CASP7 Target T0308
- 1. Protein Name
- ARL6
- 2. Organism Name
- Homo sapiens
- 3. Number of amino acids (approx)
- 165
- 4. Accession number
- ARL6_HUMAN
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
EVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRY
RNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRD
AVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQI
- 7. Additional information
- Ligand bound: GTP. Crystal pH 5.5. Trimer in unit-cell.
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Complete. Structure deposited in PDB with 4 week hold.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- n/a
- 12. Estimated date of public release of structure
- 27-Jun-06
Related Files
Template Sequence file Template PDB file