CASP7 Target T0299
- 1. Protein Name
- SP0830
- 2. Organism Name
- Streptococcus pneumoniae TIGR4
- 3. Number of amino acids (approx)
- 180
- 4. Accession number
- AAK74961
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
MTRYALLVRGINVGGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSL
LSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYH
KYLLKVPFYRHITIRNAKTFDKIGQMLKK
- 7. Additional information
- Noone
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- MCSG target APC80351, a 1.4A crystal structure, is in refinement.
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- done
- 12. Estimated date of public release of structure
- before 1st September, 2006
Related Files
Template Sequence file Template PDB file