PFRMAT RR TARGET T0289 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 STSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPF ITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFG PKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLP CSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKH 10 44 0 8 0.258845420748 10 45 0 8 0.256929714737 10 46 0 8 0.253136688402 12 46 0 8 0.362656509589 12 48 0 8 0.258449527691 12 109 0 8 0.253641883076 13 33 0 8 0.263601342276 13 44 0 8 0.263248063837 13 45 0 8 0.361842745205 13 47 0 8 0.498810486206 13 49 0 8 0.447435054676 13 108 0 8 0.316756363029 13 110 0 8 0.258471648256 13 111 0 8 0.394274409639 13 112 0 8 0.255798638188 14 29 0 8 0.386057181416 14 33 0 8 0.284067165266 14 45 0 8 0.360553287671 14 47 0 8 0.604612096151 14 48 0 8 0.357377508079 14 49 0 8 0.428510046259 14 50 0 8 0.43463433687 14 51 0 8 0.262854773199 14 108 0 8 0.396081328147 14 109 0 8 0.353893595608 14 110 0 8 0.272801663366 14 111 0 8 0.452444965941 14 112 0 8 0.3634216 15 29 0 8 0.271011297602 15 30 0 8 0.259852882374 15 33 0 8 0.257881224345 15 47 0 8 0.42043265822 15 48 0 8 0.259078987893 15 49 0 8 0.563150913433 15 50 0 8 0.339834271642 15 51 0 8 0.260609535827 15 111 0 8 0.426331874929 15 112 0 8 0.487462679354 16 29 0 8 0.279967341808 16 47 0 8 0.262364217135 16 50 0 8 0.299576612219 16 51 0 8 0.416680986618 16 52 0 8 0.383209713841 16 111 0 8 0.674020904792 16 112 0 8 0.26421226024 16 113 0 8 0.340968755224 17 30 0 8 0.397023807638 17 49 0 8 0.391197594614 17 50 0 8 0.514080109862 17 112 0 8 0.337755578362 17 113 0 8 0.263321256884 18 27 0 8 0.446831137455 18 51 0 8 0.457632871334 18 113 0 8 0.262797845274 19 29 0 8 0.3402458 19 33 0 8 0.264289356916 19 49 0 8 0.29852788404 19 50 0 8 0.314067528193 19 51 0 8 0.434913375066 19 52 0 8 0.391759946137 19 72 0 8 0.253148724592 19 113 0 8 0.289593942857 20 49 0 8 0.252295456318 20 50 0 8 0.357522122083 20 51 0 8 0.410527181013 20 52 0 8 0.361055906849 20 53 0 8 0.286135619174 20 54 0 8 0.264637430516 20 55 0 8 0.254612260225 20 56 0 8 0.25586044565 20 65 0 8 0.257864959224 20 69 0 8 0.253316255344 20 70 0 8 0.276941650997 20 113 0 8 0.364926785714 20 114 0 8 0.257762814261 20 115 0 8 0.261130995622 21 30 0 8 0.263066870384 21 32 0 8 0.255795710466 21 33 0 8 0.252531951185 21 51 0 8 0.305097669471 21 52 0 8 0.258326888675 21 54 0 8 0.252701433751 21 55 0 8 0.259424133771 21 56 0 8 0.312149257876 21 57 0 8 0.257197438637 21 61 0 8 0.2556128905 21 118 0 8 0.253708244772 22 32 0 8 0.276018230769 22 60 0 8 0.255755698267 23 51 0 8 0.255466504407 23 53 0 8 0.25370791947 23 55 0 8 0.253134085983 23 70 0 8 0.253344881958 24 55 0 8 0.277810307798 24 92 0 8 0.290866391195 26 56 0 8 0.253478581256 26 111 0 8 0.261302430003 29 49 0 8 0.264093850155 29 92 0 8 0.272887920792 29 111 0 8 0.256130446667 30 47 0 8 0.257947586041 30 49 0 8 0.317828064588 30 51 0 8 0.314981958573 33 47 0 8 0.308792801921 33 49 0 8 0.420643665881 34 45 0 8 0.25984702693 34 47 0 8 0.305637409856 34 49 0 8 0.325221991314 37 49 0 8 0.252330263678 45 108 0 8 0.252425902593 46 108 0 8 0.254438223425 47 56 0 8 0.25708943823 47 63 0 8 0.253193616328 47 108 0 8 0.416984798054 47 111 0 8 0.572835356795 48 108 0 8 0.360523369863 48 111 0 8 0.264469899765 48 112 0 8 0.262860953945 49 110 0 8 0.264147525056 49 111 0 8 0.504691604998 49 112 0 8 0.393765785967 50 111 0 8 0.409002596203 50 112 0 8 0.506920452775 51 111 0 8 0.338244530839 51 112 0 8 0.510435953586 52 66 0 8 0.260649222723 52 68 0 8 0.259337278022 52 70 0 8 0.290322057143 52 71 0 8 0.256997702945 52 92 0 8 0.257176619282 52 112 0 8 0.442340034747 53 62 0 8 0.28829518024 53 65 0 8 0.367926226734 53 66 0 8 0.262850218965 53 67 0 8 0.261586419024 53 69 0 8 0.264000488358 53 70 0 8 0.362954371429 53 71 0 8 0.260662885425 53 72 0 8 0.252773325588 53 112 0 8 0.30571509976 53 113 0 8 0.337591698686 53 114 0 8 0.263936078477 53 115 0 8 0.260032124013 54 65 0 8 0.265292264308 54 69 0 8 0.253602846785 54 70 0 8 0.256114506847 54 71 0 8 0.260297570796 55 71 0 8 0.253485412607 56 65 0 8 0.274407900826 56 66 0 8 0.255224479399 56 71 0 8 0.351488791003 56 92 0 8 0.468669729402 56 95 0 8 0.252509180015 57 68 0 8 0.261841781432 57 92 0 8 0.260490149835 57 111 0 8 0.306369330529 62 71 0 8 0.25448571758 67 113 0 8 0.275437173554 69 111 0 8 0.252445420738 69 112 0 8 0.253706292957 69 113 0 8 0.359883128767 69 114 0 8 0.257614476353 69 115 0 8 0.256525689119 69 177 0 8 0.263385666765 70 79 0 8 0.257342848824 70 80 0 8 0.258211406312 70 81 0 8 0.256683135495 70 88 0 8 0.252970784163 70 112 0 8 0.263012544878 70 113 0 8 0.395193485149 70 115 0 8 0.262623157869 70 177 0 8 0.263833608211 71 80 0 8 0.254328921809 71 92 0 8 0.257534777257 71 117 0 8 0.254744658314 95 111 0 8 0.254792477772 112 124 0 8 0.252241130812 112 126 0 8 0.260750717081 112 174 0 8 0.258688950279 112 176 0 8 0.292022415094 113 126 0 8 0.26545849385 114 125 0 8 0.259616387508 114 126 0 8 0.266083053176 114 127 0 8 0.25962614658 114 176 0 8 0.294760957839 115 124 0 8 0.261678804914 115 125 0 8 0.263890210834 115 126 0 8 0.299491250623 115 127 0 8 0.273852435644 115 128 0 8 0.276451507123 115 129 0 8 0.25245908344 115 154 0 8 0.262615675913 115 155 0 8 0.256548460289 115 177 0 8 0.260144678654 115 179 0 8 0.285911683089 116 128 0 8 0.261462478798 116 180 0 8 0.252849771659 117 126 0 8 0.259153807452 176 194 0 8 0.25999016 178 194 0 8 0.255431371744 END