CASP7 Target T0304
- 1. Protein Name
- NESG:Hunt:1
- 2. Organism Name
- Escherichia coli
- 3. Number of amino acids (approx)
- 130
- 4. Accession number
- YEEU_ECOLI
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
-
MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAY
HLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
- 7. Additional information
- monomer
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- in-pdb on hold
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- 6/26/2006
- 12. Estimated date of public release of structure
- 7/30/2006
Related Files
Template Sequence file Template PDB file