PFRMAT RR TARGET T0289 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 STSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPF ITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFG PKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLP CSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKH ALDFIQRFNEGKEF 4 13 0 8 0.483888605386 4 14 0 8 0.56961084022 4 15 0 8 0.50687992827 13 29 0 8 0.472646210016 13 30 0 8 0.473624550485 13 33 0 8 0.482137549013 13 34 0 8 0.465242153748 13 47 0 8 0.631998699764 13 48 0 8 0.625457070699 13 49 0 8 0.584720314847 13 110 0 8 0.620042933071 13 111 0 8 0.62825128861 13 112 0 8 0.631159889709 13 176 0 8 0.524378808824 14 23 0 8 0.53610597978 14 24 0 8 0.528235319493 14 25 0 8 0.526524371107 14 27 0 8 0.546242288025 14 29 0 8 0.639264755695 14 30 0 8 0.637554454674 14 33 0 8 0.645893533857 14 34 0 8 0.57173509945 14 47 0 8 0.674244224352 14 48 0 8 0.645784597486 14 49 0 8 0.62023357172 14 57 0 8 0.519532038639 14 68 0 8 0.50977743038 14 95 0 8 0.51363449308 14 110 0 8 0.660463773449 14 111 0 8 0.680649682954 14 112 0 8 0.650359925059 14 175 0 8 0.50901759591 14 176 0 8 0.557301030322 15 24 0 8 0.554730131972 15 25 0 8 0.549211020445 15 26 0 8 0.531117734442 15 27 0 8 0.545883909234 15 29 0 8 0.64420502011 15 30 0 8 0.641045865357 15 33 0 8 0.651057117832 15 34 0 8 0.607362739513 15 37 0 8 0.522568834487 15 42 0 8 0.468809492326 15 45 0 8 0.484590227289 15 46 0 8 0.480116638061 15 47 0 8 0.697158989945 15 48 0 8 0.659123856088 15 49 0 8 0.670480472742 15 56 0 8 0.483864618312 15 57 0 8 0.553417448704 15 68 0 8 0.526942480681 15 92 0 8 0.466825101652 15 95 0 8 0.576179703378 15 110 0 8 0.694539070228 15 111 0 8 0.689435401257 15 112 0 8 0.694185027023 15 114 0 8 0.509443103213 15 125 0 8 0.52446133045 15 142 0 8 0.462252141042 15 174 0 8 0.53776227095 15 175 0 8 0.550906055268 15 176 0 8 0.612727855774 15 198 0 8 0.496799457644 15 201 0 8 0.475261129241 15 202 0 8 0.552807405027 16 27 0 8 0.475603773829 16 33 0 8 0.554092854203 16 47 0 8 0.574017316418 16 111 0 8 0.537147215457 16 112 0 8 0.6059193326 17 30 0 8 0.57035705436 17 48 0 8 0.538682432712 17 112 0 8 0.581697330558 19 111 0 8 0.462498377382 20 29 0 8 0.452341859035 29 42 0 8 0.459027527909 33 42 0 8 0.495978090485 33 57 0 8 0.462973261753 45 111 0 8 0.45962446263 47 110 0 8 0.606997802671 47 111 0 8 0.611153725216 47 112 0 8 0.614961051375 47 176 0 8 0.484668185278 48 57 0 8 0.543631934397 48 68 0 8 0.528020763264 48 95 0 8 0.478259269386 48 110 0 8 0.635304918617 48 111 0 8 0.645032936528 48 112 0 8 0.639014202042 48 176 0 8 0.55782937172 49 59 0 8 0.476117740711 49 63 0 8 0.459912076632 49 68 0 8 0.508759252191 49 95 0 8 0.50309088705 49 110 0 8 0.652228183818 49 111 0 8 0.655392785389 49 112 0 8 0.651765204242 49 114 0 8 0.460129143803 49 175 0 8 0.464098913596 49 176 0 8 0.560667164179 50 68 0 8 0.45909807474 50 111 0 8 0.583053588374 50 112 0 8 0.565155342655 51 68 0 8 0.476974352181 51 110 0 8 0.552725702749 51 111 0 8 0.590913347526 51 112 0 8 0.57893034674 52 68 0 8 0.465989656925 52 110 0 8 0.490802879354 52 111 0 8 0.576669917046 52 112 0 8 0.518849859862 56 68 0 8 0.453524875118 57 68 0 8 0.462381121982 57 111 0 8 0.455912614002 66 111 0 8 0.46904393336 68 95 0 8 0.482263481149 68 111 0 8 0.534144582341 68 112 0 8 0.482839170916 69 111 0 8 0.50909864492 70 111 0 8 0.485219887971 71 111 0 8 0.499798271016 71 112 0 8 0.464356875476 72 111 0 8 0.471235055331 99 110 0 8 0.490047286535 99 111 0 8 0.575150254674 99 112 0 8 0.532507662997 110 125 0 8 0.622967874627 110 126 0 8 0.577759280754 110 138 0 8 0.460888878903 110 142 0 8 0.470504681341 110 174 0 8 0.552415234093 110 175 0 8 0.550988385531 110 176 0 8 0.585542784446 111 120 0 8 0.471690411955 111 121 0 8 0.509701446933 111 123 0 8 0.517413983564 111 124 0 8 0.574436721445 111 125 0 8 0.672877072899 111 126 0 8 0.676324909034 111 127 0 8 0.567279601885 111 138 0 8 0.573510762294 111 139 0 8 0.530793489908 111 141 0 8 0.524917950115 111 142 0 8 0.611584023881 111 146 0 8 0.45916862157 111 164 0 8 0.453182994324 111 165 0 8 0.479260152262 111 166 0 8 0.452146498581 111 174 0 8 0.606687334014 111 175 0 8 0.659161983818 111 176 0 8 0.663470417282 111 177 0 8 0.550692965176 111 178 0 8 0.468412745961 111 191 0 8 0.468372169628 111 194 0 8 0.472731871163 111 198 0 8 0.549278821838 111 201 0 8 0.573167612726 111 202 0 8 0.563701042105 111 205 0 8 0.488973864991 112 121 0 8 0.552665787745 112 123 0 8 0.588816322388 112 124 0 8 0.546208387329 112 125 0 8 0.720672905577 112 126 0 8 0.693618557895 112 127 0 8 0.606616525373 112 135 0 8 0.522458805652 112 136 0 8 0.490880837343 112 138 0 8 0.569229562922 112 139 0 8 0.52540207699 112 141 0 8 0.519526537197 112 142 0 8 0.619008037549 112 146 0 8 0.463442283355 112 165 0 8 0.476352181745 112 166 0 8 0.461230759697 112 174 0 8 0.679740064258 112 175 0 8 0.65807262011 112 176 0 8 0.708684457973 112 177 0 8 0.550320057515 112 178 0 8 0.512314147059 112 190 0 8 0.460764065279 112 191 0 8 0.466449884371 112 194 0 8 0.474571331583 112 198 0 8 0.548949500786 112 201 0 8 0.578151451689 112 202 0 8 0.586539552239 112 205 0 8 0.510015511847 113 142 0 8 0.481447920646 113 176 0 8 0.464172198221 114 123 0 8 0.470414511712 114 125 0 8 0.534352829477 114 126 0 8 0.500644220058 114 142 0 8 0.463028958069 114 176 0 8 0.476951809774 165 174 0 8 0.464433091487 165 176 0 8 0.469954646607 175 198 0 8 0.502295593638 175 201 0 8 0.504701736125 175 202 0 8 0.478069913166 176 190 0 8 0.512985322953 176 191 0 8 0.462609770013 176 194 0 8 0.499995827978 176 198 0 8 0.560122482325 176 201 0 8 0.562382912019 176 202 0 8 0.554092854203 176 205 0 8 0.455315679281 177 190 0 8 0.461002839167 177 194 0 8 0.464899181703 177 198 0 8 0.470942004039 177 201 0 8 0.471920344507 177 202 0 8 0.46580497967 178 201 0 8 0.467719174079 178 202 0 8 0.461187346263 191 202 0 8 0.459732996216 198 208 0 8 0.470283765751 END