIVTED.....SK...VA
 689 ....Q.....N.....LEEA....IDI....V.NST.....GYGLTAGLESLD.....ER...EW
 690 ....K.....D.....LKEA....IDI....V.NST.....GYGLTAGFESLD.....ER...EW
 691 ....K.....D.....IDAA....IKE....A.NNT.....RYGLSAGVLCDD.....EQ...TY
 692 ....D.....S.....FEQA....ISW....I.NKY.....SSHHSEAIITNN.....IS...RA
 693 ....S.....S.....IEEA....IHH....I.NTY.....GSMHSEAIISEN.....EE...NV
 694 ....K.....D.....EDDA....VHI....A.NDS.....PFGLGGSVFTAN.....PI...HG
 695 ....D.....D.....LDAA....LAH....I.VEY.....GSQHTEAIVTSN.....HP...RA
 696 ....D.....D.....VFAA....IDH....I.HEY.....GSSHTDCIVTED.....SK...VA
 697 ....D.....T.....LEDA....IAI....Q.NQV.....EYGLTAGLHSLS.....TE...EV
 698 ....E.....D.....VYGA....IDH....I.HRH.....GSAHTDCIVTED.....PE...VA
 699 ....C.....G.....DAEA....IRL....M.NDS.....KYGLTASVWTSD.....LD...CG
 700 ....S.....T.....TDEV....IDH....I.NSR.....PAPLVAYWFGPD.....DQ...DF
 701 ....P.....D.....LATA....IAY....Q.NGT.....AFGLTAGLHSLD.....PA...EI
 702 ....D.....S.....VQEA....VEH....I.HKY.....GSSHTDVIITEN.....EK...TA
 703 ....D.....N.....LDEA....IEH....I.NTY.....SSRHSESIVTHD.....YF...NA
 704 ....-.....-.....----....---....-.---.....------------.....--...--
 705 ....E.....N.....VEAI....MNR....C.REIllne.GAGHTFSMHVND.....EE...LV
 706 ....E.....D.....VFAA....IEH....I.NQH.....GSAHTDCVVAED.....HK...VA
 707 ....E.....N.....WEAAcalsIEI....L.KGE.....GAGHTMGIHTEN.....KE...VI
 708 ....S.....D.....LDDA....IAH....I.REH.....GTQHSDAILTRD.....MR...NA
 709 ....D.....S.....KEKA....ISA....A.VSQlefg.GAGHSAVVFTED.....EG...VA
 710 ....N.....D.....VEEG....IKL....C.TEIlmne.GKGHTLVLHSED.....NE...VI
 711 ....E.....D.....LTAA....VNW....I.HQY.....GSAAS-GIIASS.....YE...DC
 712 ....-.....-.....----....---....-.---.....------------.....--...--
 713 ....D.....S.....LAQA....LFF....I.ESF.....GSKQSDCIVATD.....LE...VC
 714 ....-.....-.....----....---....-.---.....------------.....--...--
 715 ....D.....G.....KDAA....IDL....C.EKLlqgg.GAGHTAGIHSSN.....EA...TC
 716 ....N.....S.....TEHG....LELseamV.NFY.....GLGHSAAIHTQN.....VE...LA
 717 ....K.....D.....RAEG....VEI....V.EALld6gaGHNAGIQIGSQA.....DP...FV
 718 ....E.....S.....EAEA....LSV....A.RRVlale.GRGHTAIVHTQD.....AE...RI
 719 ....P.....D.....AARG....IRA....A.RAVvrig.GAGHSAAIHSEN.....AS...VI
 720 ....P.....D.....AARG....IRA....A.RAVvrig.GAGHSAAIHSEN.....AS...VI
 721 ....H.....N.....NDEA....ITW....I.NDH.....TXHHSETIISED.....LN...HV
 722 ....K.....D.....WHEA....CELsie.L.LQN.....GIGHTMSIHTQN.....DD...IV
 723 ....D.....D.....LDQA....IAL....F.NRY.....SPQFTVSLISED.....PA...VQ
 724 ....A.....D.....AQRG....IRA....A.RAVvria.GAGHSAAIHSED.....AT...VI
 725 ....D.....S.....TAHS....IEL....A.GASvrq..HGALSLSAYTTD.....EA...VA
 726 ....D.....S.....TAHS....IEL....A.GASvrq..HGALSLSAYTTD.....EA...VA
 727 ....D.....S.....TAHS....IEL....A.GASvrq..HGALSLSAYTTD.....EA...VA
 728 ....-.....-.....----....---....-.---.....------------.....--...--
 729 ....K.....T.....LEEV....IER....A.NNT.....TYGLAAAIITND.....IN...KA
 730 ....-.....-.....----....---....-.---.....------------.....--...--
 731 ....-.....-.....----....---....-.---.....------------.....--...--
 732 ....L.....V.....HDKY....IPI....I.NKN.....ETVATDEIQFGD.....NE...KL
 733 ....D.....D.....VQSA....IDH....I.NRY.....GSAHTDCIITTD.....KK...SA
 734 ....D.....G.....IEEA....IDH....I.AKH.....STHHSEAIVTED.....QA...AA
 735 ....-.....-.....----....---....-.---.....--------VTED.....SE...VA
 736 ....-.....-.....----....---....-.---.....------------.....--...--
 737 ....-.....-.....----....---....-.---.....------------.....--...--
 738 ....-.....-.....----....---....-.---.....------------.....--...--
 739 ....-.....-.....----....---....-.---.....------------.....--...--
 740 ....-.....-.....----....---....-.---.....------------.....--...--
 741 ....-.....-.....----....---....-.---.....------------.....--...--
 742 ....-.....-.....----....---....-.---.....------------.....--...--
 743 ....-.....-.....----....---....-.---.....------------.....--...--
 744 ....-.....-.....----....---....-.---.....------------.....--...--
 745 ....-.....-.....----....---....-.---.....------------.....--...--
 746 ....-.....-.....----....---....-.---.....------------.....--...--
 747 ....-.....-.....----....---....-.---.....------------.....--...--


      40        350                  360               370       380   
      |          |                    |                 |         |   
   1 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
   2 RRFT.EEVDAAAVYVN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
   3 RRFL.TEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
   4 REFL.ARVDAAAVYVN.....AS...TR...FTD..GYEFG..FGAE....IGISTQKLHARGPM
   5 RRFL.AEVDSASVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
   6 RRFL.AEVDSASVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
   7 RQFL.ARVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKFHARGPV
   8 RRFL.REVDSASVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
   9 RQFL.ARVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKFHARGPV
  10 RRFL.TEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  11 HRFL.QEIDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....IGISTQKLHARGPM
  12 RRFL.AEVDSASVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  13 RRFL.AEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  14 QRFI.REVNSSTVLVN.....AS...TR...FAD..GNQLG..LGAE....IGISTTKLHSFGPM
  15 QRFI.REVNSSCVVVN.....AS...TR...FAD..GNQLG..LGAE....IGISTTKLHSFGPM
  16 RRFL.NEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  17 REFT.RCVDAAAVYVN.....AS...TR...FTD..GFQFG..MGAE....IGISTQKLHARGPM
  18 RRFL.NEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  19 EKFL.QRVDAAAVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
  20 QRFL.NEVDAAAVYVN.....AS...TR...FTD..GSQFG..FGAE....IGISTQKLHARGPM
  21 NRFI.RQVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  22 RRFL.REVDSASVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  23 QRFL.NEVNSSTVLVN.....AS...TR...FSD..GFQLG..LGAE....IGISTTKLHAYGPM
  24 ARFV.NEVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  25 MMFL.KSVDSAAVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKMHARGPM
  26 ARFV.NEVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  27 QKFL.QRVDAAAVYVN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHARGPM
  28 ARFV.NEVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  29 RKFL.TEVDSSSVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  30 RRFL.TEVDSSSVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  31 QRFL.REINSSVVMVN.....AS...SR...FSD..GNQFG..LGAE....IGISTTKLHSFGPM
  32 RQFM.AEVDSASVMLN.....TP...TC...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  33 RIFM.TEVDSSSVMVN.....AS...TA...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  34 RKFL.AEVDSSSVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  35 AAFM.SLVDSGNVFWN.....CS...TR...FSD..GFRYG..FGAE....VGISTSKIHARGPV
  36 ARFM.DYVDSGNVFWN.....CS...TR...FSD..GFRYG..FGAE....VGISTSKVHARGPV
  37 MRFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  38 RQFM.AEVDSASVMLN.....TP...TC...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  39 QQFL.QQVDAAAVYAN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
  40 RQFL.REVDSSSVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  41 RRFM.AEVDSASVMLN.....TP...TC...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  42 RRFL.AEVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  43 MRFL.KSVDSAAVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKMHARGPM
  44 RRFM.AEVDSSSVMVN.....AP...TS...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  45 RQFV.AQVDSASVMIN.....TP...TC...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  46 RRFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  47 QRFL.KEVDAAAVYVN.....AS...TR...FTD..GEQFG..FGGE....IGISTQKLHARGPM
  48 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  49 RRFM.AEVDSSSVMVN.....AP...TC...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  50 DYFV.RQVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHSRGPM
  51 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  52 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  53 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  54 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  55 RRFV.SLVDSAAVMVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
  56 RRFL.REVDSASVMIN.....AS...TA...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  57 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  58 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  59 QKFL.DFVDAAACYVN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
  60 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  61 ARFV.NEVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  62 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  63 QRFQ.REVDSSSVYVN.....LP...TC...FAD..GFEYG..LGAE....IGISTNRLHARGPV
  64 QRFL.NEVDAAAVYVN.....AS...TR...FTD..GSVFG..FGAE....IGISTQKLHARGPM
  65 QKFT.RSVNSSVTMVN.....AS...SR...FSD..GNQLG..LGAE....IGISTTKLHSFGPM
  66 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  67 RRFI.SAVDAAAVYAN.....AS...TR...FTD..GNVFG..FGAE....MGISTQKLHARGPM
  68 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  69 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  70 RRFM.AEVDSSSVMVN.....AP...TS...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  71 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  72 QRFQ.REVDSSSVYVN.....LP...TC...FAD..GFEYG..LGAE....IGISTNRLHARGPV
  73 KKFV.SEIDAAAVYVN.....AS...TR...FTD..GGQFG..FGAE....IGISTQRFHARGPV
  74 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  75 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  76 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  77 RRFL.REVDSSSVIVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  78 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
  79 EHFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
  80 RRFL.REVDSASVVVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  81 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
  82 QRFQ.REVDSSSVYVN.....LP...TC...FAD..GFEYG..LGAE....IGISTNRLHARGPV
  83 RRFV.SLVDSAAVMVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
  84 RRFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  85 KKFV.SEIDAAAVYVN.....AS...TR...FTD..GGQFG..FGAE....IGISTQRFHARGPV
  86 QRFL.REVDSASVIVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
  87 QRFI.REVDSASVMIN.....AS...SR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  88 RRFL.REVDSASVVVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
  89 QRFI.REVNSSTVLVN.....AS...TR...FAD..GNQLG..LGAE....IGISTTKLHSFGPM
  90 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
  91 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
  92 MKFL.REVDSAAVYVN.....AS...TR...FTD..GNEFG..LGAE....MGISTDKIHARGPM
  93 MKFL.REVDSAAVYVN.....AS...TR...FTD..GNEFG..LGAE....MGISTDKIHARGPM
  94 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
  95 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
  96 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISTDKFHARGPV
  97 MRFV.REVDASAVMVN.....AS...SR...FND..GFQFG..LGAE....MGISTDKLHVRGPV
  98 WRFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTAKLHARGPV
  99 QRFL.REVDSSSVMVN.....AS...TR...FAD..GQEYG..LGAE....IGISTDKLHARGPV
 100 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
 101 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 102 RRFL.REVDSSSVMVN.....TS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 103 ETFQ.DLVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKIHARGPM
 104 LQFT.GEVDAAAVYVN.....AS...TR...FTD..GYEFG..MGAE....IGISTDKLHARGPM
 105 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 106 MRFI.REVDSASVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISNDKLHARGPV
 107 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 108 QRFL.NEVDAAAVMVN.....AS...TR...FTD..GSQFG..LGAE....LGISTQKMHARGPM
 109 RAFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 110 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 111 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 112 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 113 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 114 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 115 AEFL.RQVDAAAVYHN.....AS...TR...FTD..GFEYG..FGAE....IGISTQKLHARGPM
 116 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 117 QKFL.DEIDAACVYVN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 118 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 119 AHFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 120 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 121 RDFL.RQVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 122 EHFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 123 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 124 MRFL.REVDSASVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISNDKLHARGPV
 125 AHFM.NQVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 126 THFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 127 QRFI.REVDSASVMIN.....AS...SR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 128 EIFQ.DMVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 129 RQFL.REVDSSSVMVN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKLHARGPV
 130 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 131 EHFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 132 MRFL.REVDSASVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISNDKLHARGPV
 133 EHFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 134 EQFQ.DDVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
 135 THFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 136 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 137 QRFL.NEVDAAAVMVN.....AS...TR...FTD..GSQFG..LGAE....LGISTQKMHARGPM
 138 EHFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 139 EIFQ.DMVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 140 EQFQ.DDVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
 141 EQFQ.DDVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKMHARGPM
 142 THFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 143 KRFI.REVDSAVTMAN.....AS...SR...FSD..GGQLG..LGAE....IGISTSKLHAYGPM
 144 QRFL.NEVDAAAVMVN.....AS...TR...FTD..GSQFG..LGAE....LGISTQKMHARGPM
 145 QAFH.QKVDAAAVYIN.....AS...TR...FTD..GFAMG..FGAE....IGISTQKLHARGPM
 146 DRFV.REVDSSVVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 147 ERFV.REVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 148 QQFV.AQVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 149 ANFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 150 MRFL.REVDSASVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 151 QAFH.QKVDAAAVYIN.....AS...TR...FTD..GFAMG..FGAE....IGISTQKLHARGPM
 152 QAFH.QKVDAAAVYIN.....AS...TR...FTD..GFAMG..FGAE....IGISTQKLHARGPM
 153 QRFI.REVDSASVMIN.....AS...SR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 154 EYFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 155 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 156 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 157 MRFL.REVDSASVMIN.....AS...TR...FAD..GFEYG..LGAE....IGISNDKLHARGPV
 158 QRFI.REVDSASVMIN.....AS...SR...FAD..GFEYG..LGAE....IGISTDKIHARGPV
 159 REFA.SRIDSSAVMVN.....AS...TR...FND..GGEFG..LGAE....IGISTDKFHARGPC
 160 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHVRGPM
 161 EQFT.ALVDSSAVMVN.....AS...TR...FND..GGMFG..LGAE....IGISTDKFHARGPC
 162 ELFF.AEVDSAIVMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 163 EAFL.REVDSAIIIHN.....AS...TQ...FAD..GGEFG..MGAE....IGISTGRIHARGPV
 164 RRFT.QLVDSTTVAVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 165 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHVRGPM
 166 EYFV.RAVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 167 KRFI.REVDSAVTMAN.....VS...SR...FSD..GGQLG..LGAE....IGISTSKLHAYGPM
 168 ARFF.ERLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 169 QQFL.QQVDAAVVYVN.....AS...TR...FTD..GYEFG..FGAE....IGISTQKLHARGPM
 170 SKFF.VSVDAAALYHN.....AS...TR...FTD..GYEFG..FGAE....IGISTQKLHVRGPM
 171 AKFF.ERLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 172 QRFI.REVDASSVMVN.....AS...TR...FSD..GGQYG..LGAE....IGISTTKLHAYGPM
 173 QRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISTDKFHARGPV
 174 QKFQ.DEIDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 175 KLFQ.QRVNAACVYIN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 176 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 177 QQFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISTDKFHARGPV
 178 HRFV.AEVDASAVVVN.....AS...TR...FND..GGELG..LGAE....IGISTTKLHAYGPM
 179 MRFL.REVDSASVMVN.....AS...TR...FAD..GFEFG..LGAE....IGISNDKLHARGPV
 180 EIFQ.DMVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 181 NQFV.AQVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 182 ERFF.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 183 THFM.NEVNSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 184 RQFI.NQVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 185 RQFI.NQVDAAAVYVN.....AS...TR...FTD..GGEFG..LGAE....VAVSTQKLHARGPM
 186 EEFT.ARIDSAVVMVN.....AS...TR...FTD..GGVFG..FGAE....LGISTQKMHARGPM
 187 RRFT.AAIDAAAVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPV
 188 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 189 NQFL.RQVDAAAVYVN.....AS...TR...FTD..GSEFG..LGGE....MGISTQKIHARGPM
 190 ERFL.AEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGGE....IGIATGRMHARGPV
 191 RRFV.RSVDASVVLVN.....AS...SR...FSD..GGELG..LGAE....IGISTTKLHAYGPM
 192 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHVRGPM
 193 QRFL.NEVDAAAVYVN.....AS...TR...FTD..GGRFG..FGAE....IGISTQKLHARGPM
 194 AQFF.SELDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 195 KAFL.NTVDAAALYHN.....AS...TR...FTD..GGALG..FGAE....IGISTQKLHARGPM
 196 ERFQ.DEVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 197 ETFL.NGCDSAIVLWN.....AS...TQ...FAD..GGEFG..MGAE....IGISTGKMHARGPV
 198 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 199 RQFI.NQVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 200 SKFF.TSVDAAALYHN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHVRGPM
 201 RYFQ.QAINSACVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 202 ARFF.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 203 EAFL.NGCDSAIVLWN.....AS...TQ...FAD..GGEFG..MGAE....IGISTGKMHARGPV
 204 GRFF.QRLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 205 RQFI.NQVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 206 ARFF.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 207 ARFF.QRLDSAILIHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 208 DQFV.AQVNSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 209 RRFI.TTCDSAAVMVN.....AS...TR...FTD..GERFG..MGAE....IGISTQKLHARGPM
 210 ARFF.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 211 ERFF.RRLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 212 RYFL.TSVDAAAVYHN.....AS...TR...FTD..GFEFG..YGAE....IGISTQKLHARGPM
 213 ARFF.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 214 RRFT.TEIDAAAVMVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 215 ERFF.SGLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 216 MRFL.REVDASLVLVN.....AS...PR...FND..GFQLG..LGAE....IGISTSKLHAYGPM
 217 ERFF.RRLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 218 QRF-.---------VN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 219 TKFM.TRLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 220 QRFT.DGVDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 221 RQFV.AQVDAAAVYIN.....AS...TR...FTD..GGEFG..LGAE....VAVSTQKLHARGPM
 222 MRFL.READASMVAVN.....AS...SR...FND..GGQLG..LGAE....IGISTSKLHSYGPM
 223 ELFI.NSAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 224 ERFL.TEVDSAIVMHN.....AS...TQ...FAD..GGEFG..MGAE....IGISTGRLHARGPV
 225 RYFQ.QAINSACVYVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 226 TKFM.TRLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 227 ERFF.SEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGGE....IGIATGKMHARGPV
 228 QRFL.NEVDAAAVYVN.....AS...TR...FTD..GGRFG..FGAE....IGISTQKLHARGPM
 229 ELFI.NSAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 230 ETFF.GLVNSANIFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQQMPPRGPV
 231 ETFF.GLVNSAGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQQMPPRGPV
 232 EYFL.QHVDSACVFWN.....TS...TR...FSD..GYRFG..LGAE....VGISTARIHARGPV
 233 EQFF.AELDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 234 ELFI.NSVGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 235 RRFT.QLVDSTTVAVN.....TS...TR...FTD..GGQFG..FGAE....IGISTQKLHARGPM
 236 QAFH.QKVDAAAVYIN.....AS...TR...FTD..GFAMG..FGAE....IGISTQKLHARGPM
 237 ETFF.GLVNSAGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQQMPPRGPV
 238 EQFC.QRVDSAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQKMPPRGPV
 239 QQFL.REVDSASVMVN.....TS...TR...FAD..GFEYG..LGAE....IGISTDKFHARGPV
 240 QAFH.QKVDAAAVYIN.....AS...TR...FTD..GFAMG..FGAE....IGISTQKLHARGPM
 241 AYFQ.TAVDAAAVYHN.....AS...TR...FTD..GFEFG..YGAE....IGISTQKLHARGPM
 242 ERFV.NAAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 243 QRFL.NEIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 244 ERFL.NEIDSAVVMHN.....AS...TQ...FSD..GGEFG..MGAE....IGIATGKMHARGPV
 245 EKFL.ASVDSAIVMWN.....AS...TQ...FAD..GGEFG..LGAE....IGIATGRIHARGPV
 246 HRFL.QEVQSSLVLVN.....AS...TR...FND..GFQLG..LGAE....IGISTSRLHAFGPM
 247 KTFF.GLVNSAGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQQMPPRGPV
 248 EIFL.AQIGSAGVFHN.....CS...TR...FSD..GFRYG..FGAE....VGISTQKMPPRGPV
 249 ALFQ.RLVDASVVMIN.....AS...SR...FSD..GGELG..LGAE....IGIATTKLHAYGPM
 250 DTFV.QQLPSAVVMVN.....AS...SR...FSD..GGALG..LGAE....IGISTTRLHAYGPM
 251 EIFM.NQVDAAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQKMPPRGPV
 252 SDFM.NQVDSAAVYVN.....AS...TR...FTD..GSQFG..LGAE....VAVSTQKLHARGPM
 253 EYFL.QHVDSACVFWN.....TS...TR...FSD..GYRFG..LGAE....VGISTARIHARGPV
 254 RRFV.AQVDSAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 255 RRFF.QAVDAAVLYHN.....AS...TR...FTD..GEQFG..YGAE....IGISTQKLHARGPM
 256 DTFV.QQLHSAVVMVN.....AS...SR...FSD..GGALG..LGAE....IGISTTRLHAYGPM
 257 ARFQ.RAVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATSKLHAYGPM
 258 REFT.SRVDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 259 KQFI.ALVDSSSVMVN.....AS...TR...FAD..GFRYG..KGAE....VGISTNKIHARGPV
 260 AKFL.GEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 261 RKFL.TNVDATTVYHN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 262 KKFL.SEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGRFHARGPV
 263 DTFV.QQLHSAVVMVN.....AS...SR...FSD..GGALG..LGAE....IGISTTRLHAYGPM
 264 ELFV.NTAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 265 ERFV.NAAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 266 ELFV.NTAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 267 ELFV.NTAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 268 TRFQ.RTVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATSKLHAYGPM
 269 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..SGAE....IGISTQKLHVRGPM
 270 ARFL.DEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 271 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..SGAE....IGISTQKLHVRGPM
 272 QRFT.EQIDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 273 ARFF.NELDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 274 ARFF.NELDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 275 DRFF.QRLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 276 DRFL.RSVDAAAVYHN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 277 QQFI.RTLNSAVVMAN.....AS...SR...FSD..GGELG..LGAE....IGISTSKLHAYGPM
 278 ERFV.NAAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 279 MRFQ.RTVDASVVMVN.....AS...SR...FSD..GGELG..LGAE....IGIATSKLHAYGPM
 280 NKFM.SEIDSSGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 281 DYFF.ERLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 282 AQFF.SQVDSAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQKLPPRGPV
 283 MRFV.REVDASMVAVN.....AS...SR...FND..GGQLG..LGAE....IGISTSKLHSYGPM
 284 RRFL.RAADSAAVYWN.....AS...TR...FTD..GAEFG..FGAE....MGISTQKLHCRGPF
 285 ARFL.NEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 286 ELFI.NSVGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 287 ARFL.NEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 288 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 289 KRFQ.RTVDASVVMVN.....AS...SR...FSD..GGELG..LGAE....IGIATTKLHAYGPM
 290 THFM.NEVNSAAVYLN.....AS...TR...FTD..GGQFG..FGAE....VAVSTQKLHARGPM
 291 QRFA.DGVDSATVMVN.....AS...TA...FTD..GGQFG..FGAE....IGISTQKLHARGPM
 292 ERFL.NAVDSAIVMWN.....AS...TQ...FAD..GGEFG..LGAE....IGISTGRLHARGPV
 293 ARFI.NEVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 294 EQFQ.LQVDAAAVYHN.....AS...TR...FTD..GFEFG..YGAE....IGISTQKLHARGPM
 295 KIFF.NCLDSAILLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKMHARGPV
 296 ERFL.EEVDASSVYVN.....AS...TR...FTD..GGEFG..FGAE....VGISTSKLHARGPM
 297 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 298 QRFF.TEVDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 299 ARFF.ARLDSAILMRN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 300 ERFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 301 ERFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 302 ERFV.NAAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 303 ELFI.NSVGSAAVYVN.....AA...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 304 ERFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 305 ERFV.QALRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 306 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 307 DTFV.QQLYSAVVMVN.....AS...SR...FSD..GGALG..LGAE....IGISTTRLHAYGPM
 308 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 309 ETFF.AGIDSAILLHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 310 KEFI.GLVDSSSVMVN.....AS...TR...FAD..GYRYG..KGAE....VGISTNKIHSRGPV
 311 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 312 RRFL.DEVDAAGVFHN.....AS...TR...FAD..GFRYG..FGAE....VGISTQKLPPRGPV
 313 ETFV.TAIDAAAVGVN.....VS...TR...FTD..GGELG..FGAE....VGISTQKLHARGPM
 314 AKFL.GEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 315 DTFV.QQLYSAVVMVN.....AS...SR...FSD..GGALG..LGAE....IGISTTRLHAYGPM
 316 VYFQ.TAVDRAAVYHN.....AS...TR...FTD..GFEFG..YGAE....IGISTQKLHARGPM
 317 NKFL.HSVDSSGVFLN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 318 RRFA.AEVDAAAVLIN.....AS...TR...FVD..GGEFG..FGAE....IGISTQKLHARGPM
 319 QRFT.ERVDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 320 ERFL.QAVDSAGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 321 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 322 ARFL.QEVDAAGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTHKLPPRGPV
 323 KEFI.GLVDSSSVMVN.....AS...TR...FAD..GYRYG..KGAE....VGISTNKIHSRGPV
 324 DRFL.AEVDSAVVMVN.....AS...TR...FTD..GAEFG..FGAE....VGISTQKLHARGPM
 325 RRFV.ASCDSAAVMVN.....AS...TR...FTD..GERFG..MGAE....IGISTQKLHARGPM
 326 ERFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 327 QKFQ.DEIDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 328 ETFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 329 ARFQ.RAVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 330 WRFL.EEVDASLVLWN.....AS...TR...FND..GFELG..LGAE....IGISTSKLHAYGPM
 331 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 332 ERFI.NSVGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 333 ERFI.NSVGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 334 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 335 QRFS.ERVDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 336 EKFL.NSIDAAAVYLN.....AS...TR...FTD..GGSFG..FGAE....VGISTNKLHARGPM
 337 ARFQ.RAVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 338 EIFF.NRLDSAILLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKMHARGPI
 339 KKFM.NVVDSAGVFHN.....CS...TR...FAD..GFRYG..FGAE....IGISTQTLPPRGPV
 340 EQFL.QQLDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 341 ARFL.NEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 342 EKFL.SSVDSAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 343 DKFL.NEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 344 EAFI.AEVDSAIVLVN.....AS...TQ...FAD..GGEFG..FGAE....IGIATDKLHARGPV
 345 AKFL.GEVDSAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 346 DTFF.ATVDAACVYHN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 347 ERFL.TGVDSAIVMHN.....AS...TQ...FAD..GGEFG..LGAE....IGIATGRLHARGPV
 348 WRFL.EEVDASLVLWN.....AS...TR...FND..GFELG..LGAE....IGISTSKLHAYGPM
 349 ETFV.QSLRSAVVMVN.....AS...SR...FSD..GGELG..LGAE....IGISTTRLHSYGPM
 350 ETFL.RQVDSAAVLYN.....AS...TR...FSD..GARFG..LGAE....VGISTGRIHARGPV
 351 QRFL.DEVDAAGVFHN.....AS...TR...FAD..GFRYG..LGAE....VGISTQKLPPRGPV
 352 EEFT.KRIDSAVVMVN.....AS...TR...FTD..GGVFG..FGAE....LGISTQKMHARGPM
 353 ETFL.RQVDSAAVLYN.....AS...TR...FSD..GARFG..LGAE....VGISTGRIHARGPV
 354 EEFT.KRIDSAVVMVN.....AS...TR...FTD..GGVFG..FGAE....LGISTQKMHARGPM
 355 QRFT.ERVDAAAVMVN.....AS...TA...FTD..GEQFG..FGAE....IGISTQKLHARGPM
 356 AHFQ.RAVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 357 ERFL.RAVDSAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 358 EKFL.RQVDSACVFWN.....AS...SR...FAD..GYRFG..LGAE....VGISTARIHARGPV
 359 ETFL.QLVDSAAVLHN.....AS...TR...FCD..GFRFG..LGAE....VGISTSRIHARGPV
 360 EEFT.KRIDSAVVMVN.....AS...TR...FTD..GGVFG..FGAE....LGISTQKMHARGPM
 361 SKFL.NEVDAAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 362 AKFQ.RSIDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 363 SKFL.NEVDAAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 364 EKFF.NHLDSAILLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKMHARGPI
 365 EIFL.RQVDSAAVIHN.....AS...TR...FCD..GFRFG..LGAE....VGISTSRIHARGPV
 366 NVFL.RQVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTSRIHARGPV
 367 DYFT.THIDSAAVYIN.....AS...TR...FTD..GGEFG..LGCE....MGISTQKLHARGPM
 368 EVFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTGRIHARGPV
 369 ETFL.RRVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTGRIHARGPV
 370 ETFL.RRVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTGRIHARGPV
 371 AKFQ.RSIDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 372 DRFL.SSIDSAGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 373 ETFL.QQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTGRIHARGPV
 374 EYFT.LYVDSAAVYVN.....AS...TR...FTD..GGEFG..LGCE....LGISTQKMHARGPM
 375 ELFQ.RSVDASVVTVN.....AS...SR...FSD..GSQLG..LGAE....IGIATSKLHAYGPM
 376 ARFL.NEVDAAIVLHN.....AS...TQ...FAD..GGEFG..FGAE....IGIATGKFHARGPV
 377 AEFL.NGTDSAVVMWN.....AS...TQ...FCD..GGEFG..FGAE....IGIATGRMHARGPV
 378 RRFM.TAIDSAIVMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 379 ERFI.SEIDSAAVIVN.....AS...TR...FTD..GGELG..LGAE....VGISTQKLHARGPM
 380 KAFT.ALVDSSSVMVN.....AS...TR...FAD..GYRYG..KGAE....VGISTNKIHSRGPV
 381 NKFM.NVVDSSGVFHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTFPPRGPV
 382 EKFI.NTAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 383 ERFL.GAVDSAGVYLN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 384 TYFQ.SNVDSACVFHN.....AS...SR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 385 RRFL.RTVDSSGVYHN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 386 ERFL.NEVDSAVVMVN.....AS...TR...FTD..GGEFG..FGAE....VGISTQKLHARGPM
 387 DRFL.AAVDSAGVYHN.....CS...SR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 388 GRFL.SAVDSAGVYLN.....CS...TR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 389 RRFT.AAVDSAAVLVN.....AS...TR...FTD..GGEFG..FGAE....IGISTQKLHARGPM
 390 ETFL.RRVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTGRIHARGPV
 391 ERFT.REVDATAVFVN.....AS...TR...FND..GGQFG..LGAE....VAISTNRLHARGPM
 392 TYFQ.REVDSACVFHN.....AS...TR...FSD..GYRFG..LGAE....VGISTARIHARGPV
 393 RYFQ.NHVDSACVFHN.....AS...SR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 394 KRFQ.RSVDASVVMVN.....AS...SR...FSD..GSELG..LGAE....IGIATTKLHAYGPM
 395 EIFL.RQVDSSSVLHN.....AS...TR...FSD..GARFG..LGAE....VGISTSRIHARGPV
 396 HQFV.SLVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 397 DRFL.AEVDSAIVMHN.....AS...SQ...FAD..GGEFG..LGAE....IGIATGRLHARGPV
 398 KQFL.GSVDSACVFHN.....AS...SR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 399 TKFV.NAVNSAAVYVN.....AS...TR...FTD..GSQFG..LGAE....VAVSTQKLHARGPM
 400 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGVSTGRIHARGPV
 401 ELFV.NTAGSAAVYVN.....AS...TR...FTD..GAQFG..LGAE....VAVSTQKLHARGPM
 402 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGVSTGRIHARGPV
 403 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGVSTGRIHARGPV
 404 QKFI.RQINSSVVMVN.....AS...SR...FSD..GNQLG..LGSE....IGISTSKLHAYGPM
 405 AHFF.AQLDSAILMHN.....AS...TQ...FAD..GGEFG..MGAE....IGIATGKMHARGPV
 406 RRFQ.REVDASAVMVN.....AS...TR...FND..GGELG..LGAE....IGISTTKLHAFGPM
 407 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTGRIHARGPV
 408 QTFM.REVDAACVYVN.....AS...TR...FSD..GGEFG..FGAE....VGISTSKLHARGPM
 409 EQFF.ARVDSAIVMHN.....AS...SQ...FAD..GGEFG..LGAE....IGIATGRLHARGPV
 410 RIFT.NSLDSAALFIN.....CS...TR...FHD..GGEFG..LGAE....VGISTGKLHVRGPM
 411 EFFA.SSVDAAAVLVN.....CS...SR...FVD..GGEFG..FGAE....IGISTQKLHARGPM
 412 RIFT.NSLDSAALFIN.....CS...TR...FHD..GGEFG..LGAE....VGISTGKLHVRGPM
 413 HQFV.SLVDAAAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 414 DYFT.THIDSAAVYVN.....AS...TR...FTD..GGEFG..LGCE....MGISTQKLHARGPM
 415 NVFL.RQVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTSRIHARGPV
 416 AYFT.DQVDSAAVYVN.....AS...TR...FTD..GGQFG..LGCE....MGISTQKLHARGPM
 417 TDFM.NTVDAAVVYQN.....VS...SR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 418 RQFL.GSVDSACVFHN.....AS...SR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 419 AKFQ.RLINSSCIYAN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 420 ETFL.SQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTSRIHARGPV
 421 DYFC.AAVDSAVVAVN.....AS...TR...FTD..GGEFG..LGAE....VGISTQKLHARGPM
 422 AKFQ.RLINSSCIYAN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 423 AKFQ.RLINSSCIYAN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 424 AKFQ.RLINSSCIYAN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 425 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGVSTGRIYARGPV
 426 ERFL.SLVDSACVYAN.....AS...TR...FSD..GGEFG..FGAE....IGISTNKLHARGPV
 427 GKFL.KGIDSAGVYWN.....AS...TR...FAD..GFRYG..FGTE....VGVSTNKIHARGPV
 428 AYFT.DQVDSAAVYVN.....AS...TR...FTD..GGQFG..LGCE....MGISTQKLHARGPM
 429 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTSRIHARGPV
 430 RNFQ.RRVDSACVFHN.....AS...SR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 431 STFM.RRLDSASVFHN.....AS...TR...FSD..GYRFG..LGAE....VGISTGKIHARGPV
 432 DYFT.THIDSAAVYVN.....AS...TR...FTD..GGEFG..LGCE....MGISTQKLHARGPM
 433 AKFQ.RLINSSCIYAN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 434 ETFM.KAIDSAGVYWN.....CS...TR...FAD..GFRYG..FGTE....VGISTNKIHARGPV
 435 EIFQ.DMVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQX-------
 436 DRFL.AAVDSAGVYHN.....CS...SR...FAD..GFRYG..FGAE....VGISTQTLPPRGPV
 437 AKFQ.RLINSSCIYGN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 438 EKFL.KSIDSAGIYWN.....AS...TR...FAD..GFRYG..FGTE....VGISTNKIHARGPV
 439 DVFL.RQVDSAAVFHN.....AS...TR...FSD..GARFG..LGAE....VGISTSRIHARGPV
 440 QRFA.DHVDAAAVMIN.....AS...TA...FTD..GEQYG..MGAE....IGISTQKLHARGPM
 441 EYFL.NAIDSAVVMHN.....AS...TQ...FSD..GGEFG..MGAE....IGIATGKMHARGPV
 442 ASFM.NRVDSACVFHN.....CS...SR...FSD..GYRFG..FGAE....IGISTTRIHARGPV
 443 EHFL.KHVDSACAFHN.....AS...TR...FAD..GYRFG..LGAE....VGISTGRIHARGPV
 444 EHFL.KHVDSACAFHN.....AS...TR...FAD..GYRFG..LGAE....VGISTGRIHARGPV
 445 QRFA.DRVDAAAVMIN.....AS...TA...YTD..GEQYG..MGAE....IGISTQKLHARGPM
 446 ASFM.NRVDSACVFHN.....CS...SR...FSD..GYRFG..FGAE....IGISTTRIHARGPV
 447 EHFL.KHVDSACAFHN.....AS...TR...FAD..GYRFG..LGAE....VGISTGRIHARGPV
 448 DEFM.KNVDSACVFHN.....AS...TR...FSD..GYRFG..LGAE....VGISTTRIHARGPV
 449 QIFL.ESVDSACVFAN.....CS...SR...MAD..GYRLG..LGAE....VGISTGRIHARGPV
 450 QRFA.DRVDAAAVMIN.....AS...TA...FTD..GEQFG..MGAE....IGISTQKLHARGPM
 451 SYFE.QYVDAAAVSIN.....TS...TA...WTD..GEMFG..FGAE....IGISTQKLHARGPM
 452 QIFL.ESVDSACVFAN.....CS...SR...MAD..GYRLG..LGAE....VGISTGRIHARGPV
 453 QIFL.ESVDSACVFAN.....CS...SR...MAD..GYRLG..LGAE....VGISTGRIHARGPV
 454 EIFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTSRIHARGPV
 455 QRFA.DRVDAAAVMIN.....AS...TA...YTD..GEQYG..MGAE....IGISTQKLHARGPM
 456 NRFM.AGIDASGVYWN.....AS...TR...FAD..GFRYG..YGTE....VGISTNKIHARGPM
 457 EIFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTSRIHARGPV
 458 ERFM.AAVDSAGVYWN.....AS...TR...FAD..GTRYG..FGTE....VGISTNKIHSRGPV
 459 GKFQ.RLLRSSCIYVN.....AS...TR...FSD..GGEFG..FGGE....VGISTSKLHARGPM
 460 AAFM.NQVDAAVVYQN.....AS...SR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 461 EKFL.KGIDSSGVYWN.....AS...TR...FAD..GFRYG..FGTE....VGISTSKIHARGPV
 462 EVFL.RQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAG....GWISTSRIHARGPV
 463 ARFL.AGTDSAVAMWN.....AS...TQ...FCD..GGEFG..FGAE....IGIATGRIHARGPI
 464 WRFL.EEVDASLVLWN.....AS...TR...FND..GFELG..LGAE....IGISTSKLHPTAPW
 465 AEFF.KRVDAAVVYHN.....AS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 466 EYFM.RGVDSAGVFWN.....AS...TR...FAD..GMRFG..FGTE....VGISTNKIHTRGPV
 467 NIFM.KGVDSAGVFWN.....AS...TR...FAD..GMRYG..FGTE....VGISTNKIHSRGPV
 468 SDFV.RRVDSACVFHN.....CS...TR...FAD..GYRFG..LGAE....VGISTGRIHARGPV
 469 RRFH.QEVDAACVYVN.....AS...SR...FTD..GGQFG..MGAE....IGVSTQKLHARGPM
 470 RRFH.QEVDAACVYVN.....AS...SR...FTD..GGQFG..MGAE....IGVSTQKLHARGPM
 471 AEFL.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 472 DAFM.KQVDAAAVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 473 NKFL.KNVKSSIAMHN.....TS...TQ...FAD..GGEFG..FGGE....VGISTNTLPPRGPV
 474 DVFM.KGVDSAGVFWN.....AS...TR...FAD..GMRYG..FGTE....VGISTNKIHTRGPV
 475 TLFT.KIVDAACVYTN.....VS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 476 ERFV.QDVDSAAVMVN.....AS...PR...FND..GGQLG..LGAE....VAISTQKLHARGPM
 477 DKFL.TEVDAAAVYAN.....AS...TA...FTD..GGEFG..LGAE....IGISTQKVHARGPM
 478 DAFL.QRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 479 ATFL.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 480 ERFM.NEVDSAGVYWN.....AA...TR...LAD..GMRYG..FGTE....VGISTNKIHSRGPV
 481 ALFT.RMVDAACVYTN.....VS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 482 NKFL.KNVKSSIAMHN.....TS...TQ...FAD..GGEFG..FGGE....VGISTNTLPPRGPV
 483 DQFL.IEVDAAAVYAN.....AS...TA...FTD..GGEFG..LGAE....IGISTQKVHARGPM
 484 ATFM.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 485 ERFM.SAVDASGAYWN.....AS...TR...FAD..GMRYG..FGTE....VGISTNKIHSRGPV
 486 DKFL.TEVDAAAVYAN.....AS...TA...FTD..GGEFG..LGAE....IGISTQKVHARGPM
 487 EQFL.IGIDSAGVYWN.....TS...SR...LAD..GMRYG..FGTE....VGISTNKIHSRGPV
 488 DEFL.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 489 ERFV.QDVDSAAVMVN.....VS...PR...FND..GGQLG..LGAE....VAISTQKLHARGPM
 490 EKFM.KGVDSSGVYWN.....AS...TR...FAD..GFRYG..FGAE....VGISTSKIHARGPV
 491 SEFM.QRIDAAVVTEN.....AS...TR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 492 EKFX.KGVDSSGVYWN.....AS...TR...FAD..GFRYG..FGAE....VGISTSKIHARGPV
 493 AEFL.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 494 EYFL.KAVDSSSVYWN.....AS...TR...FAD..GFRYG..FGTE....VGISTSKIHARGPV
 495 AEFF.KRVDAAVVYAN.....TS...TA...FTD..GAQFG..LGAE....IGISTQKLHARGPM
 496 AYFQ.TAVDAAAVYHN.....AS...TR...FTD..GFE--..----....--------------
 497 SAWC.RGLDSANCFVN.....AS...TR...FAD..GTRYG..LGTE....VGISTGKTHARGPV
 498 AEFQ.RRVESACVFHN.....CS...TR...FAD..GFRFG..LGAE....VGISTARIHARGPV
 499 SAWC.RGLDSANCFVN.....AS...TR...FAD..GTRYG..LGTE....VGISTGKTHARGPV
 500 DFFL.KGIDSAGVYWN.....AS...TR...FAD..GFRYG..FGTE....VGISTSKIHARGPV
 501 EQFL.QQVDSACVFWN.....VS...SR...FYD..GYRFG..L---....--------------
 502 VYFQ.TAVDAAAVYHN.....AS...TR...FTD..GF---..----....--------------
 503 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 504 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 505 QQFM.ESIDAAAVYQN.....AS...TR...FTD..GGQFG..LGGE....LAISTDKLHQRGPI
 506 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 507 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 508 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 509 KRMI.DETSSGGVTGN.....DV...IM...HFT..LNSFP..FGGV....GSSGMGAYH--GKH
 510 KRMI.SETSSGGVTAN.....DV...IM...HFT..VTELP..FGGV....GHSGMGAYH--GKH
 511 KKMI.AETSSGGVTAN.....DV...IV...HIT..VPTLP..FGGV....GNSGMGAYH--GKK
 512 KRMI.DETSSGGVTGN.....DV...IM...HFT..LNSFP..FGGV....GSSGMGAYH--GKH
 513 KRMI.DETSSGGVTGN.....DV...IM...HFT..LNSFP..FGGV....GSSGMGAYH--GKH
 514 SDFV.RRVDSACVFHN.....CS...TR...FAD..GYRFG..LGAE....VGISTGRIHARGPV
 515 TTFM.ENIDTAAVYHN.....AS...TR...FTD..GGQMG..VGAE....LAISTDKLHHRGPL
 516 KRMI.DGTSSGGVTGN.....DV...IM...HFT..LSSLP..FGGV....GSSGMGAYH--GKH
 517 KRMI.DGTSSGGVTGN.....DV...IM...HFT..LSSLP..FGGV....GSSGMGAYH--GKH
 518 LEFM.QQIDCAAVYQN.....AS...TR...FTD..GGQMG..VGAE....LAISTDKLHHRGPL
 519 HKFV.KSINSANVFVN.....IS...SR...FAD..GFRFG..LGTE....VGISTGKTHARGPV
 520 KRVI.SETSSGGVTGN.....DV...IM...HFF..LASLP..FGGV....GNSGMGAYH--GKH
 521 SKF-.-----------.....--...--...---..-----..----....--------------
 522 NVFL.RQVDSAAVFHN.....AS...TR...FSD..GARF-..----....--------------
 523 RQFA.LGVNSAATYIN.....TS...PR...FSR..NPSRG..DSVF....LGMSNQKGHRRGFI
 524 ADFM.QQVDCAAVYKN.....AS...TR...FTD..GGQLG..VGAE....LAISTDKLHHRGPL
 525 RQFA.LGVNSASTYIN.....TS...PR...FSR..NPSRG..DSVF....LGMSNQKGHRRGFI
 526 EFFL.-----------.....--...--...---..-----..----....--------------
 527 KRMI.DETSSGGVTGN.....DV...IM...HFT..LNSFP..FGGV....GSSGMGAYH--GKH
 528 RQFA.LGVNSASTYIN.....TS...PR...FSR..NPSRG..DSVF....LGMSNQKGHRRGFI
 529 HRVI.HRLEAGICWIN.....--...TW...GES..PAEMP..VGGY....KQSGVGREN--GLT
 530 EAFM.QQVDSAAVYRN.....AS...TR...FTD..GGQMG..VGAE....LAISTDKLHHRGPL
 531 ----.-----------.....--...--...---..-----..----....--------------
 532 THFM.ENIDTAAVYHN.....AS...TR...FTD..GGQMG..VGAE....LAISTDKLHHRGPL
 533 EKVL.NSTSSGGVTIN.....DT...LV...HVS..SSYLP..FGGV....GNSGMGEYH--GKY
 534 HRVA.RRIQAGLVWTN.....CW...M-...-VR..DLNLP..FGGM....KSSGVGREG--GRD
 535 KKLL.ERTSFGGGCIN.....DT...IM...HLT..SPYMP..FGGV....GSSGMGSYH--GYK
 536 KRML.KETTSGGVTVN.....DV...LM...HYT..VDTLP..FGGV....GNSGMGRYH--GKH
 537 REFA.RRIQVGMVGIN.....VP...IP...-VP..MAWHG..FGGW....KKSLFGDMHAYGEE
 538 REFS.RRIQVGMVGIN.....VP...IP...-VP..MAWHG..FGGW....KKSLFGDMHAYGEE
 539 NTFM.QSVDAAAVYHN.....AS...TR...FTD..GGQFG..LGGE....LAISTDKLHQRGPI
 540 REFA.QRIQVGMVGIN.....VP...IP...-VP..MAWHG..FGGW....KKSLFGDMHAYGEE
 541 HRTI.HRLEAGICWIN.....--...TW...GES..PAEMP..VGGY....KQSGVGREN--GIT
 542 HRTI.HRLEAGICWIN.....--...TW...GES..PAEMP..VGGY....KQSGVGREN--GIT
 543 HRTI.HRLEAGICWIN.....--...TW...GES..PAEMP..VGGY....KQSGVGREN--GIT
 544 HRTI.HRLEAGICWIN.....--...TW...GES..PAEMP..VGGY....KQSGVGREN--GIT
 545 QQVM.EYVSFGGGAIN.....DT...IY...HLA..NPHLP..FGGV....GTSGMGNYH--GKA
 546 RQFA.TEIDSALVYIN.....NS...PR...FDR..HPTYG..ESLF....LGVSNQKGHYRGLI
 547 DLFI.KNTSSGGVCIN.....DT...MM...HFS..CESLP..FGGV....GNSGLGAYH--GRY
 548 DTIS.KKISVGNVYIN.....RN...QI...GAA..VGIQP..FGGR....GLSGTGPKA-GGPH
 549 RLFC.DEIEVGMVGVN.....VP...LP...-VP..VAYHS..FGGW....KRSLFGDLHAYGPD
 550 RRFQ.NEVEVGMVGIN.....VP...IP...-VP..MAYYS..FGGW....KNSLFGDSHAHGTE
 551 DTIS.KKISVGNVYIN.....RN...QI...GAA..VGIQP..FGGR....GLSGTGPKA-GGPH
 552 NHWL.EQVHAGNLYVN.....RN...TV...GAV..VGVQA..FGGR....GLSGTGPKA-GGPF
 553 RLFC.DEIEVGMVGVN.....VP...LP...-VP..VAYHS..FGGW....KRSLFGDLHAYGPD
 554 KQFV.QDVSAGGITIN.....DT...VL...HVT..VKDLP..FGGV....GESGIGAYH--GKF
 555 KQFV.QDVSAGGITIN.....DT...VL...HVT..VKDLP..FGGV....GESGIGAYH--GKF
 556 ----.-----------.....--...--...---..-----..----....--------------
 557 RLFC.DEIEVGMVGVN.....VP...LP...-VP..VAYHS..FGGW....KRSLFGDLHAYGPD
 558 HRVA.KKLQSGLVWTN.....CW...L-...-IR..ELNLP..FGGM....KSSGVGREG--GKD
 559 WRVA.RALDAGTVWIN.....TY...KQ...FSI..--STP..FSGR....KESGMGREK--GSL
 560 WRVA.RALDAGTVWIN.....TY...KQ...FSI..--STP..FSGR....KESGMGREK--GSL
 561 HKVL.DATRSGGFCTN.....DL...LF...QSA..VHGLP..FGGV....GQSGFGRYH--GRA
 562 WRVA.RALDAGTVWIN.....TY...KQ...FSI..--STP..FSGR....KESGMGREK--GSL
 563 AHIV.DRADVGNLYVN.....RN...VV...GAV..VGVQP..FGGE....GLSGTGPKA-GGPL
 564 HRVA.KKLQSGLVWTN.....CW...L-...-IR..ELNLP..FGGM....KSSGIGREG--AKD
 565 WRVA.RVLDAGTVWIN.....TY...KQ...FSI..--STP..FSGR....KESGMGREK--GSL
 566 AHVI.SRAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 567 ERVI.KEVPAGGMVVN.....HL...IF...HFA..THKLP..FGGV....GPSGLGAYH--GKF
 568 RAFS.RELNSAMVHVN.....AS...PR...FSR..SPRHS..NEIA....LGMSNQKGYRRGRI
 569 AQIV.QHAEVGNLYVN.....RN...IV...GAV..VGVQP..FGGE....ALSGTGPKA-GGPL
 570 NKVN.GTISFGGGCIN.....DT...LM...HIA..TPYLP..FGGV....GESGIGSYH--GKS
 571 ANVA.DRIRVGNIYIN.....RN...II...GAV..VGVQP..FGGR....GLSGTGPKA-GGPL
 572 NFFF.DNTRSGACVQG.....DT...LL...HFA..VDVLP..FGGT....GPSGYGNYH--GKA
 573 AHVI.SRAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 574 ANVA.DRIRVGNIYIN.....RN...II...GAV..VGVQP..FGGR....GLSGTGPKA-GGPL
 575 ANVA.DRIRVGNIYIN.....RN...II...GAV..VGVQP..FGGR....GLSGTGPKA-GGPL
 576 DKVL.DGTQSGSLMIN.....DT...LL...HFT..NPNLP..FGGI....GDSGIGSYH--GKG
 577 RAFS.RELNSAMVHVN.....AS...PR...FSR..SPRHS..NEIA....LGMSNQKGYRRGRI
 578 RTFQ.HHIEVGQVGIN.....IP...IP...-VP..LPFFS..FTGW....KGSFYGDLHAYGKQ
 579 RTFQ.HHIEVGQVGIN.....IP...IP...-VP..LPFFS..FTGW....KGSFYGDLHAYGKQ
 580 AHVI.SNAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 581 AHVI.SNAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 582 RTFQ.HHIEVGQVGIN.....IP...IP...-VP..LPFFS..FTGW....KGSFYGDLHAYGKQ
 583 WRVT.EGLEYGMVGHN.....TG...ML...--S..TEVAP..FGGV....KQSGFGREG--SKY
 584 WRVT.EGLEYGMVGHN.....TG...ML...--S..TEVAP..FGGV....KQSGFGREG--SKY
 585 AHVT.SRIKAGNLYIN.....RN...II...GAV..VGVQP..FGGR....GLSGTGPKA-GGPL
 586 RKFQ.RSVTVGMIGIN.....VP...LP...-VP..VAYHS..FGGW....KASLFGDKHIYGPE
 587 HRII.HKLEAGICWIN.....AW...--...GES..PAEMP..VGGY....KQSGVGREN--GVS
 588 DQWL.DKVHAGNLYVN.....RN...TV...GAV..VGVQP..FGGM....GLSGTGPKA-GGPL
 589 FYIA.DKLEVGTVQIN.....NK...TE...-RG..PDHFP..FLGV....KASGMGTQG--VKY
 590 EKIE.KETSSGGLVYN.....DS...VI...HFA..NPHLP..FGGV....NHSGMGSYH--GKH
 591 NQVN.ESFDFGGGVIN.....DT...IV...HFV..NDKLP..FGGV....GASGVGNYH--GRA
 592 HRVT.RQFDVGIVWVN.....--...TW...FLR..DLRTP..FGGT....RLSGIGREG--GRH
 593 WRIA.RALEAGTVWIN.....TY...KL...FSI..--STP..FSGW....KESGMGREK--GRL
 594 WRIA.RALETGTVWIN.....TY...KL...FSI..--STP..FSGW....KESGMGREK--GRL
 595 HRII.HKLEAGICWIN.....AW...--...GES..PAEMP..VGGY....KQSGVGREN--GVS
 596 QRVT.ERAHVGNCYIN.....RN...IV...GAV..VGVQP..FGGE....GLSGTGPKA-GGPL
 597 FYIA.NKLEVGTVHVN.....NK...TE...-RG..PDHFP..FLGV....KSSGMGTQG--IRY
 598 AHVI.ANAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 599 WRIA.RALETGTVWIN.....TY...KL...FSI..--STP..FSGW....KESGMGREK--GRL
 600 HRVA.AALNAGTVWVN.....C-...-F...FVR..DLRAP..FGGV....GDSGIGREG--GTF
 601 AHVI.SNAHVGNIYVN.....RN...VI...GAV..VGVQP..FGGE....GLSGTGPKA-GGAL
 602 RQFS.MGVDSALVYVN.....IP...PY...FCR..NPRHG..ESLF....LGVSSQKGQRRGLI
 603 FYVA.DRLEVGTVQVN.....NK...TE...-RG..PDHFP..FLGV....KASGIGTQG--IRY
 604 KRMI.DETSSGGVTGN.....DV...IM...HFM..LNSFP..FGGV....GSSGMGAYH--GKH
 605 WRVC.EGLDYGMVGQN.....TG...IL...--S..TEVAP..FGGV....KQSGFGREG--SKY
 606 TRIL.SETSSGSVTFN.....DV...MI...QYM..CDALP..FGGV....GESGIGRYH--GKY
 607 KKAL.RQTRSGSFCCN.....DL...LF...QSA..VHTLP..FGGT....GKSGFGRYH--GKA
 608 HRVA.AEIDSGMVWIN.....SS...Q-...-DC..DPRVP..FGGV....KQSGIGREL--GEA
 609 AQVT.GRVKAGNLYVN.....RN...VI...GAI..VGVQP..FGGR....GLSGTGPKA-GGPL
 610 AQVT.GSAHVGNLYVN.....RN...MV...GAV..VGVQP..FGGE....GLSGTGPKA-GGPL
 611 ERIG.SKISTGMLTIN.....DY...GA...SYL..IQDLP..FGGC....KESGFGRFN--GPE
 612 EKVT.TSTKVGNYYVN.....RN...IV...GAV..VGVQP..FGGE....GLSGTGPKA-GGPL
 613 RAFE.QDVEVGMIGVN.....VP...IP...-VP..MAYYS..FGGW....KASLFGDTHAHGIE
 614 RDFA.SRVNVGMVGIN.....FP...IP...-VP..LSYYT..FGGW....KKSAFGDLNQYGPD
 615 DLAR.REFRTGNLYIN.....RG...CT...GAV..VERHP..FGGF....KLSGIGSKA-GGPD
 616 EQYE.AAISAGGMLVN.....DT...AV...HLT..NQYLP..FGGV....GESGMGAYH--GRF
 617 EHFL.SRVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....GGISTSKIPARGPV
 618 KHLM.AETSSGGFLAN.....DC...LV...HFT..VSALP..FGG-....--------------
 619 ARVT.SRAKVGNIYVN.....RN...VI...GAI..VGVQP..FGGR....GLSGTGPKA-GGPL
 620 HRVA.KRLKAGTIGIN.....T-...-H...HVV..DVALP..FGGF....KQSGYGRDM--GRD
 621 AEVV.HRSRSGGVCIN.....DV...LM...HAA..LHSMP..FGGL....GSSGFGAYH--GKA
 622 FAYL.RNLRVGNVVIN.....DS...TD...-YW..EALEP..FGGA....AGTRTGWGRVGGRY
 623 QYYF.DNIEVGVIYAN.....RK...SGgstGSM..VGSQP..FVGW....KLSGVSGKGTGSFY
 624 RYFQ.NNIDVGQVGIN.....IP...IP...-VP..VAWFS..FTGS....RGSKLGDLGPNGKQ
 625 RRLV.SETSSGSIVFN.....DA...IL...QYI..ADTIP..FGGV....GECGFGKYH--GKF
 626 RYFQ.NNIDVGQVGIN.....IP...IP...-VP..VAWFS..FTGS....RGSKLGDLGPNGKQ
 627 QHVT.EAVHAGNIYVN.....RN...QI...GAI..VGSQP..FGGE....GLSGTGPKA-GGPH
 628 FDIA.NKLEVGTVHIN.....NK...T-...GRG..PDNFP..FLGL....KGSGAGVQG--IRY
 629 FDIA.NKLEVGTVHIN.....NK...T-...GRG..PDNFP..FLGL....KGSGAGVQG--IRY
 630 ETVA.ETIRAGNIYVN.....RN...QI...GAV..VGSQP..FGGE....GLSGTGPKA-GGPL
 631 VQVA.KQIDTGMIHVN.....DQ...PV...-NE..EAHIS..FGGE....KDSGIGRFG--GEW
 632 FDIA.NKLEVGTVHIN.....NK...T-...GRG..PDNFP..FLGL....KGSGAGVQG--IRY
 633 FDIA.NKLEVGTVHIN.....NK...T-...GRG..PDNFP..FLGL....KGSGAGVQG--IRY
 634 DIFS.DKCNVGNIYIN.....RD...MV...GAV..VGSQP..FGGQ....NLSGSGYKA-GGPN
 635 RDIA.DRIDTGMIHIN.....DQ...PV...-NQ..EPHLP..FGGY....KNSGLGRYN--GEY
 636 LSFA.RQAHVGVAVVN.....GG...TH...-GS..EPHMP..FGGV....NASGNGTRE-PGTE
 637 LAVA.KRIESGICHIN.....GP...TV...-HD..EAQMP..FGGV....KGSGYGRFG--SKA
 638 ALFK.ERVEAGCVMVN.....LA...TA...GTD..-YHVP..FGGR....KSSSFGPRE-QGQY
 639 ENLS.RRIRVGNAYVN.....RN...QI...GAI..VGSQP..FGGE....GLSGTGPKA-GGPN
 640 KRVA.KALLCGQVFVN.....NY...G-...AAG..GVELP..FGGV....RKSGHGREK--GVI
 641 ARVT.AKAHAGNIYVN.....RN...VI...GAV..VGVQP..FGGH....GLSGTGPKA-GGPL
 642 ERVG.RQVRGGTVWVN.....T-...-F...LVR..DLTAP..FGGI....GISGIGREG--GDY
 643 AYVA.THAKVGNLYVN.....RN...MV...GAV..VGVQP..FGGE....GLSGTGPKA-GGPA
 644 QHYF.ESVDVGVVYAN.....RA...AG...AST..GAMVG..SQPF....VGWKLSGSTGKGTG
 645 MKVA.NNIEAGEIYIN.....RT...P-...-AD..PYQGF..HAGW....KRSGLGGDD--GKH
 646 WRVA.EALEYGMVGIN.....TG...L-...-IS..NASAP..FGGV....KASGLGREG--SKY
 647 QTVV.ERIEAGNIYVN.....RD...QI...GAV..VGSQP..FGGE....GLSGTGPKA-GGPH
 648 QEVS.DAIHVGNIYVN.....RN...QI...GAV..VGSQP..FGGE....GLSGTGPKA-GGPR
 649 QLFE.EQTSSGSYSIN.....DA...IF...QLT..NPNLP..FGGV....GNSGSGKYH--GLA
 650 KYAL.ENVKFGGGCIN.....DV...IQ...QVE..EKDFG..FGGV....GLSGIGKYH--GYD
 651 QHVT.EAVHAGNIYVN.....RN...QI...GAI..VGSQP..FGGE....GMSGTGPKA-GGPH
 652 MRVT.RRLRSGQVFVN.....NW...A-...-DM..DQTVP..FGGV....KQSGNGRDK--SHH
 653 EYFF.EHIEFGVVYAN.....RRggaTT...GAW..PGAQP..FTGW....KASGATGRGVNGVY
 654 QHVC.DRIHAGNIYVN.....RN...QI...GAI..VGSQP..FGGE....GLSGTGPKA-GGPN
 655 NKFQ.KQIQAGQIGIN.....VP...IP...-VP..LPMFS..FTGN....KGSFLGDLNFYGKA
 656 QYYF.DNVEVGVLYAN.....RK...SG...GST..GSMVG..SQPF....VGWKLSGVSGKGTG
 657 DYIA.QRTHSGHFGLN.....TV...LT...HVA..QDDLP..FGGV....GASGMGKYH--GPE
 658 DWLQ.TRIRAGSVNIN.....EV...IE...QVG..LASLP..LSGV....GASGTGAYH--GKF
 659 QNAA.RALAAGMVSVN.....H-...-F...GLA..LPETP..FGGI....NDSGYGSEG--GSE
 660 RKYQ.REIDVGQVGIN.....LP...IP...-VP..LPFFS..FTGS....RGSFVGAGHFYGKT
 661 RTFV.RRTRSGGVARN.....DF...AA...QMI..PSDAP..FGGV....GRSGMGAYH--GKA
 662 ARVI.ARLPTGNVYVN.....RN...II...GAV..VGVQP..FGGS....GLSGTGPKA-GGPH
 663 LRMS.AALDFGCVWIN.....CH...IP...--L..VAEMP..HGGF....KSSGYGKDL--SKY
 664 QALA.AAAHVGNIYVN.....RN...MI...GAV..VGVQP..FGGE....GLSGTGPKA-GGPH
 665 QHVT.EAVHAGNIYVN.....RN...QI...GAI..VGSQP..FGGE....GLSGTGPKA-GGPN
 666 RRIA.AQISTGTVNVN.....DG...YA...AAWa.SVGAP..MGGM....KASGIGRRH--GRE
 667 AHVI.SNAHVGNI---.....--...--...---..-----..----....--------------
 668 QRIA.HAARVGNVYVN.....RN...MI...GAV..VGVQP..FGGE....GLSGTGPKA-GGPL
 669 QRFL.QEVDAALIHIN.....TS...PL...SAGrgAGIPT..LGAFrdlsLGISTQRLHVRGPI
 670 DTIL.NFTNSGGVTIN.....DV...AI...HAD..VPSAP..FGGV....GDSGYGAYH--GKW
 671 HQAW.NELEVGGVVIG.....DV...PS...-WR..VDNMP..YGGV....KDSGLGREG--IRY
 672 ARVL.ARSSSGSVVVN.....HC...LQ...QFM..HTGLP..FGGI....GQSGIGSAH--GMH
 673 QRFL.QEVDAALIHIN.....TS...PL...SAGrgAGIPT..LGAFrdlsLGISTQRLHVRGPI
 674 MRMS.RAIRAGTVWLN.....SH...MR...LA-..-AEAE..TGGF....GQSGLGRLH--GPE
 675 EQFM.SAAGSDCGIVN.....VN...IG...-TS..GAEIGgaFGGE....KETGGGR-------
 676 EQFM.SAAGSDCGIVN.....VN...IG...-TS..GAEIGgaFGGE....KETGGGR-------
 677 ----.-----------.....--...--...---..-----..----....--------------
 678 HRVA.KKLQSGLVWTN.....CW...L-...-IR..ELNLP..FGGM....KSSGVGREG--GKD
 679 RRLF.DELEVGLLATN.....DG...PG...-FR..AEHFP..FGGV....KDSGIGREG--VK-
 680 EQFM.SAAGSDCGIVN.....VN...IG...-TS..GAEIGgaFGGE....KETGGGR-------
 681 EQFM.SAAGSDCGIVN.....VN...IG...-TS..GAEIGgaFGGE....KETGGGR-------
 682 FELAkNHFDTGMVFIN.....S-...-F...GVA..QPNMP..FGGV....KASGYGREH--GGF
 683 EYFH.THIEAGNIYIN.....KP...TT...GAI..VLRQP..FGGI....KKSAIGLGRKVGIY
 684 EYFH.THIEAGNIYIN.....KP...TT...GAI..VLRQP..FGGI....KKSAIGLGRKVGIY
 685 EYFH.THIEAGNIYIN.....KP...TT...GAI..VLRQP..FGGI....KKSAIGLGRKVGIY
 686 ETFL.SQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTSRIHARGPV
 687 ----.-----------.....--...--...---..-----..----....--------------
 688 ETFL.RQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTSRIHARGPV
 689 EYFH.THIEAGNIYIN.....KP...TT...GAI..VLRQP..FGGV....KKSAIGFGRKVGIY
 690 EYFH.THIEAGNIYIN.....KP...TT...GAI..VLRQP..FGGI....KKSAIGLGRKVGIY
 691 RYFF.KHIRAGIVNWN.....KP...IT...GAS..-SAAP..FGGI....GASGN---------
 692 EIFQ.DMVDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 693 SKFF.VSVDAAALYHN.....AS...TR...FTD..GSEFG..FGAE....IGISTQKLHVRGPM
 694 AEIA.KRISTGMVFVN.....HP...TM...--A..KADLP..FGGV....KRSGYGREL--VGL
 695 QRFI.REVDASSVMVN.....AS...TR...FSD..GGQYG..LGAE....IGISTTKLHAYGPM
 696 ETFL.HQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTSRIHARGPV
 697 GLWL.DTIQAGNLYVN.....RG...IT...GAI..VQRQP..FGGW....KKSAVGAGT-----
 698 ELFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTGRIHARGPV
 699 LGLA.DQLDAGTVFVN.....RC...D-...-HA..DLYLP..WGGQ....KLSGLGRGN--GKE
 700 RTFV.RRTRSGGVARN.....DF...AA...QMI..PSDAP..FGGV....GRSGMGAYH--GKA
 701 EFWA.ERANAGNLYVN.....RS...IT...GAI..VGRQP..FGGW....KRSAVGPGAKAG--
 702 EFFL.QHVDSACVFWN.....AS...TR...FSD..GYRFG..LGAE....VGISTSRIHARGPV
 703 QKFQ.DEIDAAAVYVN.....AS...TR...FTD..GFVFG..LGAE....IGISTQKLHARGPM
 704 ----.-----------.....--...--...---..-----..----....--------------
 705 KRFA.LNMPVSRILVNtp9igAS...TN...LVP..ALTLG..CGAI....GGSSTSNNI--GPL
 706 EVFL.QQVDSAAVFHN.....AS...TR...FCD..GARFG..LGAE....VGISTSRIHARGPV
 707 REFG.LRKPVSRLLVNts9igAS...TN...LVP..ALTLG..CGAV....GGSSTSDNI--GVE
 708 QRFV.NEVDSSAVYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 709 TEFA.LRVPANRVVWN.....QP...SV...HGT..IGALY..NSLV....PSLTLGCGAMGG--
 710 KNFG.LRIPVSRLLVNvp9lgAA...TN...LTP..ALTLG..CGAV....GGSSTSDNI--GPM
 711 RAFY.QQVQTPLVFVN.....RP...PQ...LER..LDALA..LGVA....-----AKGPQRGLF
 712 ----.-----------.....--...--...---..-----..----....--------------
 713 ATYC.RHVDTAVALVN.....AS...TR...LSS..GVPLG..CGVD....FAISTSKTHCRGPL
 714 ----.-----------.....--...--...---..-----..----....--------------
 715 LQFA.QTVDANRVTFN.....SP...TS...H--..-----..----....--------------
 716 KTFG.ERVKAIRVIWN.....SP...ST...FGG..IG---..----....--------------
 717 AEYG.DAVKASRVLVN.....QP...DS...VGG..IGDVY..TDAL....KASLTLGTGSWGKN
 718 ERYA.KACDVCRVLVN.....SPg..TQ...GCI..GA---..----....--------------
 719 TEFA.TQVPVLRVSVN.....VGn..ST...GSS..GLET-..----....--------------
 720 TEFA.TQVPVLRVSVN.....VGn..ST...GSS..GLET-..----....--------------
 721 TDFM.NTVDAAVVYQN.....VS...SR...FTD..GFEFG..FGAE....IGISTQKLHARGPM
 722 MEFA.KKP-ASRILVNtg9tgAS...TG...LKP..AFTLG..CGTW....GGSSVSEN-----V
 723 ECFY.SAVNAPFVG-N.....GI...TR...WVD..G----..----....--------------
 724 TDFA.AQVPVLRVSVN.....VG...--...---..-----..----....--------------
 725 SRVQ.DMAE-------.....--...--...---..-----..----....--------------
 726 SRVQ.DMAE-------.....--...--...---..-----..----....--------------
 727 SRVQ.DMAE-------.....--...--...---..-----..----....--------------
 728 ----.-----------.....--...--...---..-----..----....--------------
 729 LQFS.ESVDAGSVWVN.....CY...D-...-AI..TPQTP..FGGY....KKSGIGREL--GED
 730 ----.-----------.....--...--...---..-----..----....--------------
 731 ----.-----------.....--...--...---..-----..----....--------------
 732 AAFT.-----------.....--...--...---..-----..----....--------------
 733 DTFL.QQVDSAAVFHN.....AS...TR...F--..-----..----....--------------
 734 DRFT.QAVDSAAVYVN.....AS...TR...FTD..G----..----....--------------
 735 EIFL.RQVDSAAVFHN.....AS...TR...FSD..GFRFG..LGAE....VGISTSRIHARGPV
 736 ----.-----------.....--...--...---..-----..----....--------------
 737 ----.-------VYVN.....AS...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 738 ----.-----------.....-S...TR...FTD..GGQFG..LGAE....VAVSTQKLHARGPM
 739 ----.-----------.....--...SR...FSD..GSQLG..LGAE....IGIATTKLHAYGPM
 740 ----.-----------.....--...--...---..-----..----....--------------
 741 ----.-----------.....--...--...---..-----..----....------KMHARGPM
 742 ----.-----------.....--...--...---..-----..----....--------------
 743 ----.-----------.....--...--...---..-----..----....--------------
 744 ----.-----------.....--...--...---..-----..----....--------------
 745 ----.-----------.....--...--...---..-----..----....--------------
 746 ----.-----------.....--...--...---..-----..----....--------------
 747 ----.-----------.....--...--...---..-----..----....--------------


           390       400       410       420     
            |         |         |         |     
   1 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRNT
   2 GL.KELTTTKYVIYGTGQIR-----------------------
   3 GL.EGLTSQKYVVFGDGHIR-----------------------
   4 GP.EQLTTFKYIIFGSGQIR-----------------------
   5 GL.EGLTSEKYVVFGDGHV------------------------
   6 GL.EGLTSEKYVVFGDGHV------------------------
   7 GL.EGLTSQKYIVLGDGTIR-----------------------
   8 GL.NGLTSQKWIVLGDGQVR-----------------------
   9 GL.EGLTSQKYIVLGDGTIR-----------------------
  10 GL.EGLTSQKWIVLGNGHIR-----------------------
  11 GL.EELTTTKYIIFGQGQIR-----------------------
  12 GL.EGLTSEKYVVFGDGHV------------------------
  13 GL.EGLTSEKYVVFGDGHVR-----------------------
  14 GL.EDLTTTKFIVYGDGQVR-----------------------
  15 GL.EDLTTTKFIVYGDGQVR-----------------------
  16 GL.EGLTSEKYVVFGDGHV------------------------
  17 GL.NEMTTIKYVCYGDGQIR-----------------------
  18 GL.EGLTSEKYVVFGDGHV------------------------
  19 GL.KELTTNKYIIYGNGQI------------------------
  20 GL.TQLTTTKYIIYGNGQI------------------------
  21 GL.EGLTSQKWVVYGDGQIR-----------------------
  22 GL.EGLTTQKFIVLGDGHV------------------------
  23 GL.EELTTTKFIVYGNGQV------------------------
  24 GL.EALTTYKWIGFGDGTI------------------------
  25 GL.EELTTYKYVILGSGQIR-----------------------
  26 GL.EALTTYKWIGFGDGTI------------------------
  27 GL.KELTTIKYIIYGNGQI------------------------
  28 GL.EALTTYKWIGFGDGTI------------------------
  29 GL.EGLTSQKWIVFGDGHIR-----------------------
  30 GL.EGLTSQKYVVLGDGHIR-----------------------
  31 GL.EDLTTRKFIVFGEGQVR-----------------------
  32 GL.EGLTCEKYVVIGDGQLR-----------------------
  33 GL.NGLTSQKYVVLGDGHTR-----------------------
  34 GL.EGLTSQKWIVFGDGQIR-----------------------
  35 GL.DGLLIYKYKLIGNGHIVEDYAKRT----------------
  36 GL.DGLVIYKYRLIGNGHIVGDYAGR-----------------
  37 GL.DGLTSQKWIVFGNGEIR-----------------------
  38 GL.EGLTCEKYVVIGDGQLR-----------------------
  39 GL.AELTSTKYVIYGNGQA------------------------
  40 GL.EGLTSQKFIVLGDGHIR-----------------------
  41 GL.EGLTCEKYVVIGDGQLR-----------------------
  42 GL.EGLTSEKYIVYGDGHVR-----------------------
  43 GL.KELTTYKYVILGSGQIR-----------------------
  44 GL.EGLTCEKYIVIGDGQLR-----------------------
  45 GL.EGLTCEKYIVVGDGQLR-----------------------
  46 GL.EGLTSQKFIVLGDGHIR-----------------------
  47 GL.EQLTTTKYVIYGDGQIR-----------------------
  48 GL.EALTTYKWIGIGDYTI------------------------
  49 GL.EGLTCEKYIVIGDGQLR-----------------------
  50 GL.DALTTYKWIGYGEDLV------------------------
  51 GL.EALTTYKWIGIGDYTI------------------------
  52 GL.EALTTYKWIGIGDYTI------------------------
  53 GL.EALTTYKWIGIGDYTI------------------------
  54 GL.EALTTYKWIGIGDYTI------------------------
  55 GL.PELTTTKYVVTGEGHV------------------------
  56 GL.VGLTSQKYVVFGDGEIR-----------------------
  57 GL.EALTTYKWIGIGDYTI------------------------
  58 GL.EALTTYKWIGIGDYTI------------------------
  59 GL.KELTTIKYIILGSGQVR-----------------------
  60 GL.EGLTSLKYVVLGHG--------------------------
  61 GL.EALTTYKWIGFGDGTI------------------------
  62 GL.EALTTYKWIGIGDYTI------------------------
  63 GL.EGLTTLKWVLNGEGQVR-----------------------
  64 GL.NELTSTKYIIYGDGQIR-----------------------
  65 GL.EDLTTRKFVVFGDGQVR-----------------------
  66 GL.EALTTYKWIGIGDYTI------------------------
  67 GL.QELTTTKFIIYGDGQI------------------------
  68 GL.EALTTYKWIGIGDYTI------------------------
  69 GL.EALTTYKWIGIGDYTI------------------------
  70 GL.EGLTCEKYIVIGDGQLR-----------------------
  71 GL.EGLTSLKYVVLGHG--------------------------
  72 GL.EGLTTLKWVLNGEGQVR-----------------------
  73 GL.RELTTYKFVVLGEYHVR-----------------------
  74 GL.EGLTSLKYVVLGHG--------------------------
  75 GL.EGLTSLKYVVLGHG--------------------------
  76 GL.EGLTSLKYVVLGHG--------------------------
  77 GL.EGLTSLKYIVLGDGEV------------------------
  78 GL.EGLTSLKYVVLGHG--------------------------
  79 GL.DALTTYKWIGYGDDLV------------------------
  80 GL.EGLTSQKWVVLGDGHV------------------------
  81 GL.EALTSTKFYINGDGHIR-----------------------
  82 GL.EGLTTLKWVLNGEGQV------------------------
  83 GL.PELTTTKYVVTGEGHV------------------------
  84 GL.EGLTTEKFIVLGDGHIR-----------------------
  85 GL.RELTTYKFVVLGEYHVR-----------------------
  86 GL.EGLTSEKYVVLGDGQIR-----------------------
  87 GL.EGLTSQKWIVYGHGE-------------------------
  88 GL.EGLTSQKWVVLGDGHV------------------------
  89 GL.EDLTTTKFIVYGDGQVR-----------------------
  90 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPIPQRN-
  91 GL.EALTSTKFYINGDGHIR-----------------------
  92 AL.EELTIPKFVILGEGQVRDNFG-------------------
  93 AL.EELTIPKFVILGEGQVRDNFG-------------------
  94 GL.EALTSTKFYINGDGHIR-----------------------
  95 GL.EALTSTKFYINGDGHIR-----------------------
  96 GL.EGLTSMKWVVFGQGEV------------------------
  97 GL.EGLTCEKWIVLGDGQL------------------------
  98 GL.EGLTTEKYVVLGDGHIR-----------------------
  99 GL.EGLTTEKWIVLGDGHVR-----------------------
 100 DL.EALTSTKFYINGDGHIR-----------------------
 101 GL.EGLTSLKYVVLGHG--------------------------
 102 GL.EGLTSQKFIVLGNGQI------------------------
 103 GL.EALTSTKFYINGDGHIR-----------------------
 104 GL.AELTSYKFVVFGNGQL------------------------
 105 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN-
 106 GL.EGLTSLKYVVFGHGEI------------------------
 107 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN-
 108 GL.KEITSYKWIVYGSGQIR-----------------------
 109 GL.DGLTSEKYVVLGDGHIR-----------------------
 110 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN-
 111 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPVPQRN-
 112 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN-
 113 GL.EGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRN-
 114 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPIPQRN-
 115 GL.RELTSYKYVVKGTGQVR-----------------------
 116 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPIPQRN-
 117 GL.EALTSTKYVIRGNGQIR-----------------------
 118 GL.EGLTSLKYVVLGHGE-------------------------
 119 GL.EALTTYKWLAWGD---------------------------
 120 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPIPQRN-
 121 GL.EGLTSQKWIVLGDGHIR-----------------------
 122 GL.DALTTYKWIGYGDDLV------------------------
 123 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPIPQRN-
 124 GL.EGLTSLKYVVFGHGEI------------------------
 125 GL.EALTTYKWLAWGD---------------------------
 126 GL.EALTTYKWLAWGD---------------------------
 127 GL.NGLTSQKWIVYGHGEV------------------------
 128 GL.EALTSTKYYINGTGQVR-----------------------
 129 GL.EGLTSQKFIVLGDGHIR-----------------------
 130 GL.EGLTSLKYVVLGHGE-------------------------
 131 GL.DALTTYKWIGYGDDLV------------------------
 132 GL.EGLTSLKYVVFGHGEI------------------------
 133 GL.DALTTYKWIGYGDDLV------------------------
 134 GL.EALTSTKFYINGQGQIR-----------------------
 135 GL.EALTTYKWLAWGD---------------------------
 136 GL.EGLTSLKYVVLGHGE-------------------------
 137 GL.KEITSYKWIVYGSGQIR-----------------------
 138 GL.DALTTYKWIGYGDDLV------------------------
 139 GL.EALTSTKYYINGTGQVR-----------------------
 140 GL.EALTSTKFYINGQGQIR-----------------------
 141 GL.EALTSTKFYINGQGQIR-----------------------
 142 GL.EALTTYKWLAWGD---------------------------
 143 GL.QALTTEKFVVTGNGQIR-----------------------
 144 GL.KEITSYKWIVYGNGQIR-----------------------
 145 GL.TELTSTKYIIFGDGQIR-----------------------
 146 GL.EALTTYKWIGYGDN--------------------------
 147 GL.EALTTYKWIGYGDDLI------------------------
 148 GL.EALTTYKWVCVGDYC-------------------------
 149 GL.EALTTYKWLAWGD---------------------------
 150 GL.EGLTSQKWVVLGDGHVR-----------------------
 151 GL.TELTSTKYIIFGDGQIR-----------------------
 152 GL.TELTSTKYIIFGDGQIR-----------------------
 153 GL.EGLTSQKWIVYGHGE-------------------------
 154 GL.DALTTYKWIGYGDDLV------------------------
 155 GL.EGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENLPVPQR--
 156 GL.EGLLTTKWLLRGQDHVVSDFSEH