PFRMAT RR TARGET T0289 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 ALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQD WKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKL TLNAKSIRSTLH END