PFRMAT RR TARGET T0301 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 MAHPPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFMRVIGS PDPYAAHIDGMGGATSSTSKCVILSKSSQPGHDVDYLYGQVSIDKPFVDW SGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVP VSGGQVQETGDFELDGVTFPAAEIVLEFLDPSD 9 23 0 8 0.294711650856 9 24 0 8 0.259961208083 9 74 0 8 0.263269208495 9 86 0 8 0.544237303977 11 22 0 8 0.261405225571 11 23 0 8 0.263763993491 11 72 0 8 0.279902878531 11 93 0 8 0.2816271321 12 22 0 8 0.261627081828 12 23 0 8 0.263608173627 13 22 0 8 0.42478469122 13 23 0 8 0.505491963973 13 24 0 8 0.397306096181 14 23 0 8 0.346395276847 14 24 0 8 0.3387119909 14 72 0 8 0.32677562766 15 24 0 8 0.263957548437 15 60 0 8 0.264858636169 18 60 0 8 0.281481250991 19 60 0 8 0.2882311749 23 72 0 8 0.347826096246 24 86 0 8 0.270357708333 43 109 0 8 0.431117716162 44 72 0 8 0.46824682338 44 73 0 8 0.262446193347 44 84 0 8 0.284466717087 44 109 0 8 0.273295683168 45 136 0 8 0.320713095346 48 73 0 8 0.379525988691 57 74 0 8 0.260543824736 58 71 0 8 0.25908126501 58 72 0 8 0.263927295311 58 73 0 8 0.305578120192 58 74 0 8 0.26038507715 59 69 0 8 0.259526929339 59 70 0 8 0.264731768221 60 69 0 8 0.261876588792 60 70 0 8 0.339206316481 60 72 0 8 0.261296899861 61 74 0 8 0.268848769784 70 83 0 8 0.295373853199 70 84 0 8 0.264444526175 70 85 0 8 0.308740897959 70 86 0 8 0.305982925481 70 88 0 8 0.289496685714 70 90 0 8 0.353032402999 70 91 0 8 0.299747335411 70 105 0 8 0.270177045977 70 106 0 8 0.260854163254 71 84 0 8 0.390452568391 71 85 0 8 0.437150109814 71 86 0 8 0.321383906924 71 87 0 8 0.453177567644 71 88 0 8 0.372859926316 71 89 0 8 0.353770378774 71 91 0 8 0.397820589816 71 93 0 8 0.261893829821 71 98 0 8 0.361732049315 72 83 0 8 0.295050392723 72 84 0 8 0.408986377215 72 86 0 8 0.35518737237 72 88 0 8 0.396946405941 72 89 0 8 0.331519410204 72 91 0 8 0.429062258709 72 93 0 8 0.279182701778 72 134 0 8 0.319235114994 73 83 0 8 0.260414354369 73 84 0 8 0.571893057188 73 86 0 8 0.483109025494 73 87 0 8 0.60167081414 73 88 0 8 0.441340111936 73 89 0 8 0.395997096888 73 91 0 8 0.537268289373 73 93 0 8 0.27839923803 73 98 0 8 0.32340615418 73 111 0 8 0.259355820261 73 121 0 8 0.259214639006 73 134 0 8 0.467818841169 73 136 0 8 0.438620596817 74 84 0 8 0.546867029432 74 86 0 8 0.383274897356 74 87 0 8 0.517865101788 74 88 0 8 0.413821829684 74 89 0 8 0.352268521087 74 91 0 8 0.39264108292 74 93 0 8 0.263702511332 74 98 0 8 0.264339128188 74 134 0 8 0.264487140793 74 136 0 8 0.462706505718 84 93 0 8 0.343697608867 84 98 0 8 0.281898054161 84 111 0 8 0.259125831443 84 120 0 8 0.2621052764 84 134 0 8 0.260103690548 84 136 0 8 0.349588367661 85 105 0 8 0.260129714742 86 98 0 8 0.26622784195 86 105 0 8 0.286731970706 86 134 0 8 0.262310542234 87 137 0 8 0.262599410792 87 139 0 8 0.310892501775 87 156 0 8 0.259566616236 87 174 0 8 0.302639582166 88 98 0 8 0.397042019802 88 99 0 8 0.267563635155 88 105 0 8 0.260393209711 88 109 0 8 0.348516906641 88 111 0 8 0.39618149505 88 133 0 8 0.264817973365 88 134 0 8 0.377765193861 88 136 0 8 0.338437962588 89 98 0 8 0.268344597122 89 100 0 8 0.320205012401 89 148 0 8 0.27737492735 90 99 0 8 0.299210776808 90 105 0 8 0.287949551402 91 107 0 8 0.266578137371 91 111 0 8 0.260496005279 91 121 0 8 0.259900701831 91 134 0 8 0.46120905298 91 136 0 8 0.264681021042 91 149 0 8 0.266750949778 93 134 0 8 0.26006920849 98 134 0 8 0.261063658019 98 136 0 8 0.260717536233 98 149 0 8 0.262959520582 104 113 0 8 0.263185605771 104 115 0 8 0.259005144241 104 140 0 8 0.260892223638 104 160 0 8 0.262913978241 104 166 0 8 0.263313774928 105 114 0 8 0.260309606986 105 115 0 8 0.260484944996 107 164 0 8 0.264696960861 110 136 0 8 0.265159215614 111 121 0 8 0.285230138482 112 121 0 8 0.260222751237 112 132 0 8 0.261816733145 112 134 0 8 0.263053207682 112 149 0 8 0.319787248027 114 136 0 8 0.268496539568 115 134 0 8 0.260710704882 116 134 0 8 0.265068456236 116 136 0 8 0.496092029084 116 149 0 8 0.259900051227 121 134 0 8 0.294286378129 132 145 0 8 0.265107492528 132 149 0 8 0.383441477449 133 146 0 8 0.298341917706 133 148 0 8 0.335343106472 133 159 0 8 0.262804351323 134 144 0 8 0.264750310459 134 145 0 8 0.379852560582 134 146 0 8 0.448978871231 134 148 0 8 0.41626896837 134 149 0 8 0.381471486781 134 150 0 8 0.261797865604 134 158 0 8 0.445942273378 134 176 0 8 0.262362915925 135 150 0 8 0.262473844054 135 160 0 8 0.273774019802 136 145 0 8 0.420254620507 136 146 0 8 0.558417628123 136 147 0 8 0.468971797658 136 149 0 8 0.349556646776 136 160 0 8 0.286668684421 136 164 0 8 0.263734065668 136 174 0 8 0.323586877307 136 176 0 8 0.297303010139 137 147 0 8 0.329306569399 137 148 0 8 0.263751306697 137 149 0 8 0.262236698582 137 162 0 8 0.265934295652 145 156 0 8 0.283325497199 145 162 0 8 0.264033669206 145 176 0 8 0.297603278834 148 158 0 8 0.330509911475 148 177 0 8 0.262160903116 149 167 0 8 0.261425394321 156 174 0 8 0.262234096163 162 174 0 8 0.349799840231 162 176 0 8 0.264653370335 167 176 0 8 0.262049649685 END