PFRMAT RR
TARGET T0301
AUTHOR 5370-1100-4902
REMARK From group SAM-TO6 under the direction of
REMARK Kevin Karplus.
REMARK Residue-residue contact predictions
REMARK  by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network.
METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net
METHOD Inputs may include separation and sequence length,
METHOD e-value statistic based on mutual information values,
METHOD a statistic based on propensity of residues in contact.
METHOD Other inputs are distributions from alignments and
METHOD secondary predictions from SAM-t04 and/or SAM-t06 of
METHOD the University of California, Santa Cruz
MODEL 1
FLDPSDDGEDGGAIFPTGNLVDDLEVPGVGTFKATMINAGIPTVFVNAEE
IGYRGTELREEINGDPQQLARFERIRVAGALRMGLIKTPEEAATRQHTPK
IAFVAPPRDYRTASGKLVAAGDIDLLVRALSMGKLHHAMMGTAAVAIGTA
AAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIMS
RSARILMEGWVRVPGDAF
180 194 0 8 0.237061868819
180 195 0 8 0.131459916843
180 205 0 8 0.130128779299
180 210 0 8 0.222601199894
180 211 0 8 0.122360557268
180 212 0 8 0.167295557845
180 215 0 8 0.123059306888
180 224 0 8 0.101813154573
180 299 0 8 0.0986922030585
181 194 0 8 0.227507085842
181 196 0 8 0.205683196411
181 197 0 8 0.216365152309
181 199 0 8 0.209631066703
181 200 0 8 0.207373467838
181 201 0 8 0.218386906912
181 202 0 8 0.163027589962
181 203 0 8 0.135972837455
181 204 0 8 0.129814862454
181 206 0 8 0.119525546589
181 207 0 8 0.145858453004
181 209 0 8 0.183385991945
181 212 0 8 0.15525383779
181 213 0 8 0.123288319798
181 218 0 8 0.13176472522
181 224 0 8 0.133652780524
181 231 0 8 0.122290942548
181 299 0 8 0.0883680798344
182 192 0 8 0.217560638739
182 193 0 8 0.197910094844
182 194 0 8 0.233937013675
182 195 0 8 0.168134838115
182 197 0 8 0.0900141101307
182 198 0 8 0.189333496275
182 199 0 8 0.15900067118
182 202 0 8 0.170812077114
182 204 0 8 0.123433729985
182 207 0 8 0.115884436489
182 208 0 8 0.201590566538
182 210 0 8 0.1025262175
182 212 0 8 0.135377208706
182 213 0 8 0.114275165368
182 216 0 8 0.157060242184
182 251 0 8 0.119798800631
182 274 0 8 0.121652048575
183 194 0 8 0.241263149704
183 198 0 8 0.131650218764
183 199 0 8 0.121403517518
183 203 0 8 0.106170255322
183 206 0 8 0.161335692023
183 207 0 8 0.0982019722964
183 210 0 8 0.174689356779
183 212 0 8 0.0915274170356
183 218 0 8 0.0986782150541
183 224 0 8 0.100759500002
184 193 0 8 0.200769503205
184 195 0 8 0.142810043931
184 196 0 8 0.189459713617
184 199 0 8 0.180102714518
184 200 0 8 0.200992985974
184 201 0 8 0.120746731912
184 202 0 8 0.127350371243
184 204 0 8 0.109358544439
184 206 0 8 0.10389834315
184 209 0 8 0.121341059452
184 210 0 8 0.227930954908
184 211 0 8 0.106865751917
184 215 0 8 0.0993402054993
184 224 0 8 0.0931932907801
184 274 0 8 0.0987299381404
185 194 0 8 0.228216895744
185 196 0 8 0.124827650898
185 199 0 8 0.118433831634
185 200 0 8 0.169649771532
185 203 0 8 0.1500880352
185 205 0 8 0.110359500017
185 206 0 8 0.114933252184
185 207 0 8 0.0987351429793
185 208 0 8 0.183649486913
185 210 0 8 0.205821449944
185 212 0 8 0.0895261564856
185 217 0 8 0.106596726808
185 218 0 8 0.0998727255774
185 224 0 8 0.109555352409
185 274 0 8 0.10700270424
185 299 0 8 0.0892688422634
186 195 0 8 0.106930487101
186 200 0 8 0.176294398969
186 210 0 8 0.202855992991
186 218 0 8 0.0980350921497
186 274 0 8 0.0980858393288
187 196 0 8 0.157809413681
187 208 0 8 0.139076873243
187 211 0 8 0.0999686897943
187 224 0 8 0.11199707245
187 231 0 8 0.104174850215
188 197 0 8 0.236130527962
188 202 0 8 0.226458961412
188 205 0 8 0.122880065249
188 207 0 8 0.139023848947
188 210 0 8 0.230174240466
188 211 0 8 0.170395039399
189 208 0 8 0.221865365797
189 212 0 8 0.164243245143
189 216 0 8 0.214674555579
189 274 0 8 0.129405306694
190 199 0 8 0.214525567066
190 203 0 8 0.211888665568
190 206 0 8 0.139838731535
190 211 0 8 0.194057212862
190 212 0 8 0.232403863322
190 231 0 8 0.131694459895
190 242 0 8 0.0915547424397
191 205 0 8 0.131975521194
191 212 0 8 0.260005123911
191 224 0 8 0.158566717738
192 204 0 8 0.117622527373
192 206 0 8 0.122437003339
192 207 0 8 0.111351672428
192 208 0 8 0.201621795572
192 210 0 8 0.224971028097
192 215 0 8 0.247458859787
192 224 0 8 0.117468984626
192 299 0 8 0.0931867847315
193 208 0 8 0.244101738709
193 211 0 8 0.203252211351
193 212 0 8 0.208079374112
193 218 0 8 0.206042004992
194 204 0 8 0.226720504566
194 206 0 8 0.233006974028
194 207 0 8 0.231252943325
194 212 0 8 0.19111322587
194 213 0 8 0.221171170411
194 215 0 8 0.253286652823
194 217 0 8 0.232281874911
194 218 0 8 0.211384772104
194 224 0 8 0.230543458725
194 231 0 8 0.200607502595
194 243 0 8 0.102109830389
194 251 0 8 0.132289763342
194 299 0 8 0.143791481363
195 210 0 8 0.226969360925
195 213 0 8 0.192471038213
195 215 0 8 0.192696798099
196 207 0 8 0.214537603256
196 208 0 8 0.24197751384
196 218 0 8 0.154295171528
196 251 0 8 0.0876426554153
197 206 0 8 0.199713896819
197 224 0 8 0.191499359854
197 231 0 8 0.100552607656
197 242 0 8 0.0955904443875
197 299 0 8 0.0890785403418
198 210 0 8 0.264603599063
198 214 0 8 0.233885615891
198 217 0 8 0.22181364271
198 224 0 8 0.127396238886
199 210 0 8 0.368060041455
199 212 0 8 0.258571516102
199 213 0 8 0.315913930958
199 216 0 8 0.247440642851
199 218 0 8 0.21519536477
199 224 0 8 0.190229704469
199 231 0 8 0.132963139372
199 243 0 8 0.0898986277681
199 251 0 8 0.0990552405705
199 299 0 8 0.106659510177
200 209 0 8 0.292582205534
200 218 0 8 0.221438894311
200 231 0 8 0.205954173336
200 251 0 8 0.0911884519034
201 211 0 8 0.13506589428
201 231 0 8 0.136057416087
201 274 0 8 0.110886489953
202 211 0 8 0.20712200906
202 231 0 8 0.121998495663
202 274 0 8 0.0910967166181
203 212 0 8 0.22160609976
203 214 0 8 0.189175073991
203 218 0 8 0.202687486333
203 224 0 8 0.122697245283
203 242 0 8 0.133579587477
205 231 0 8 0.113995079975
206 217 0 8 0.145802500986
206 218 0 8 0.135690474946
206 224 0 8 0.158859164623
206 251 0 8 0.107023198293
206 274 0 8 0.099029866981
206 299 0 8 0.089452312834
207 216 0 8 0.178513937449
207 218 0 8 0.123138030076
207 224 0 8 0.118400000181
207 231 0 8 0.172242757202
208 218 0 8 0.144541628767
208 224 0 8 0.223463901938
209 224 0 8 0.208259266355
209 231 0 8 0.18164237092
209 242 0 8 0.0924629868245
209 251 0 8 0.0902668701189
209 274 0 8 0.202724245507
209 299 0 8 0.101137826728
210 231 0 8 0.20464027682
212 224 0 8 0.23147187186
212 299 0 8 0.0942030295232
213 224 0 8 0.253593413014
213 231 0 8 0.115112819125
213 251 0 8 0.111249852768
214 224 0 8 0.291372304403
215 224 0 8 0.353749842635
217 251 0 8 0.117685310742
218 251 0 8 0.0989182882475
218 299 0 8 0.0949053574697
224 251 0 8 0.104502755065
224 274 0 8 0.164699644453
224 299 0 8 0.0950091289449
231 274 0 8 0.120522273235
242 274 0 8 0.0943699096698
251 274 0 8 0.095053044773
274 299 0 8 0.108609698245
END