PFRMAT RR TARGET T0289 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 STSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPF ITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFG PKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLP CSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKH ALDFIQRFNEGKEF 10 45 0 8 0.253302267339 10 46 0 8 0.256566351923 11 45 0 8 0.26093125993 12 46 0 8 0.315983244989 12 108 0 8 0.286142921438 13 33 0 8 0.258284274056 13 45 0 8 0.382713594868 13 46 0 8 0.340612838806 13 47 0 8 0.299430278055 13 48 0 8 0.255877361376 13 108 0 8 0.286218378162 13 110 0 8 0.260841151157 13 111 0 8 0.369763137902 13 112 0 8 0.301171340127 14 29 0 8 0.335395215031 14 33 0 8 0.259976171995 14 45 0 8 0.365432457143 14 47 0 8 0.39104357477 14 48 0 8 0.294002862978 14 49 0 8 0.324903574376 14 108 0 8 0.402323084806 14 110 0 8 0.257774525148 14 111 0 8 0.539166728376 14 112 0 8 0.355123482159 15 29 0 8 0.287778870494 15 30 0 8 0.252574891106 15 33 0 8 0.25790724854 15 47 0 8 0.323394679696 15 48 0 8 0.375476475304 15 49 0 8 0.300424130923 15 111 0 8 0.397312925743 15 112 0 8 0.475116857835 16 47 0 8 0.381297664075 16 49 0 8 0.324232317047 16 52 0 8 0.266517419498 16 111 0 8 0.667860553024 16 112 0 8 0.287802339119 16 113 0 8 0.280754714689 17 26 0 8 0.25724200507 17 30 0 8 0.334310705637 17 48 0 8 0.327779108511 17 49 0 8 0.426840260994 17 50 0 8 0.264058392191 17 112 0 8 0.338462141557 17 113 0 8 0.256317820866 17 114 0 8 0.254247596201 18 27 0 8 0.33550594572 18 51 0 8 0.459836103122 18 52 0 8 0.263579872316 18 56 0 8 0.25032119587 18 113 0 8 0.261484599364 19 29 0 8 0.273297643564 19 33 0 8 0.255565071043 19 48 0 8 0.26230338558 19 49 0 8 0.259886713827 19 51 0 8 0.344342002956 19 52 0 8 0.261713286972 19 113 0 8 0.274586785124 20 48 0 8 0.263477727353 20 49 0 8 0.288399722296 20 50 0 8 0.26380270448 20 51 0 8 0.319674866967 20 52 0 8 0.264982576394 20 53 0 8 0.26485343133 20 54 0 8 0.262024601398 20 55 0 8 0.251181620797 20 65 0 8 0.258984650188 20 69 0 8 0.252531625882 20 70 0 8 0.264532357831 20 113 0 8 0.326882057447 20 114 0 8 0.255349395532 20 115 0 8 0.262463109073 21 30 0 8 0.254282078259 21 32 0 8 0.259816773804 21 33 0 8 0.258286876476 21 51 0 8 0.290387771429 21 55 0 8 0.269869685345 21 56 0 8 0.259617038112 21 57 0 8 0.25146040498 21 61 0 8 0.257731585228 21 71 0 8 0.252202745126 22 32 0 8 0.379680857835 22 55 0 8 0.250296472885 22 61 0 8 0.254759296924 23 53 0 8 0.254935936143 23 54 0 8 0.253152302919 23 55 0 8 0.252357914385 23 70 0 8 0.250606811403 24 55 0 8 0.263693077562 26 55 0 8 0.255120707924 26 56 0 8 0.265997043478 30 47 0 8 0.25660213519 30 51 0 8 0.25575342115 30 112 0 8 0.264037247533 34 45 0 8 0.25880020371 34 47 0 8 0.272124073343 45 108 0 8 0.263867764967 46 108 0 8 0.258738396249 46 111 0 8 0.257008763228 47 108 0 8 0.262973508586 47 111 0 8 0.353311330834 48 108 0 8 0.330021920219 48 111 0 8 0.335678555324 49 111 0 8 0.257176619282 49 112 0 8 0.332980093878 50 65 0 8 0.311987035006 50 70 0 8 0.255284660348 50 111 0 8 0.295913603513 50 112 0 8 0.380182499192 50 113 0 8 0.255261238573 51 112 0 8 0.256744942957 52 61 0 8 0.250216123185 52 63 0 8 0.254114547507 52 66 0 8 0.257246559304 52 68 0 8 0.255883867425 52 70 0 8 0.256730954953 52 71 0 8 0.257655139156 52 112 0 8 0.393099560595 52 117 0 8 0.250030050195 53 62 0 8 0.257435234714 53 65 0 8 0.37137668502 53 66 0 8 0.261478093315 53 67 0 8 0.261376273654 53 69 0 8 0.263560679472 53 70 0 8 0.394532303331 53 71 0 8 0.260331402249 53 112 0 8 0.262984568869 53 113 0 8 0.339871346269 53 114 0 8 0.259071180635 53 115 0 8 0.254374789451 53 177 0 8 0.249701169438 53 179 0 8 0.25006550816 54 65 0 8 0.265005022262 54 69 0 8 0.254081691962 54 70 0 8 0.25577749353 55 71 0 8 0.254862743096 56 65 0 8 0.257955718602 56 66 0 8 0.253406038814 56 71 0 8 0.284104623249 56 91 0 8 0.377950363489 56 92 0 8 0.397087550212 56 111 0 8 0.258349659845 57 68 0 8 0.253011772269 57 111 0 8 0.268466611511 62 71 0 8 0.252848470449 67 113 0 8 0.26259388065 68 92 0 8 0.25120601848 69 87 0 8 0.256144109369 69 88 0 8 0.252658168528 69 111 0 8 0.253754112415 69 112 0 8 0.252144841293 69 113 0 8 0.332599636735 69 114 0 8 0.255357528093 69 115 0 8 0.25725534247 69 177 0 8 0.261896106938 70 80 0 8 0.250987089944 70 81 0 8 0.256932967762 70 87 0 8 0.253242736995 70 88 0 8 0.256296350906 70 92 0 8 0.252864735571 70 112 0 8 0.262951062718 70 113 0 8 0.358871852783 70 115 0 8 0.259826207575 70 177 0 8 0.262547687705 71 91 0 8 0.265486144556 71 92 0 8 0.357232894075 92 108 0 8 0.305854123798 95 108 0 8 0.254229053963 111 123 0 8 0.259576375309 111 125 0 8 0.256558869967 111 127 0 8 0.286198905459 111 174 0 8 0.384574946345 111 201 0 8 0.263194388936 112 123 0 8 0.258472298861 112 125 0 8 0.257061787524 112 126 0 8 0.296112356336 112 174 0 8 0.284531644258 112 176 0 8 0.294532913043 113 126 0 8 0.264720382636 114 123 0 8 0.256932967762 114 125 0 8 0.258333394723 114 126 0 8 0.260720789258 114 127 0 8 0.264911335162 114 176 0 8 0.262102348678 115 124 0 8 0.262240602211 115 125 0 8 0.265353746467 115 126 0 8 0.290602436478 115 127 0 8 0.265330324692 115 128 0 8 0.302442866242 115 129 0 8 0.250718064835 115 153 0 8 0.249971170455 115 154 0 8 0.249773061275 115 155 0 8 0.256677605354 115 173 0 8 0.251528067885 115 176 0 8 0.252296106923 115 177 0 8 0.258221165385 115 179 0 8 0.29542061857 116 125 0 8 0.255102165685 116 126 0 8 0.265315035478 116 155 0 8 0.254702694301 116 180 0 8 0.252162082322 117 126 0 8 0.255245949359 117 163 0 8 0.2501914002 166 178 0 8 0.250675775519 174 186 0 8 0.250880065445 174 198 0 8 0.251467886936 176 186 0 8 0.259878581266 176 198 0 8 0.252068069919 176 201 0 8 0.265248673782 177 186 0 8 0.253423930448 178 191 0 8 0.25884704726 178 198 0 8 0.251495537642 178 201 0 8 0.252018949253 191 201 0 8 0.2662698774 END